all | frequencies |
|
exhibits | applications |
---|---|---|---|---|
manual |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 |
|
User Manual | Users Manual | 2.79 MiB | ||||
1 | Parts List/Tune Up Info | |||||||
1 | Cover Letter(s) | |||||||
1 | External Photos | |||||||
1 | ID Label/Location Info | |||||||
1 | Internal Photos | |||||||
1 | RF Exposure Info | |||||||
1 | Operational Description | |||||||
1 | Cover Letter(s) | |||||||
1 | Test Report | |||||||
1 | Test Setup Photos |
1 | User Manual | Users Manual | 2.79 MiB |
Version 1.0 | 10/23/2012 User Manual HD Wireless Outdoor Cloud Camera DCS-2332L D-Link reserves the right to revise this publication and to make changes in the content hereof without obligation to notify any person or organization of such revisions or changes. Information in this document may become obsolete as our services and websites develop and change. Please refer to the www.mydlink.com website for the most current information. Preface Manual Revisions Revision 1.0 Date Description October 23, 2012 DCS-2332L Revision A1 with firmware version 1.00 Trademarks D-Link and the D-Link logo are trademarks or registered trademarks of D-Link Corporation or its subsidiaries in the United States or other countries. All other company or product names mentioned herein are trademarks or registered trademarks of their respective companies. Copyright 2012 D-Link Corporation. All rights reserved. This publication may not be reproduced, in whole or in part, without prior expressed written permission from D-Link Corporation. D-Link DCS-2332L User Manual 2 Table of Contents Product Overview ......................................................................... 4 Package Contents ................................................................. 4 Introduction ............................................................................ 5 System Requirements ......................................................... 5 Features .................................................................................... 6 Hardware Overview ............................................................. 7 Front ...................................................................................... 7 Rear: External ...................................................................... 8 Rear: Internal ...................................................................... 9 Removing the Top Panel ..................................................10 Replacing the Ethernet Cable ....................................11 Reattaching the Top Panel ...........................................12 Removing the Bottom Panel ..........................................13 Using the Reset Button .................................................13 Installing an SD Memory Card ...................................14 Reattaching the Bottom Panel ...................................14 Installation ....................................................................................16 Zero Configuration Setup ................................................16 Camera Installation Wizard .............................................19 Windows Users ....................................................................19 Mac Users...............................................................................20 Manual Hardware Installation ........................................21 SD Memory Card Installation .........................................22 mydlink ...........................................................................................23 Configuration ...............................................................................24 Using the Configuration Interface ................................24 Live Video ..............................................................................25 Setup .......................................................................................27 Setup Wizard ....................................................................27 Network Setup .................................................................33 Wireless Setup ..................................................................36 Dynamic DNS ...................................................................37 Image Setup .....................................................................38 Audio and Video ..............................................................40 Preset ...................................................................................42 Motion Detection ...........................................................44 Time and Date ..................................................................45 Event Setup .......................................................................46 SD Card ...............................................................................55 Advanced ...............................................................................56 ICR and IR ...........................................................................56 HTTPS ..................................................................................57 Access List ..........................................................................58 System ................................................................................59 Maintenance .........................................................................60 Device Management .....................................................60 Firmware Upgrade ..........................................................61 Status ......................................................................................62 Device Info ............................................................................62 Logs .....................................................................................63 Help......................................................................................64 Technical Specifications ...........................................................65 D-Link DCS-2332L User Manual 3 Section 1: Product Overview Product Overview Package Contents DCS-2332L HD Wireless Outdoor Cloud Camera CAT5 Ethernet cable (Pre-Attached) Power adapter (Pre-Attached) CD-ROM with User Manual and software Quick Installation Guide Antenna If any of the above items are missing, please contact your reseller. Note: Using a power supply with a different voltage than the one included with your product will cause damage and void the warranty for this product. D-Link DCS-2332L User Manual 4 Section 1: Product Overview Introduction Congratulations on your purchase of the DCS-2332L HD Wireless Outdoor Cloud Camera. The DCS-2332L is a versatile and unique solution for your small office or home. Unlike a standard webcam, the DCS-2332L is a complete system with a built-in CPU and web server that transmits high quality video images for security and outdoor surveillance. The DCS-2332L can be accessed remotely, and controlled from any PC/Notebook over your local network or through the Internet via a web browser. The simple installation and intuitive web-based interface offer easy integration with your Ethernet/Fast Ethernet or 802.11n/g wireless network. The DCS-2332L also comes with remote monitoring and motion detection features for a complete and cost-
effective home security solution. System Requirements Computer with Microsoft Windows 8/7/Vista/XP, or Mac with OS X 10.6 or higher PC with 1.3GHz or above and at least 128MB RAM Internet Explorer 7, Firefox 12, Safari 4, or Chrome 20 or higher version with Java installed and enabled Existing 10/100 Ethernet-based network or 802.11g/n wireless network D-Link DCS-2332L User Manual 5 Section 1: Product Overview Features Simple to Use The DCS-2332L is a stand-alone system with a built-in CPU, requiring no special hardware or software. The DCS-2332L supports both ActiveX mode for Internet Explorer and Java mode for other browsers such as Firefox and Safari. Supports a Variety of Platforms Supporting TCP/IP networking, HTTP, and other Internet related protocols. The DCS-2332L can also be integrated easily into other Internet/Intranet applications because of its standards-based features. Web Configuration Using a standard Web browser, administrators can configure and manage the Network Camera directly from its own Web page via Intranet or Internet. This means you can access your DCS-2332L anytime, anywhere in the world. Broad Range of Applications With todays high-speed Internet services, the Network Camera can provide the ideal solution for delivering live video images over the Intranet and Internet for remote monitoring. The Network Camera allows remote access using a Web browser for live image viewing, and allows the administrator to manage and control the Network Camera anytime, anywhere in the world. Many applications exist, including industrial and public monitoring of homes, offices, banks, hospitals, child-care centers, and amusement parks. Remote Monitoring Utility The D-ViewCam application adds enhanced features and functionality for the Network Camera and allows administrators to configure and access the Network Camera from a remote site via Intranet or Internet. Other features include image monitoring, recording images to a hard drive, viewing up to 32 cameras on one screen, and taking snapshots. IR LED for Day and Night Functionality The built-in infrared LEDs enables night time viewing of up to 16 feet (5 meters). IP65 Weatherproof Housing The DCS-2332L uses an IP65 weatherproof housing, allowing you to rest assured that in the toughest of conditions, it will continue to provide round-the-clock surveillance. 802.11n Wireless or Ethernet/Fast Ethernet Support The DCS-2332L offers wireless 802.11n and Ethernet/Fast Ethernet connectivity, making the DCS-2332L easy to integrate into your existing network environment. The DCS-2332L works with a 10Mbps Ethernet based network or 100Mbps Fast Ethernet based network for traditional wired environments, and works with 802.11n routers or access points for added flexibility. The Site Survey feature also allows you to view and connect to any available wireless networks. D-Link DCS-2332L User Manual 6 Section 1: Product Overview Hardware Overview Front 8 1 2 3 4 5 6 7 1 2 3 4 5 6 7 8 Camera Lens ICR Sensor Microphone PIR IR LED WPS Status LED Power/Status LED Antenna Records video of the surrounding area The IR-Cut Removable sensor measures the lighting conditions and switches between color and infrared accordingly Records audio from the surrounding area Passive Infrared sensor for motion detection Infrared LED illuminates the camera's field of view at night Indicates the WPS connection status of the camera Indicates the camera's current status Outdoor wireless antenna D-Link DCS-2332L User Manual 7 Section 1: Product Overview Rear: External 1 2 3 4 5 6 7 8 9 6 1 2 3 4 5 6 7 8 9 Weatherproof Cover Protective Cable Cover Ethernet Cable Speaker Weatherproof Cover Weatherproof Screw Covering Power Cable WPS Button Adjustment Ring Weatherproof protective panel Weatherproof cable connection cover RJ45 Ethernet cable to connect to your network Audio output Weatherproof cover for the MicroSD Card slot and reset button Weatherproof protective covering for enclosure screws Connected to the included DC 5 V power adapter Press this button, then press the WPS button for 5 seconds on your router to set up a wireless connection automatically Tighten or loosen the adjustment ring to adjust the camera's position D-Link DCS-2332L User Manual 8 Section 1: Product Overview Rear: Internal 1 2 3 4 1 2 3 4 DC Power Connector RJ45 Ethernet Port Reset Button SD Memory Card Slot Connected to the included DC 5 V power adapter RJ45 connector for Ethernet Use a paperclip or similar tool to press and hold the recessed button for 10 seconds to reset the camera Insert a MicroSD card for for storing recorded images and video D-Link DCS-2332L User Manual 9 Section 1: Product Overview Removing the Top Panel 2 3 4 Step 1:
Place the camera face down on a non-slip flat surface. Step 2:
Carefully pry out the two protective rubber screw coverings using a thin flat blade. Step 3:
Undo the two screws using a Philips #00 Screwdriver. Step 4:
Lift off the protective panel. Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured firmly in place. D-Link DCS-2332L User Manual 10 Section 1: Product Overview Replacing the Ethernet Cable 3 2 Step 1:
Follow the steps outlined in "Removing the Top Panel" on page 10. Step 2:
Unplug the Ethernet cable from the RJ45 connector. Step 3:
Carefully remove the weatherproof cable connection cover. Step 4:
Attach the weatherproof cable connection cover to the new Ethernet cable. Step 5:
Plug the new Ethernet cable into the RJ45 connector. Step 6:
Follow the steps outlined in "Reattaching the Top Panel" on page 12. Note: To avoid damage to the weatherproof aspects of the camera, users are advised not to remove the rear cable connection covering. To use a longer Ethernet cable install a coupling adaptor. D-Link DCS-2332L User Manual 11 Section 1: Product Overview Reattaching the Top Panel 3 2 1 Step 1:
Seat the protective panel, ensuring a tight fit with the inlaid rubber seal. Step 2:
Replace the two screws. Ensure that the screws are tightened firmly. Step 3:
Firmly replace the protective rubber screw coverings. Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured firmly in place. D-Link DCS-2332L User Manual 12 Section 1: Product Overview Removing the Bottom Panel Step 1:
Place the camera face down on a non-slip flat surface. Step 2:
Carefully pry out the two protective rubber screw coverings using a thin flat blade. 2 Step 3:
Undo the two screws using a Philips #00 Screwdriver. Step 4:
Lift off the protective panel. If you need to install an SD Memory Card please skip to "Installing an SD Memory Card" on page 14. 3 4 Using the Reset Button If you need to use the Reset Button follow these steps. Step 1:
Follow the steps outlined in "Removing the Bottom Panel" on page 13. Step 2:
Using a paperclip or similar tool, press and hold the Reset Button for 10 seconds. This will reset the device to it's factory settings. Step 3:
Follow the steps outlined in "Reattaching the Bottom Panel" on page 14. 2 D-Link DCS-2332L User Manual 13 Section 1: Product Overview Installing an SD Memory Card Step 1:
Follow the steps outlined in "Removing the Bottom Panel" on page 13. Step 2:
Insert a MicroSD Memory card into the slot, with the notch facing right. Step 3:
Follow the steps outlined in "Reattaching the Bottom Panel" on page 14. Reattaching the Bottom Panel Step 1:
Seat the protective panel, ensuring a tight fit with the inlaid rubber seal. Step 2:
Replace the two screws. Ensure that the screws are tightened firmly. Step 3:
Firmly replace the protective rubber screw coverings. Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured firmly in place. 2 3 4 2 D-Link DCS-2332L User Manual 14 Section 1: Product Overview Optional: WPS Wireless Connection Alternatively, if your router supports WPS, you can use the WPS button on the camera to easily create a secure wireless connection to your network. To create a WPS connection:
Step 1 Attach the Antenna Locate the antenna included with your DCS-2332L, and attach it to the antenna connector located on the side of the DCS-2332L. Step 2 Press and hold the WPS button for approximately 5-6 seconds. The blue WPS status LED on the front panel will blink. Step 3 Within 60 seconds press the WPS button on your router. On some routers, you may need to log in to the web interface and click on an on-screen button to activate the WPS feature. If you are not sure where the WPS button is on your router, please refer to your routers User Manual. The DCS-2332L will automatically create a wireless connection to your router. While connecting, the status LED will flash. When the connection process is complete, the status LED will turn solid. Note: If your router does not support WPS, you can still use the wired connection method on the previous page. After Zero Configuration setup is complete, your router's wireless settings will be automatically transferred to the camera. 1 WPS Button 2 D-Link DCS-2332L User Manual 15 Section 2: Installation Installation Zero Configuration Setup If you have a mydlink-enabled Cloud Router, you can take advantage of Zero Configuration. Zero Configuration automatically configures your camera's settings for you, and adds it to your mydlink account automatically. This type of setup allows you to set up your camera by simply plugging it in and connecting it to your router. Connect your camera to your mydlink-enabled Cloud Router and Zero Configuration will automatically configure your DCS-2332L and automatically add the camera to your mydlink account. After the short time it takes to do this you can remotely access your camera from the www.mydlink.com website to manage and monitor your DCS-2332L. Connect the Ethernet Cable Using the pre-attached Ethernet cable connect the free end to your network. Attach the External Power Supply Attach the external power supply to your wall outlet or power strip. D-Link DCS-2332L User Manual 16 Section 2: Installation Check Your mydlink Account Open a web browser and login to your mydlink account. The mydlink page will check for new devices and display a New device Found! pop-up notification in the bottom-left corner. Click the notification to continue. A summary and confirmation notification will appear with the automatically configured details. Make a note of the details and click Yes to add the camera to your account. DCS-2332L D-Link DCS-2332L User Manual 17 Section 2: Installation Zero Configuration will navigate to the mydlink Live View tab for your camera where you will see a screen similar to the following. If you wish to connect your camera to your router wirelessly, you can simply disconnect the Ethernet cable and move the camera to its intended location; your router's wireless settings have been automatically transferred to the camera, and no further configuration is required. Your camera is now set up, and you can skip to "mydlink" on page 23 to learn more about the mydlink features of this camera, or to "Configuration" on page 24 for advanced configuration of your camera. D-Link DCS-2332L User Manual 18 Section 2: Installation Camera Installation Wizard Windows Users Insert the Installation CD-ROM into your computers optical drive to start the autorun program. Simply click Set up your Cloud Camera to go through the Setup Wizard, which will guide you step-by-step through the installation process from connecting your hardware to configuring your camera and registering it with your mydlink account. Note: If the autorun program does not open, go to My Computer, browse to your CD drive, and double-click on the setup.exe file. D-Link DCS-2332L User Manual 19 Section 2: Installation Mac Users Insert the Installation CD-ROM into your computers CD drive. On the desktop, open your CD drive and double-click on the SetupWizard file. 6HWXS:L]DUG Within 20-30 seconds, the Setup Wizard will open, which will guide you step-by-step through the installation process from connecting your hardware to configuring your camera and registering it with your mydlink account. Note: mydlink portal requires JavaTM to function correctly. For more guidelines, please refer to mydlink FAQ pages at https://eu.mydlink.com/faq/mydlink D-Link DCS-2332L User Manual 20 Section 2: Installation Manual Hardware Installation If you wish to set up your camera without using the Camera Setup Wizard, please follow these steps. Note: In order to use the mydlink features of this product, you will need to go through the Camera Setup Wizard. Connect the Ethernet Cable Using the pre-attached Ethernet cable connect the free end to your network. Attach the External Power Supply Attach the external power supply to your wall outlet or power strip. D-Link DCS-2332L User Manual 21 Section 2: Installation SD Memory Card Installation The SD memory card slot is housed behind the lower protective panel on the rear of the device. Step 1:
Place the camera face down on a non-slip flat surface Step 2:
Carefully pry out the two lower protective rubber grommets using a thin flat blade. Step 3:
Undo the two screws using a Philips #00 Screwdriver. Step 4:
Lift off the protective panel. Step 5:
Insert a MicroSD Memory Card. Step 6:
Replace the protective panel. Step 7:
Replace the two screws. Ensure that the screws are tightened firmly. Step 8:
Firmly replace the protective rubber grommets. Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured firmly in place. D-Link DCS-2332L User Manual 22 Section 2: Installation mydlink After registering your DCS-2332L camera with a mydlink account in the Camera Installation Wizard, you will be able to remotely access your camera from the www.mydlink.com website. After signing in to your mydlink account, you will see a screen similar to the following:
DCS-2332L For more details on using your camera with mydlink, go to the Support section of the mydlink website and check the User Manual section for your product to find the latest instruction guide for your camera's mydlink features. D-Link DCS-2332L User Manual 23 Section 3: Configuration Configuration Using the Configuration Interface After completing the Camera Installation Wizard, you are ready to use your camera. The cameras built-in Web configuration utility is designed to allow you to easily access and configure your DCS-2332L. At the end of the wizard, enter the IP address of your camera into a web browser, such as Mozilla Firefox. To log in, use the User name admin and the password you created in the Installation Wizard. If you did not create a password, the default password is blank. After entering your password, click OK. D-Link DCS-2332L User Manual 24 Section 3: Configuration Live Video This section shows your cameras live video. You may select any of the available icons listed below to operate the camera. You may also select your language using the drop-down menu on the left side of the screen. You can zoom in and out on the live video image using your mouse. Right-click to zoom out or left-click to zoom in on the image. SD Status:
This option displays the status of the SD card. If no SD card has been inserted, this screen will display the message "Card Invalid."
Motion Trigger Indicator Recording Indicator Control Pad Auto Pan Stop This indicator will change color when a trigger event occurs. Note: The video motion feature for your camera must be enabled. When a recording is in progress, this indicator will change color. This control pad can be used to electronically pan, tilt, and zoom (ePTZ) within the camera's predefined view area, if one has been defined. Starts the automatic panning function. The ROI will pan from back and forth within the FOV Stops the camera ePTZ motion Preset Path Starts the camera's motion along the predefined path ePTZ Speed:
You may select a value between 0 and 64. 0 is the slowest and 64 is the fastest. D-Link DCS-2332L User Manual 25 Section 3: Configuration Global View:
This window indicates the total field of view (FOV) of the camera. The red box indicates the visible region of interest (ROI). Language:
You may select the interface language using this menu. Video Profile 1 Video Profile 2 Video Profile 3 Full screen mode Taking a Snapshot Record a Video Clip Set a Storage Folder Listen/Stop Audio In (from microphone) Start/Stop Audio Out (to speaker) Go To:
(Preset List) If any presets have been defined, selecting a preset from this list will display it. D-Link DCS-2332L User Manual 26 Section 3: Configuration Setup Setup Wizard To configure your Network Camera, click Internet Connection Setup Wizard. Alternatively, you may click Manual Internet Connection Setup to manually configure your Network Camera and skip to "Network Setup" on page 33. DCS-2332L To quickly configure your Network Cameras motion detection settings, click Motion Detection Setup Wizard. If you want to enter your settings without running the wizard, click Manual Motion Detection Setup and skip to "Motion Detection" on page 44. D-Link DCS-2332L User Manual 27 Section 3: Configuration Internet Connection Setup Wizard This wizard will guide you through a step-by-step process to configure your new D-Link Camera and connect the camera to the internet. Click Next to continue. Note: Select DHCP if you are unsure of which settings to choose. Click Next to continue. D-Link DCS-2332L User Manual 28 Section 3: Configuration Select Static IP if your Internet Service Provider has provided you with connection settings, or if you wish to set a static address within your home network. Enter the correct configuration information and click Next to continue. If you are using PPPoE, select Enable PPPoE and enter your user name and password, otherwise click Next to continue. If you have a Dynamic DNS account and would like the camera to update your IP address automatically, Select Enable DDNS and enter your host information. Click Next to continue. Enter a name for your camera and click Next to continue. DCS-2332L D-Link DCS-2332L User Manual 29 Section 3: Configuration Configure the correct time to ensure that all events will be triggered as scheduled. Click Next to continue. If you have selected DHCP, you will see a summary of your settings, including the camera's IP address. Please write down all of this information as you will need it in order to access your camera. DCS-2332L Click Apply to save your settings. D-Link DCS-2332L User Manual 30 Section 3: Configuration Motion Detection Setup Wizard This wizard will guide you through a step-by-step process to configure your camera's motion detection functions. Click Next to continue. Step 1 This step will allow you to enable or disable motion detection, specify the detection sensitivity, and adjust the cameras ability to detect movement. You may specify whether the camera should capture a snapshot or a video clip when motion is detected. Please see "Motion Detection" on page 44 for information about how to configure motion detection. Step 2 This step allows you to enable motion detection based on a customized schedule. Specify the day and hours. You may also choose to always record motion. D-Link DCS-2332L User Manual 31 Section 3: Configuration Step 3 This step allows you to specify how you will receive event notifications from your camera. You may choose not to receive notifications, or to receive notifications via e-mail or FTP. Please enter the relevant information for your e-mail or FTP account. Click Next to continue. Step 4 You have completed the Motion Detection Wizard. Please verify your settings and click Apply to save them. Please wait a few moments while the camera saves your settings and restarts. D-Link DCS-2332L User Manual 32 Section 3: Configuration Network Setup Use this section to configure the network connections for your camera. All relevant information must be entered accurately. After making any changes, click the Save Settings button to save your changes. LAN Settings:
This section lets you configure settings for your local area network. DCS-2332L DHCP:
Select this connection if you have a DHCP server running on your network and would like your camera to obtain an IP address automatically. Static IP Address:
If you choose DHCP, you do not need to fill out the IP address settings. You may obtain a static or fixed IP address and other network information from your network administrator for your camera. A static IP address may simplify access to your camera in the future. IP Address:
Enter the fixed IP address in this field. Subnet Mask:
This number is used to determine if the destination is in the same subnet. The default value is 255.255.255.0. Default router:
The gateway used to forward frames to destinations in a different subnet. Invalid gateway settings may cause the failure of transmissions to a different subnet. Primary DNS:
The primary domain name server translates names to IP addresses. Secondary DNS:
The secondary DNS acts as a backup to the primary DNS. D-Link DCS-2332L User Manual 33 Section 3: Configuration Enable UPnP Presentation:
Enabling this setting allows your camera to be configured as a UPnP device on your network. Enable UPnP Port Forwarding:
Enabling this setting allows the camera to add port forwarding entries into the router automatically on a UPnP capable network. Enable PPPoE:
Enable this setting if your network uses PPPoE. User Name / Password:
Enter the username and password for your PPPoE account. Re-enter your password in the Confirm Password field. You may obtain this information from your ISP. HTTP Port:
The default port number is 80. Access Name for Stream 1~3:
The default name is video#.mjpg, where # is the number of the stream. HTTPS Port:
You may use a PC with a secure browser to connect to the HTTPS port of the camera. The default port number is 443. Authentication:
Depending on your network security requirements, the Network Camera provides three types of security settings for streaming via RTSP protocol: disable and digest. If digest authentication is selected, user credentials are encrypted using MD5 algorithm, thus providing better protection against unauthorized access. RTSP Port:
The port number that you use for RTSP streaming to mobile devices, such as mobile phones or PDAs. The default port number is 554. You may specify the address of a particular stream. For instance, live1.sdp can be accessed at rtsp://x.x.x.x/video1.sdp where the x.x.x.x represents the ip address of your camera. Access name for stream 1 ~ 3:
This Network Camera supports multiple streams simultaneously. The access name is used to differentiate the streaming source (video profile). D-Link DCS-2332L User Manual 34 Section 3: Configuration COS SETTING:
Enabling the Class of Service setting implements a best-effort policy without making any bandwidth reservations. QOS SETTING:
Enabling QoS allows you to specify a traffic priority policy to ensure a consistent Quality of Service during busy periods. If the Network Camera is connected to a router that itself implements QoS, the router's settings will override the QoS settings of the camera. IPV6:
Enable the IPV6 setting to use the IPV6 protocol. Enabling the option allows you to manually set up the address, specify an optional IP address, specify an optional router and an optional primary DNS. MULTICAST The DCS-2332L allows you to multicast each of the available streams via group address and specify the TTL value for each stream. Enter the port and TTL settings you wish to use if you do not want to use the defaults. D-Link DCS-2332L User Manual 35 Section 3: Configuration Wireless Setup This section allows you to set up and configure the wireless settings on your camera. After making any changes, click the Save Settings button to save your changes. Site Survey:
Click the Rescan button to scan for available wireless networks. After scanning, you can use the drop-down box to select an available wireless network. The related information (SSID, Wireless Mode, Channel, Authentication, Encryption) will be automatically filled in for you. DCS-2332L SSID:
Enter the SSID of the wireless access point you wish to use. Wireless Mode:
Use the drop-down box to select the mode of the wireless network you wish to connect to. Infrastructure is normally used to connect to an access point or router. Ad-Hoc is usually used to connect directly to another computer. Channel:
If you are using Ad Hoc mode, select the channel of the wireless network you wish to connect to, or select Auto. Authentication:
Select the authentication you use on your wireless network - Open, Shared, WPA-PSK, or WPA2-PSK. Encryption:
If you use WPA-PSK or WPA2-PSK authentication, you will need to specify whether your wireless network uses TKIP or AES encryption. If you use Open or Shared authentication, WEP encryption should be the setting. Key:
If you use WEP, WPA-PSK, or WPA2-PSK authentication, enter the Key (also known as password) used for your wireless network. D-Link DCS-2332L User Manual 36 Section 3: Configuration Dynamic DNS DDNS (Dynamic Domain Name Server) will hold a DNS host name and synchronize the public IP address of the modem when it has been modified. A user name and password are required when using the DDNS service. After making any changes, click the Save Settings button to save your changes. Enable DDNS:
Server Address:
Select this checkbox to enable the DDNS function. Select your Dynamic DNS provider from the pull down menu or enter the server address manually. DCS-2332L Host Name:
Enter the host name of the DDNS server. User Name:
Enter the user name or e-mail used to connect to your DDNS account. Password:
Enter the password used to connect to your DDNS server account. Timeout:
Enter the DNS timeout values you wish to use. Status:
Indicates the connection status, which is automatically determined by the system. D-Link DCS-2332L User Manual 37 Section 3: Configuration Image Setup In this section, you may configure the video image settings for your camera. A preview of the image will be shown in Live Video. Enable Privacy Mask:
The Privacy Mask setting allows you to specify up to 3 rectangular areas on the camera's image to be blocked/
excluded from recordings and snapshots. DCS-2332L You may click and drag the mouse cursor over the camera image to draw a mask area. Right clicking on the camera image brings up the following menu options:
Disable All: Disables all mask areas Enable All: Enables all mask areas Reset All: Clears all mask areas. Anti Flicker:
If the video flickers, try enabling this setting. Mirror:
This will mirror the image horizontally. Flip:
This will flip the image vertically. When turning Flip on, you may want to consider turning Mirror on as well. Power Line:
Select the frequency used by your power lines to avoid interference or distortion. White Balance:
Use the drop-down box to change white balance settings to help balance colors for different environments. You can choose from Auto, Outdoor, Indoor, Fluorescent, and Push Hold. D-Link DCS-2332L User Manual 38 Section 3: Configuration Exposure Mode:
Changes the exposure mode. Use the drop-down box to set the camera for Indoor, Outdoor, or Night environments, or to Moving to capture moving objects. The Low Noise option will focus on creating a high-
quality picture without noise. You can also create 3 different custom exposure modes. The Max Gain setting will allow you to control the maximum amount of gain to apply to brighten the picture. Denoise:
This setting controls the amount of noise reduction that will be applied to the picture. Brightness:
Adjust this setting to compensate for backlit subjects. Contrast:
Adjust this setting to alter the color intensity/strength. Saturation:
This setting controls the amount of coloration, from grayscale to fully saturated. Sharpness:
Specify a value from 0 to 8 to specify how much sharpening to apply to the image. Reset Default:
Click this button to reset the image to factory default settings. D-Link DCS-2332L User Manual 39 Section 3: Configuration Audio and Video You may configure up to 3 video profiles with different settings for your camera. Hence, you may set up different profiles for your computer and mobile display. In addition, you may also configure the two-way audio settings for your camera. After making any changes, click the Save Settings button to save your changes. Aspect ratio:
Set the aspect ratio of the video to 4:3 standard or 16:9 widescreen. DCS-2332L Mode:
Set the video codec to be used to JPEG, MPEG-4, or H.264. Frame size / View window area:
Frame size determines the total capture resolution, and View window area determines the Live Video viewing window size. If the Frame size is larger than the Live Video size, you can use the ePTZ controls to look around. 16:9 1280 x 800, 1280 x 720, 800 x 450, 640 x 360, 480 x 270, 320 x 176, 176 x 144 1024 x 768, 800 x 600, 640 x 480, 480 x 360, 320 x 240, 176 x 144 4:3 Maximum frame rate:
Note: If your View window area is the same as your Frame size, you will not be able to use the ePTZ function. A higher frame rate provides smoother motion for videos, and requires more bandwidth. Lower frame rates will result in stuttering motion, and requires less bandwidth. D-Link DCS-2332L User Manual 40 Section 3: Configuration Video Quality:
This limits the maximum frame rate, which can be combined with the "Fixed quality" option to optimize the bandwidth utilization and video quality. If fixed bandwidth utilization is desired regardless of the video quality, choose "Constant bit rate" and select the desired bandwidth. DCS-2332L Constant bit rate:
The bps will affect the bit rate of the video recorded by the camera. Higher bit rates result in higher video quality. Fixed quality:
Select the image quality level for the camera to try to maintain. High quality levels will result in increased bit rates. Audio in off:
Selecting this checkbox will mute incoming audio. Audio in gain level:
This setting controls the amount of gain applied to incoming audio to increase its volume. Audio out off:
Selecting this checkbox will mute outgoing audio. Audio out volume level:
This setting controls the amount of gain applied to outgoing audio to increase its volume. D-Link DCS-2332L User Manual 41 Section 3: Configuration Preset This screen allows you to set preset points for the ePTZ function of the camera, which allows you to look around the camera's viewable area by using a zoomed view. Presets allow you to quickly go to and view a specific part of the area your camera is covering, and you can create preset sequences, which will automatically change the camera's view between the different presets according to a defined order and timing you can set. Note: If your View window area is the same as your Frame size, you will not be able to use the ePTZ function. Video Profile:
This selects which video profile to use. ePTZ Speed:
You may select a value between 0 and 64. 0 is the slowest and 64 is the fastest. DCS-2332L Arrow Buttons and Home Button:
Input Preset Name:
Use these buttons to move to a specific part of the viewing area, which you can then set as a preset. Click the Home button to return to the center of the viewing area. Enter the name of the preset you want to create, then click the Add button to make a new preset. If an existing preset has been selected from the Preset List, you can change its name by typing in a new name, then clicking the Rename button. Preset List:
Click this drop-down box to see a list of all the presets that have been created. You can select one, then click the GoTo button to change the displayed camera view to the preset. Clicking the Remove button will delete the currently selected preset. Preset Sequence:
This section allows you to create a preset sequence, which automatically moves the camera's view between a set of preset views. D-Link DCS-2332L User Manual 42 Section 3: Configuration Preset List: To add a preset to the sequence, select it from the drop-
down box at the bottom of this window, set the Dwell time to determine how long the camera view will stay at that preset, then click the Add button. The preset name will appear in the list, followed by the dwell time to view that preset for. You can rearrange your presets in the sequence by selecting a preset in the sequence, then clicking the arrow buttons to move it higher or lower in the current sequence. Clicking the trash can button will remove the currently selected preset from the sequence. If you want to change the dwell time for a preset, select it from the list, enter a new dwell time, then click the Update button. D-Link DCS-2332L User Manual 43 Section 3: Configuration Motion Detection Enabling Video Motion will allow your camera to use the motion detection feature. You may draw a finite motion area that will be used for monitoring. After making any changes, click the Save Settings button to save your changes. Enable Video Motion:
Select this box to enable the motion detection feature of your camera. DCS-2332L Sensitivity:
Specifies the measurable difference between two sequential images that would indicate motion. Please enter a value between 0 and 100. Percentage:
Specifies the amount of motion in the window being monitored that is required to initiate an alert. If this is set to 100%, motion is detected within the whole window will trigger a snapshot. Draw Motion Area:
Draw the motion detection area by dragging your mouse in the window (indicated by the red square). Erase Motion Area:
To erase a motion detection area, simply click on the red square that you wish to remove. Right clicking on the camera image brings up the following menu options:
Select All: Draws a motion detection area over the entire screen. Clear All: Clears any motion detection areas that have been drawn. Restore: Restores the previously specified motion detection areas. D-Link DCS-2332L User Manual 44 Section 3: Configuration Time and Date This section allows you to automatically or manually configure, update, and maintain the internal system clock for your camera. After making any changes, click the Save Settings button to save your changes. Time Zone:
Select your time zone from the drop-down menu. Enable Daylight Saving:
Select this to enable Daylight Saving Time. DCS-2332L Auto Daylight Saving:
Select this option to allow your camera to configure the Daylight Saving settings automatically. Set Date and Time Manually:
Selecting this option allows you to configure the Daylight Saving date and time manually. Offset:
Sets the amount of time to be added or removed when Daylight Saving is enabled. Synchronize with NTP Server:
Enable this feature to obtain time automatically from an NTP server. NTP Server:
Network Time Protocol (NTP) synchronizes the DCS-
2332L with an Internet time server. Choose the one that is closest to your location. Set the Date and Time Manually:
This option allows you to set the time and date manually. Copy Your Computer's Time Settings:
This will synchronize the time information from your PC. D-Link DCS-2332L User Manual 45 Section 3: Configuration Event Setup In a typical application, when motion is detected, the DCS-2332L sends images to a FTP server or via e-mail as notifications. As shown in the illustration below, an event can be triggered by many sources, such as motion detection or external digital input devices. When an event is triggered, a specified action will be performed. You can configure the Network Camera to send snapshots or videos to your e-mail address or FTP site.
(YHQW&RQGLWLRQ
$FWLRQ H[
0RWLRQGHWHFWLRQ
3HULRGLFDOO\'LJLWDOLQSXW
6\VWHPUHERRW 0HGLD ZKDWWRVHQG 6HUYHU ZKHUHWRVHQG H[
6QDSVKRW9LGHR&OLSV H[
(PDLO)73 To start plotting an event, it is suggested to configure server and media columns first so that the Network Camera will know what action shall be performed when a trigger is activated. D-Link DCS-2332L User Manual 46 Section 3: Configuration The Event Setup page includes 4 different sections. Event Server Media Recording DCS-2332L 1. To add a new item - "event, server or media," click Add. A screen will appear and allow you to update the fields accordingly. 2. To delete the selected item from the pull-down menu of event, server or media, click Delete. 3. Click on the item name to pop up a window for modifying. D-Link DCS-2332L User Manual 47 Section 3: Configuration Add Server You can configure up to 5 servers to save snapshots and/or video to. After making any changes, click the Save Settings button to save your changes. DCS-2332L Server Name:
Enter the unique name of your server. E-mail:
Enter the configuration for the target e-mail server account. FTP:
Enter the configuration for the target FTP server account. Network Storage:
Specify a network storage device. Only one network storage device is supported. SD Card:
Use the camera's onboard SD card storage. D-Link DCS-2332L User Manual 48 Section 3: Configuration There are three types of media, Snapshot, Video Clip, and System Log. After making any changes, click the Save Settings button to save your changes. DCS-2332L Add Media Media Name:
Enter a unique name for media type you want to create. Snapshot:
Select this option to set the media type to snapshots. Source:
Set the video profile to use as the media source. Refer to "Audio and Video" on page 40 for more information on video profiles. Send pre-event image(s) [0~4]:
Send post-event image(s) [0~7]:
Set the number of pre-event images to take. Pre-event images are images taken before the main event snapshot is taken. Set the number of post-event images to take. Post-event images are images taken after the main event snapshot is taken. You can set up to 7 post-event images to be taken. File name prefix:
The prefix name will be added on the file name. Add date and time suffix to file name:
Check it to add timing information as file name suffix. D-Link DCS-2332L User Manual 49 Section 3: Configuration Video clip:
Select this option to set the media type to video clips. Source:
Set the video profile to use as the media source. Refer to
"Audio and Video" on page 46 for more information on video profiles. DCS-2332L Pre-event recording:
This sets how many seconds to record before the main event video clip starts. You can record up to 4 seconds of pre-event video. Maximum duration:
Set the maximum length of video to record for your video clips. Maximum file size:
Set the maximum file size to record for your video clips. File name prefix:
This is the prefix that will be added to the filename of saved video clips. System log:
Select this option to set the media type to system logs. This will save the event to the camera system log, but will not record any snapshots or video. D-Link DCS-2332L User Manual 50 Section 3: Configuration Add Event Create and schedule up to 2 events with their own settings here. After making any changes, click the Save Settings button to save your changes. DCS-2332L Event name:
Enter a name for the event. Enable this event:
Select this box to activate this event. Priority:
Set the priority for this event. The event with higher priority will be executed first. Delay:
Select the delay time before checking the next event. It is being used for both events of motion detection and digital input trigger. Trigger:
Specify the input type that triggers the event. Video Motion Detection:
Motion is detected during live video monitoring. Select the windows that need to be monitored. Periodic:
The event is triggered in specified intervals. The trigger interval unit is in minutes. System Boot:
Triggers an event when the system boots up. Network Lost:
Triggers an event when the network connection is lost. Passive Infrared Sensor:
Triggers an event when the PIR sensor is activated by moving infrared objects even in dark environment. D-Link DCS-2332L User Manual 51 Section 3: Configuration Time:
Select Always or enter the time interval. Server:
Specify the location where the event information should be saved to. DCS-2332L D-Link DCS-2332L User Manual 52 Section 3: Configuration Add Recording Here you can configure and schedule the recording settings. After making any changes, click the Save Settings button to save your changes. DCS-2332L Recording entry name:
The unique name of the entry. Enable this recording:
Select this to enable the recording function. Priority:
Set the priority for this entry. The entry with a higher priority value will be executed first. Source:
The source of the stream. Recording schedule:
Scheduling the recording entry. Recording settings:
Configuring the setting for the recording. Destination:
Select the folder where the recording file will be stored. Total cycling recording size:
Please input a HDD volume between 1MB and 2TB for recording space. The recording data will replace the oldest record when the total recording size exceeds this value. For example, if each recording file is 6MB, and the total cyclical recording size is 600MB, then the camera will record 100 files in the specified location (folder) and then will delete the oldest file and create new file for cyclical recording. Please note that if the free HDD space is not enough, the recording will stop. Before you set up this option please make sure your HDD has enough space, and it is better to not save other files in the same folder as recording files. D-Link DCS-2332L User Manual 53 Section 3: Configuration Size of each file for recording:
If this is selected, files will be separated based on the file size you specify. DCS-2332L Time of each file for recording:
If this is selected, files will be separated based on the maximum length you specify. File Name Prefix:
The prefix name will be added on the file name of the recording file(s). D-Link DCS-2332L User Manual 54 Section 3: Configuration SD Card Here you may browse and manage the recorded files which are stored on the SD card. Format SD Card:
Click this icon to automatically format the SD card and create "picture" & "video" folders. DCS-2332L View Recorded Picture:
If the picture files are stored on the SD card, click on the picture folder and choose the picture file you would like to view. Playback Recorded Video:
If video files are stored on the SD card, click on the video folder and choose the video file you would like to view. Refresh:
Reloads the file and folder information from the SD card. D-Link DCS-2332L User Manual 55 Section 3: Configuration Advanced ICR and IR Here you can configure the ICR and IR settings. An IR(Infrared) Cut-Removable(ICR) filter can be disengaged for increased sensitivity in low light environments. Automatic:
The Day/Night mode is set automatically. Generally, the camera uses Day mode and switches to Night mode when needed. DCS-2332L Day Mode:
Day mode enables the IR Cut Filter. Night Mode:
Night mode disables the IR Cut Filter. Schedule Mode:
Set up the Day/Night mode using a schedule. The camera will enter Day mode at the starting time and return to Night mode at the ending time. IR Light Control:
The camera can enable or disable the IR (infrared) light according to your preferences. This setting provides additional controls depending on your specific application. Off:
The IR light will always be off. On:
The IR light will always be on. Sync:
The IR light will turn on when the ICR sensor is on. Schedule:
The IR light will turn on or off according to the schedule that you specify below. D-Link DCS-2332L User Manual 56 Section 3: Configuration HTTPS This page allows you to install and activate an HTTPS certificate for secure access to your camera. After making any changes, click the Save Settings button to save your changes. Enable HTTPS Secure Connection:
Enable the HTTPS service. Create Certificate Method:
Choose the way the certificate should be created. Three options are available:
DCS-2332L Create a self-signed certificate automatically Create a self-signed certificate manually Create a certificate request and install Status:
Displays the status of the certificate. Note:
The certificate cannot be removed while the HTTPS is still enabled. To remove the certificate, you must first uncheck Enable HTTPS secure connection. D-Link DCS-2332L User Manual 57 Section 3: Configuration Here you can set access permissions for users to view your DCS-2332L. Access List Allow list:
The list of IP addresses that have the access right to the camera. DCS-2332L Start IP address:
The starting IP Address of the devices (such as a computer) that have permission to access the video of the camera. Click Add to save the changes made. Note: A total of seven lists can be configured for both columns. End IP address:
The ending IP Address of the devices (such as a computer) that have permission to access the video of the camera. Delete allow list:
Remove the customized setting from the Allow List. Deny list:
The list of IP addresses that have no access rights to the camera. Delete deny list:
Remove the customized setting from the Delete List. For example:
When the range of the Allowed List is set from 1.1.1.0 to 192.255.255.255 and the range of the Denied List is set from 1.1.1.0 to 170.255.255.255. Only users with IPs located between 171.0.0.0 and 192.255.255.255 can access the Network Camera.
$ORZHG
/LVW
'HQLHG
/LVW D-Link DCS-2332L User Manual 58 Section 3: Configuration System In this section, you may backup, restore and reset the camera configuration, or reboot the camera. Save To Local Hard Drive:
You may save your current camera configuration as a file on your computer. DCS-2332L Local From Local Hard Drive:
Locate a pre-saved configuration by clicking Browse and then restore the pre-defined settings to your camera by clicking Load Configuration. Restore to Factory Default:
You may reset your camera and restore the factory settings by clicking Restore Factory Defaults. Reboot Device:
This will restart your camera. D-Link DCS-2332L User Manual 59 Section 3: Configuration Maintenance Device Management You may modify the name and administrators password of your camera, as well as add and manage the user accounts for accessing the camera. You may also use this section to create a unique name and configure the OSD settings for your camera. Admin Password Setting:
Set a new password for the administrators account. Add User Account:
Add new user account. DCS-2332L User Name:
The user name for the new account. Password:
The password for the new account. User List:
All the existing user accounts will be displayed here. You may delete accounts included in the list, but you may want to reserve at least one as a guest account. Camera Name:
Create a unique name for your camera that will be added to the file name prefix when creating a snapshot or a video clip. Enable OSD:
Select this option to enable the On-Screen Display feature for your camera. Label:
Enter a label for the camera, which will be shown on the OSD when it is enabled. Show Time:
Select this option to enable the time-stamp display on the video screen. D-Link DCS-2332L User Manual 60 Section 3: Configuration Firmware Upgrade The camera's current firmware version will be displayed on this screen. You may visit the D-Link Support Website to check for the latest available firmware version. To upgrade the firmware on your DCS-2332L, please download and save the latest firmware version from the D-Link Support Page to your local hard drive. Locate the file on your local hard drive by clicking the Browse button. Select the file and click the Upload button to start upgrading the firmware. Current Firmware Version:
Displays the detected firmware version. Current Product Name:
Displays the camera model name. DCS-2332L File Path:
Locate the file (upgraded firmware) on your hard drive by clicking Browse. Upload:
Uploads the new firmware to your camera. D-Link DCS-2332L User Manual 61 Section 3: Configuration Device Info This page displays detailed information about your device and network connection. Status DCS-2332L DCS-2332L D-Link DCS-2332L User Manual 62 Section 3: Configuration Logs This page displays the log information of your camera. You may download the information by clicking Download. You may also click Clear to delete the saved log information. DCS-2332L D-Link DCS-2332L User Manual 63 Section 3: Configuration This page provides helpful information regarding camera operation. Help DCS-2332L D-Link DCS-2332L User Manual 64 Appendix A: Technical Specifications Camera Camera Hardware Profile Image Features Video Compression Video Resolution Audio Support External Device Interface Network Network Protocols Security Technical Specifications 1/4 Megapixel progressive CMOS sensor 5 meter IR illumination distance Minimum illumination: 0 lux with IR LED on Built-in Infrared-Cut Removable (ICR) Filter module Built-in PIR sensor (5 meter) Built-in microphone and speaker 10x digital zoom Focal length: 3.45 mm Aperture: F2.0 Angle of view:
(H) 57.8
(V) 37.8
(D) 66 Configurable image size, quality, frame rate, and bit rate Time stamp and text overlays Configurable motion detection windows Simultaneous H.264/MPEG-4/MJPEG format compression H.264/MPEG-4 multicast streaming 16:9 - 1280 x 800, 1280 x 720, 800 x 450, 640 x 360, 480 x 270, 320 x 176, 176 x 144 G.726, G.711 10/100 BASE-TX Fast Ethernet port IEEE 802.11n 2.4GHz single band wireless IEEE 802.11n 2.4GHz single band wireless IPv6 IPv4 TCP/IP UDP ICMP DHCP client NTP client (D-Link) DNS client DDNS client (D-Link) SMTP client FTP client Administrator and user group protection Password authentication Configurable privacy mask zones Configurable shutter speed, brightness, saturation, contrast, and sharpness JPEG for still images 4:3 - 1024 x 768, 800 x 600, 640 x 480, 480 x 360, 320 x 240, 176 x 144 MicroSD/SDHC card slot HTTP / HTTPS Samba Client PPPoE UPnP port forwarding RTP / RTSP/ RTCP IP filtering QoS CoS Multicast IGMP ONVIF compliant HTTP and RTSP digest encryption D-Link DCS-2332L User Manual 65 Appendix A: Technical Specifications System Management System Requirements for Web Interface Event Management Remote Management Mobile Support D-ViewCam System Requirements D-ViewCam Software Functions General Weight Operating System: Microsoft Windows 7/Vista/XP/2000 Browser: Internet Explorer, Firefox, Chrome, Safari Motion detection Event notification and uploading of snapshots/video clips via e-mail or FTP Take snapshots/video clips and save to local hard drive or NAS via web browser Supports multiple SMTP and FTP servers Multiple event notifications Multiple recording methods for easy backup Configuration interface accessible via web browser Windows 7/Vista/XP system, Pocket PC, or mobile phone Operating System: Microsoft Windows 7/Vista/XP Web Browser: Internet Explorer 7 or higher Remote management/control of up to 32 cameras Viewing of up to 32 cameras on one screen 255 g mydlink mobile app for iOS and Android mobile devices Protocol: Standard TCP/IP Supports all management functions provided in web interface Scheduled motion triggered, or manual recording options External Power Adaptor Power Consumption 5.5 Watts Input: 100 to 240 V AC, 50/60 Hz Output: 5 V DC, 1.2 A Temperature Operating: -25 to 50 C (-13 to 122 F) Storage: -20 to 70 C (-4 to 158 F) Humidity Operating: 20% to 80% non-condensing Storage: 5% to 95% non-condensing Certifications CE CE LVD FCC C-Tick IP65 IC D-Link DCS-2332L User Manual 66 Appendix A: Technical Specifications Dimensions
D-Link DCS-2332L User Manual 67 Transmitters shall display the following notice in a conspicuous location:
Under Industry Canada regulations, this radio transmitter may only operate using an antenna of a type and maximum (or lesser) gain approved for the transmitter by Industry Canada. To reduce potential radio interference to other users, the antenna type and its gain should be so chosen that the equivalent isotropically radiated power (e.i.r.p.) is not more than that necessary for successful communication. This radio transmitter (identify the device by certification number, or model number if Category II) has been approved by Industry Canada to operate with the antenna types listed below with the maximum permissible gain and required antenna impedance for each antenna type indicated. Antenna types not included in this list, having a gain greater than the maximum gain indicated for that type, are strictly prohibited for use with this device.
)&&1RWLFHV
This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) this device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. CAUTION: Change or modification not expressly approved by the party responsible for compliance could void the users authority to operate this equipment. This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:
--Reorient or relocate the receiving antenna.
--Increase the separation between the equipment and receiver.
--Connect the equipment into an outlet on a circuit different from that to which the receiver is connected.
--Consult the dealer or an experienced radio/TV technician for help. CAUTION:
Any changes or modifications not expressly approved by the grantee of this device could void the user's authority to operate the equipment. RF exposure warning This equipment must be installed and operated in accordance with provided instructions and the antenna(s) used for this transmitter must be installed to provide a separation distance of at least 20 cm from all persons and must not be co-located or operating in conjunction with any other antenna or transmitter. End-users and installers must be provide with antenna installation instructions and transmitter operating conditions for satisfying RF exposure compliance."
Canada Notices
,QGXVWU\&DQDGDUHJXODWRU\LQIRUPDWLRQ
7KLVGHYLFHFRPSOLHVZLWK,QGXVWU\&DQDGDOLFHQFHH[HPSW566VWDQGDUG V
2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQVWKLVGHYLFHPD\QRWFDXVH
LQWHUIHUHQFHDQGWKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHLQFOXGLQJLQWHUIHUHQFH
WKDWPD\FDXVHXQGHVLUHGRSHUDWLRQRIWKHGHYLFH
7KHXVHULVFDXWLRQHGWKDWWKLVGHYLFHVKRXOGEHXVHGRQO\DVVSHFLILHGZLWKLQWKLV
PDQXDOWRPHHW5)H[SRVXUHUHTXLUHPHQWV8VHRIWKLVGHYLFHLQDPDQQHU
LQFRQVLVWHQWZLWKWKLVPDQXDOFRXOGOHDGWRH[FHVVLYH5)H[SRVXUHFRQGLWLRQV
Le prsent appareil est conforme aux CNR d'Industrie Canada applicables aux appareils radio exempts de licence. L'exploitation est autorise aux deux conditions suivantes : (1) l'appareil ne doit pas produire de brouillage, et (2) l'utilisateur de l'appareil doit accepter tout brouillage radiolectrique subi, mme si le brouillage est susceptible d'en compromettre le fonctionnement. 5)H[SRVXUHZDUQLQJ
7KLVHTXLSPHQWPXVWEHLQVWDOOHGDQGRSHUDWHGLQDFFRUGDQFHZLWK
SURYLGHGLQVWUXFWLRQVDQGWKHDQWHQQD VXVHGIRUWKLVWUDQVPLWWHUPXVW
EHLQVWDOOHGWRSURYLGHDVHSDUDWLRQGLVWDQFHRIDWOHDVWFPIURPDOO
SHUVRQVDQGPXVWQRWEHFRORFDWHGRURSHUDWLQJLQFRQMXQFWLRQZLWKDQ\
RWKHUDQWHQQDRUWUDQVPLWWHU(QGXVHUVDQGLQVWDOOHUVPXVWEHSURYLGH
ZLWKDQWHQQDLQVWDOODWLRQLQVWUXFWLRQVDQGWUDQVPLWWHURSHUDWLQJ
FRQGLWLRQVIRUVDWLVI\LQJ5)H[SRVXUHFRPSOLDQFH
&HWpTXLSHPHQWGRLWrWUHLQVWDOOpHWXWLOLVpFRQIRUPpPHQWDX[
LQVWUXFWLRQVIRXUQLHVHWGHO DQWHQQHVXWLOLVpSRXUFHWpPHWWHXUGRLWrWUH
LQVWDOOpSRXUIRXUQLUXQHGLVWDQFHGHVpSDUDWLRQG DXPRLQVFPGH
WRXWHSHUVRQQHHWQHGRLWSDVrWUHFRORFDOLVpVRXIRQFWLRQQDQWHQ
FRQMRQFWLRQDYHFXQHDXWUHDQWHQQHRXWUDQVPHWWHXU/HVXWLOLVDWHXUV
ILQDX[HWLQVWDOODWHXUVGRLYHQWrWUHIRXUQLUGHVLQVWUXFWLRQVG LQVWDOODWLRQ
GHO DQWHQQHHWGHVFRQGLWLRQVGHIRQFWLRQQHPHQWGXWUDQVPHWWHXUGHOD
FRQIRUPLWpVXUO H[SRVLWLRQDX[5)
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2013-01-16 | 2422 ~ 2452 | DTS - Digital Transmission System | Original Equipment |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 | Effective |
2013-01-16
|
||||
1 | Applicant's complete, legal business name |
D-Link Corporation
|
||||
1 | FCC Registration Number (FRN) |
0007371172
|
||||
1 | Physical Address |
17595 Mt. Herrmann
|
||||
1 |
Fountain Valley, California 92708
|
|||||
1 |
United States
|
|||||
app s | TCB Information | |||||
1 | TCB Application Email Address |
L******@ul.com
|
||||
1 | TCB Scope |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
||||
app s | FCC ID | |||||
1 | Grantee Code |
KA2
|
||||
1 | Equipment Product Code |
CS2332LA1
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 | Name |
B******** A********
|
||||
1 | Title |
General Counsel
|
||||
1 | Telephone Number |
714-8********
|
||||
1 | Fax Number |
866-7********
|
||||
1 |
b******@dlink.com
|
|||||
app s | Technical Contact | |||||
n/a | ||||||
app s | Non Technical Contact | |||||
n/a | ||||||
app s | Confidentiality (long or short term) | |||||
1 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 | Equipment Class | DTS - Digital Transmission System | ||||
1 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | HD Wirless N Outdoor Network Camera | ||||
1 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 | Modular Equipment Type | Does not apply | ||||
1 | Purpose / Application is for | Original Equipment | ||||
1 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | No | ||||
1 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 | Grant Comments | Output power listed is conducted. The antenna(s) used for this transmitter must be installed to provide a separation distance of at least 20 cm from all persons and must not be co-located or operating in conjunction with any other antenna or transmitter. | ||||
1 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 | Firm Name |
Compliance Certification Services Inc.
|
||||
1 | Name |
K******** C********
|
||||
1 | Telephone Number |
886-3******** Extension:
|
||||
1 | Fax Number |
886-3********
|
||||
1 |
k******@ccsrf.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 15C | 2412 | 2462 | 0.0904 | ||||||||||||||||||||||||||||||||||||
1 | 2 | 15C | 2422 | 2452 | 0.0718 |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC