all | frequencies |
|
exhibits | applications |
---|---|---|---|---|
manual |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 |
|
User Manual | Users Manual | 5.92 MiB | ||||
1 | Cover Letter(s) | |||||||
1 | Attestation Statements | |||||||
1 | Cover Letter(s) | |||||||
1 | External Photos | |||||||
1 | Cover Letter(s) | |||||||
1 | Internal Photos | |||||||
1 | Cover Letter(s) | |||||||
1 | ID Label/Location Info | |||||||
1 | ID Label/Location Info | |||||||
1 | RF Exposure Info | |||||||
1 | Test Report | |||||||
1 | Test Setup Photos |
1 | User Manual | Users Manual | 5.92 MiB |
WD32HBB101 CONTENTS Important Safety Instructions 2 Safety Information 3 Preparation 4 What's Included Front View Rear View Installing the Stand Removing the Stand for Wall-Mounting Wall-Mounting Screws Remote Control Connecting External Devices 9 Customizing TV Settings 10 Initial Setup Streaming Muse My Media Viewing Photos Listening to Music Watching Videos TV Settings General Picture Audio Network Channel Time Lock APP settings Source Parental Control 21 Troubleshooting 23 Maintaining 24 25 OTT APP Service Limited Warranty 26 26 1En IMPORTANT SAFETY INSTRUCTIONS
Read these instructions All the safety and WARNING:
shock, do not expose this apparatus to rain or moisture. The apparatus should not be exposed to as vases should not be placed on apparatus. WARNING: The batteries shall not be exposed to WARNING: The mains plug is used as disconnect device, the disconnect device shall remain readily operable. WARNING: To reduce the risk of electric shock, do not remove cover (or back) as there are no user-
personnel. within an equilateral triangle is intended to alert the user to the presence of non-insulated dangerous voltage within the products to constitute a risk of electric shock. The exclamation point within an equilateral triangle is intended to alert the user to the presence of important operating and maintenance instructions in the literature accompanying the appliance. This equipment is a Class II or double insulated electrical appliance. It has been designed in such a way that it does not require a safety connection to electrical earth. This product contains electrical or electronic materials. The presence of these materials may,if not disposed of properly, have potential adverse effects on the environment and human health. Presence of this label on the product means it should not be disposed of as unsorted waste and must be collectedseparately. As a consumer, you are responsible for ensuring that this product is disposed of properly. operating instructions should be read before this product is operated.
Keep these instructions The safety and operating instructions should be retained for future reference.
Heed all warnings All warnings on the appliance and in the operating instructions should be adhered to.
Follow all instructions All operating and use
Do not use this apparatus near water The instructions should be followed. appliance should not be used near water or moisture for example, in a wet basement or near a swimming pool, and the like. Clean only with dry cloth.
Do not block any ventilation openings. Install in
Do not install near any heat sources such accordance with the manufacturers instructions. as radiators, heat registers, stoves, or other
Do not defeat the safety purpose of the polarized or grounding-type plug. A polarized plug has two blades with one wider than the other. A grounding-
type plug has two blades and a third grounding prong. The wide blade or the third prong are provided for your safety. If the provided plug does replacement of the obsolete outlet. Protect the power cord from being walked on or pinched particularly at plugs, convenience receptacles, and the point where they exit from the apparatus. the manufacturer. Use only with the cart, stand, tripod, bracket, or the apparatus. When a cart is used, use caution when moving the cart/apparatus combination to avoid injury from tip-over. Unplug this apparatus during lightning storms or when unused for long periods of time. Servicing is required when the apparatus has been damaged in any way, such as the power-supply cord or plug is damaged, liquid has been spilled or objects have fallen into the apparatus, the apparatus has been exposed to rain or moisture, does not operate normally, or has been dropped. Please keep the unit in a well-ventilated environment. Licensing and Patent Information This WESTINGHOUSE product may be covered by one or more U.S. and foreign patents and patent applications. 2En SAFETY INFORMATION 7RHQVXUHUHOLDEOHDQGVDIHRSHUDWLRQRIWKLVHTXLSPHQWSOHDVHFDUHIXOO\UHDGDOOWKHLQVWUXFWLRQVLQWKLV
user guide, especially the safety information below. Electrical Safety rear of the product. components. The TV set should only be connected to a main power supply with voltage that matches the label at the To prevent overload, do not share the same power supply socket with too many other electronic Do not place any connecting wires where they may be stepped on or tripped over. Do not place heavy items on any connecting wire, which may damage the wire. Hold the main plug, not the wires, when removing from a socket. During a thunderstorm or when not in using the television for long periods, turn off the power switch on the back of the television. Do not allow water or moisture to enter the TV or power adapter. Do NOT use in wet, moist areas, such as bathrooms, steamy kitchens or near swimming pools. 3XOOWKHSOXJRXWLPPHGLDWHO\DQGVHHNSURIHVVLRQDOKHOSLIWKHPDLQSOXJRUFDEOHLVGDPDJHGOLTXLG
is spilled onto the set, if the TV set accidentally exposed to water or moisture, if anything accidentally penetrates the ventilation slots or if the TV set does not work normally. Do not remove the safety covers. There are no user serviceable parts inside. Trying to service the unit
\RXUVHOILVGDQJHURXVDQGPD\LQYDOLGDWHWKHSURGXFWVZDUUDQW\4XDOLHGSHUVRQQHOPXVWRQO\VHUYLFH
this apparatus. To avoid a battery leakage, remove batteries from the remote control, when the remote is not use for long period, or when the batteries are exhausted.
'RQRWEUHDNRSHQRUWKURZH[KDXVWHGEDWWHULHVLQWRDUH
For best results, use type AAA (example-alkaline, carbon-zinc, etc.) batteries. Install only new batteries of the same type in your product. Failure to insert batteries in the correct polarity, as indicated in the battery compartment, may shorten the life of the batteries or cause batteries to leak. Do not mix old and new batteries. Do not mix Alkaline, Standard (Carbon-Zinc) or Rechargeable (Nickel Cadmium) or (Nickel Metal Hydride) batteries. Batteries should be recycled or disposed of as per state and local guidelines. Do not attempt to recharge disposable batteries. Do not short circuit battery terminals. Keep away from children. Physical Safety 5cm (2) clearance all around. remote control. DPSOLHUVWKDWSURGXFHKHDW
Do not block ventilation slots in the back cover. You may place the TV in a cabinet, but ensure at least Do not tap or shake the TV screen, or you may damage the internal circuits. Take good care of the 7RFOHDQWKH79XVHDVRIWGU\FORWK'RQRWXVHVROYHQWVRUSHWUROHXPEDVHGXLGV
Do not install near any heat sources such as radiators, heat registers, stoves or other apparatus (including Do not defeat the safety purpose of the polarized or grounding-type plug. A polarized plug has two blades with one wider than the other. A grounding plug has two blades and a third grounding prong, the ZLGHEODGHRUWKHWKLUGSURQJLVSURYLGHGIRU\RXUVDIHW\,IWKHSURYLGHGSOXJGRHVQRWWLQWR\RXURXWOHW
consult an electrician for replacement of the obsolete outlet. Protect the power cord from being walked on or pinched particularly at plugs. Unplug the apparatus during lightning storms or when unused for long periods. 5HIHUDOOVHUYLFLQJWRDTXDOLHGVHUYLFHSHUVRQQHO6HUYLFLQJLVUHTXLUHGLIWKHDSSDUDWXVGRHVQRWRSHUDWH
normally or if the apparatus, including the power supply cord or pulg, has been damaged in any way. 6HUYLFLQJLVDOVRUHTXLUHGLIOLTXLGKDVEHHQVSLOOHGRUREMHFWVKDYHIDOOHQLQWRWKHDSSDUDWXVZKHQWKH
DSSDUDWXVKDVEHHQH[SRVHGWRUDLQRUPRLVWXUHRULIWKHDSSDUDWXVKDVEHHQGURSSHG
Always connect your television to a power outlet with protective ground connection. 0LQLPXPFPGLVWDQFHVDURXQGWKHDSSDUDWXVIRUVXIFLHQWYHQWLODWLRQ
The ventilation should not be impeded by covering the ventilation openings with items, such as newspapers, table-cloths, curtains, etc. 1RQDNHGDPHVRXUFHVVXFKDVOLJKWHGFDQGOHVVKRXOGEHSODFHGRQWKHDSSDUDWXV
Attention should be drawn to the environmental aspects of battery disposal. 3En PREPARATION What s Included
I
T Set emote Control with atteries T Stand Six Screws
(
) 2x User Manual uic Connect Guide Warrant Card User anual uick Connect Guide Warranty Card En Front iew P EPA ATION POWE LED IR 7 isplay the main menu. POWER Switch the T between On / Standby mode. SOURCE Press to select among different input signal sources. MENU CH
-
Press to select a channel. OL -
Press to adjust the volume. POWER Indicator Illuminate blue when the T is turned on. Illuminate red when the Illuminate red when the IR (Infrared eceiver) eceive I signals from the remote control. T is in standby mode. En P EPA ATION Rear iew 10 LAN HDMI GA coaxial cable. DT T Input Connect to the antenna ( H /UH ) socket with the OPTICAL Output Connect a digital sound system to this jack. AUDIO Input Connect to the AU IO (
sockets on external audio devices. COMPOSITE COMPONENT IN Connect to A devices with composite/
component (
/Pb/Pr) video and audio output sockets. CO POSITE I EO and CO PONENT( /P /P ) share with AU IO IN ( / ).
) output
/
Power Cord Connect to AC power outlet. Headphone Soc et Connect to the Headphones. US Port Connect to a US storage device to play LAN Network connection port. HDMI Input input device. GA Input Connect to a computer or other devices with a GA interface. PC AUDIO Input Connect to a computer audio output. En Installing the Stand P EPA ATION
ay the T face down on a flat, cushioned surface to avoid damaging or scratching.
ix the eft ase Stand to the main unit using 2 pcs provided screws.
(
2 ) Remo ing the Stand for Wall Mounting
ix the ight ase Stand to the main unit using 2 pcs provided screws.
(
2 ) ay the T face down on a flat, cushioned surface to avoid damaging or scratching.
Untighten the pcs screws holding the stand assembly and remove them.
Attach the wall-mount bracket to the T using the mounting holes on the back of the T . ount this T according to the instructions included in the wall-mount bracket. Wall Mounting Screws ount the ESA bracket using
WARNING:
iso metric threaded screws (Not Supplied). accordance with the installation instruction. WARNING Never place a television set in an unstable location. A television set may fall, causing serious personal injury or death. any injuries, particularly to children, can be acoided by taking simple precautions such as Using cabinets or stands recommended by the manufacturer of the television set. Only using furniture that can safely support the television set. Ensuring the television set is not overhanging the edge of the supporting furniture. Not placing the television set on tall furniture(for example, cupboards or bookcases) without anchoring both the furniture and the television set to a suitable support. Not placing the television set on cloth or other materials that may be located between the television set and supporting furniture. Attention should be drawn to the environmental aspects of battery disposal. Educating children about the dangers of climbing on furniture to reach the television set or its controls En P EPA ATION Remote Control En
:Switch the T between On and
: ute and restore T sound.
:Select a program.(AT / T mode)
:Enter multiple program channel number
: eturn to the previous viewing channel. Standby mode. such as 2- . APP:Press to select the desired APP. MENU:
SOURCE:Select among the different input signal sources T /A /CO PONENT/H I /
H
:Allows you to navigate the on screen display menus and adjust the system settings to your preference. isplay the main menu. I / GA/US . I2/H the selection. OK:
RETURN: eturn to previous menu. E IT:Exit the on screen display menu. ASPECT:Select the aspect ratio. track/photo. chapter/track/photo. settings standard/wide/wide zoom/zoom/ ust Scan
(H I)/ ot by ot( GA). OL :Adjust the volume. CH :Select the channel. T :Into the T channel.
:Start playback or pause.
: everse playback rapidly.
:Advance playback rapidly.
:Skip to the beginning of the previous
:Stop the playback. FREE E: reeze the picture.
:Skip to the beginning of the next chapter/
ADD ERASE:Add or delete avorite channels. FA :
INFO:
MTS:Switch among different audio CC:Closed Caption selection ON/O /CC On ute. CHIP:Set up parental control. PMODE:Select picture mode dynamic/movie/
S MODE:Select sound mode standard/music/
CH LIST:
isplay the present screen information isplay the favorite channel list. isplay program list. such as the current channel and input source. channels STE EO/ ONO/SAP. user/standard. movie/user. CONNECTING E TERNAL DE ICES Blu-ray Player / Recorder OR Game Console Video Camera Satellite Antenna Cable VCR Satellite Receiver Digital Audio System Optical Cable
(not included) T N E N O P M O C I O D U A I M D H I L A C T P O Composite/Component Cable
(not included) Audio Cable
(not included) RF Cable(not included) LAN HDMI HDMI GA
(not included) VGA Cable
(not included) 3.5mm Audio Cable
(not included) Headphones Soundbar Network Cable
(not included) WIFI Computer HDMI Device HDMI Cable(not included) 9En CUSTOMI ING T SETTINGS Initial Setup Connect the power cord to the power socket after you have completed all the physical connections. At this stage, the T will enter Standby ode and the red E indicator will illuminate. In Standby ode, press the on. The red E indicator will turn blue. button on the main unit or on the remote control to turn the T the Arrow buttons to highlight and select your desired mode and press OK Westinghouse If channels cannot be found, this frame will be displayed automatically. The SLEEP MODE Power should e less than W En DEVICE FOUND1 DEVICE FOUND1 DEVICE FOUND1 DEVICE FOUND1 DE ICE FOUND DE ICE FOUND GENERAL WIDE OOM MODE CUSTO I ING T SETTINGS Press MENU to display the main interface, use the Arrow buttons to highlight T SETTINGS and press OK GENERAL to enter and adjust each option setting. MENU LANGUAGE TRANSPARENCY OOM MODE GA SETTINGS CLOSED CAPTION DLC RESTORE DEFAULT Select the menu language among English, ran ais or Espa ol. The default on-screen menu language is English. Select to turn On/Off transparency function. Select zoom mode WI E/CINE A/ oom/NO A Note: With a different input source, the zoom mode options may differ. Adjust advanced options setting H-POS, -POS, Clock, Phase or Auto.
(only available in GA mode) CC mode On/Of asic Selection Advanced Selection CC /CC2/CC CC /
Text /.../Text . Select from Service to Service . Option ode, ont Style, ont Size, ont Edge Style, ont Edge Color, G Color, G Color, G Opacity, G Opacity. Select to turn the dynamic luminance control On/Off. estore the T to factory default settings. En CUSTO I ING T SETTINGS PICTURE STANDARD Press MENU to display the main interface, use the Arrow buttons to highlight T SETTINGS and press OK to PICTURE to enter and adjust each option setting. ynamic/Standard/ ovie/User. PICTURE MODE Cycle among picture modes LUE SCREEN Allow the blue background to turn On/Off RIGHTNESS CONTRAST COLOR during weak or no signal conditions. Increase or decrease the amount of white in the picture. Adjust the difference between light and dark levels in the pictures. Control the color intensity. Adjust crispness level in edges between light and dark areas of the picture. Adjust the balance between red and green levels. SHARPNESS TEMPERATURE Cycle among color temperatures Normal/
Warm/Cool. TINT COLOR AD ANCED OPTION Set the following options Noise Reduction: educe the noise level of iddle/Strong. the connected device Off/Weak/
En AUDIO CUSTOMIZING TV SETTINGS Press MENU to display the main interface, use the Arrow buttons to highlight TV SETTINGS and press OK WRFRQUP7KHQXVHWKH$UURZEXWWRQVWRVHOHFWAUDIO to enter and adjust each option setting. SOUND MODE BASS TREBLE BALANCE DIGITAL AUDIO OUTPUT Allow the selection of an audio-
HQKDQFHPHQWWHFKQLTXH6WDQGDUG
Music/Movie/User. Control the relative intensity of lower-
pitched sounds. Control the relative intensity of higher-
pitched sounds. Adjust the relative volume of the speaker in a multiple speaker system. Select the digital audio output mode between PCM/RAW. SURROUND SOUND Turn On/Off to provide an enhanced listening experience. Turn On/Off to automatically control volume levels. AUTO VOLUME AUDIO LANGUAGE Select audio language among:
English, French, Spanish. NETWORK Press MENU to display the main interface, use the Arrow buttons to highlight TV SETTINGS and press OKWRFRQUP7KHQ8VHWKH$UURZEXWWRQVWRVHOHFW
NETWORK to enter and adjust each option setting. NETWORK TYPE MY NETWORK IP ADDRESS Select Lan and Wireless network, then connect the TV to the wired network or search the wireless network through VHDUFKLQJDYDLODEOH:L
Display the current network which you connect to. Display the current IP address information. En 17 CUSTO I ING T SETTINGS connection successfully, NETWORK SETUP menu INTERACTI E T menu. Then use the Arrow buttons to select ENA LE DISA LE the Interactive T , and press OK NE T to enter ENA LE You Nou HA E INTERACTI E T Then you will enter YOU NOW HA E INTERACTI E T menu, and use UP arrow on remote control to get the most of the show you are watching. CHANNEL Press MENU to display the main interface, use the Arrow buttons to highlight T SETTINGS and press OK CHANNEL to enter and adjust each option setting. AIR CA LE AUTO SCAN FA ORITE SHOW HIDE CHANNEL NUM ER CHANNEL LA EL INFORMATION SIGNAL Select antenna between Air and Cable. Select the Auto Scan feature to scan your available cable channels. Set the selected channel as a favorite channel. Show/Hide the selected channel. isplay the current channel number. isplay the current channel label. isplay the information of current signal. En TIME CUSTO I ING T SETTINGS Press MENU to display the main interface, use the Arrow buttons to highlight T SETTINGS and press OK TIME to enter and adjust each option setting. 4:16AM 05/01/1980 LOCK SLEEP TIMER OSD TIMER TIME ONE Select a period of time after which the T automatically switches to standby mode Off/ /
min.
/2
/
/
Set the OS timer Off/
Select a Time one s/
s/
s/ 2 s/2 s. DAYLIGHT SA ING TIME CLOCK Central/ ountain/Newfoundland. Select to turn daylight saving time On/
Off. isplay the clock time. Press MENU to display the main interface, use the Arrow buttons to highlight T SETTINGS and press OK LOCK to enter and adjust each option setting. Note: the defau t pass ord is
. CHANGE PASSWORD SYSTEM LOCK Use - buttons to input the old password and then input the new -digit password. Select to turn system lock On/Off. The following options (USA, Canada, and eset you turn the system lock on. T Setting T) will only be accessible when USA CANADA T PAA Canada English Canada rench T ating Press OK button to lock or unlock T rating. Set the PAA N/A, G, PG, PG-
,
, NC-
,
. Select PAA rating for English-
speaking Canada E, C, C , G, PG, Select PAA rating for uebec Canada E, G, ans , ans ,
,
. ans , ans . RRT SETTING Set ating egion Table. RESET RRT CLEAR LOCK Clear all lock settings. Select to reset the T setting. En CUSTOMIZING TV SETTINGS APP SETTINGS Press MENU to display the main interface, use the Arrow buttons to highlight TV SETTINGS and press OK WRFRQUP7KHQXVHWKH$UURZEXWWRQVWRVHOHFWAPP SETTINGS to enter and adjust each option setting. information. DEACTIVATE APP 'HDFWLYDWH1HWL[DQGFOHDUWKHDFFRXQW
DEACTIVATE APP Deactivate Vudu and clear the account INTERACTIVE TV information. To enter the Muse and enjoy the different programs and shows in the Muse TV. Electronic Serial Number. SETTINGS ESN SOURCE Press SOURCE on the remote control or on the main unit to display the source menu, then use the Arrow buttons to cycle among the different input sources: TV/AV/
COMPONENT/HDMI1/HDMI2/HDMI3/VGA/USB, then use the Arrow buttons to highlight the desired source and press OK to confirm. En 20 PARENTAL CONTROL Press the MENU button on the main unit or on the remote control and then press buttons to select LOCK menu. Use the 0-9 buttons to input the 4-digit password to enter the LOCK menu. If used, this option feature can "block'' undesirable programming from appearing on the TV. Parental Control offers users a wide variety of options and settings that restrict or "block''
WKHSURJUDPPLQJWKDWFDQDSSHDURQWKH793DUHQWDO&RQWURODOORZVXVHUVWRGHQHZKLFK
program rating they consider acceptable for a younger more sensitive viewer. It can be SUHVHWDQGWXUQHGHLWKHURQRURIIE\WKHXVHUZKRVSHFLHVWKHVHFUHWQXPEHUSDVVZRUG
FRGH7KHQXPEHURIKRXUVEORFNHGFDQDOVREHVSHFLHG
General audience and children block should both be programmed into the TV memory. 6HSDUDWHGLIIHUHQWYLHZHUUDWLQJVDUHVSHFLHGIRUERWK79DQGWKHPRWLRQSLFWXUH,QGXVWU\
both rating systems should be used and based on the ages of children. Overview To ensure complete coverage for all TV programs (movies and regular TV show) using the Age Block option, choose a rating from both the MPAA and TV Parental Guideline tables on the next page. In addition, you may wish to add other restrictions selected from the content block menu and submenus. Things to Consider before Setting up Parental Control Determine which ratings you consider are acceptable for different viewers. For example, if
\RXFKRRVH793*PRUHUHVWULFWLYHUDWLQJVZLOOEHDXWRPDWLFDOO\EORFNHGVRPHYLHZHUVZLOO
not be able to see: TV-PG, TV-14, or TV-MA rated programs. You may block the auxiliary video source entirely. Use the Content Blk option to block program Content based on individual parameters such as: Strong Dialog, Bad Language, Sex Scenes, Violence Scenes or Fantasy. Go into the Set Password option and use the numeric keys on the remote control to set a secret password, then save the password, it is the only way to access the Parental Control menu and change ratings setting, or turn off Parental Control. You can set different Parental Control viewing restrictions for general audiences and for FKLOGUHQERWKFDQEHDFWLYHDWWKHVDPHWLPH
Simply specifying one content block such as Sex Scenes, will not automatically restrict WKHSURJUDPPLQJWKDWDSSHDUVIURPWKHYLGHRVRXUFHV
Even If you choose to leave the AUX Inputs unblocked, the ratings you specify will DXWRPDWLFDOO\UHVWULFWWKHSURJUDPPLQJWKDWDSSHDUVIURPWKHYLGHRVRXUFHV
You cannot disable Parental Control by disconnecting the TV from power. Block hours will EHDXWRPDWLFDOO\UHVHWWRWKHRULJLQDOEORFNWLPHVHWWLQJVSHFLHGLISRZHULVGLVFRQQHFWHG
En 21 PARENTAL CONTROL Motion Picture Association of America (MPAA) Rating System G PG PG-13 R NC-17 X No Rating Grade General Audiences Parental Guidance Suggested Parents Strongly Cautioned Restricted No children under age 17 Hard Core Films No Rating Meaning Content not offensive to most viewers. Content is such that parents may not want their children to view the program. Program is inappropriate for preteens, with a greater degree of offensive material suggested than a PG rated program. Not for children under 17-contains strong element of sex and/or violence. Not for children under 17-under any circumstances. Contains strong sexual content. Same as NC-17 rating. MPAA did not rate. TV Parental Guideline Rating System Select LOCK option in the TV Settings, then use the Arrow buttons to highlight USA and press OK button to enter. Select TV to enter set TV parental guideline rating system. Grade TV-Y All Children TV-Y7 Directed to Older Children TV-G General Audience TV-PG Parental Guidance Suggested TV-14 Parents Strongly Cautioned TV-MA Mature Audience Only Meaning Content not offensive to most viewers. Considered suitable for children over 7- may contain fantasy violence scenes. Considered suitable for all DXGLHQFHFKLOGUHQPD\
watch unattended. Suggested unsuitable for younger children-
may contain suggestive language, bad language, sex and violence scenes. unsuitable for children under 14 - may contain strong language, bad language, sex, and violence scenes. Adults only- may contain strong language, bad language, sex, and violence scenes.
Canadian English is used throughout all English-speaking Canada (E, C, C8+, G, PG, 14+, 18+).
Canadian French is used in Quebec (E, G, 8 ans+, 13 ans+, 16 ans+, 18 ans+)
The V-Chip will automatically block certain categories that are "more restrictive". If you block TV-Y category, then TV-Y7 will be automatically blocked. Similarly, if you block TV-G category, then all the categories in the "young adult" will be blocked (TV-G, TV-PG, TV-14 and TV-MA).
TV-NO: The channel is not locked. En 22 TROUBLESHOOTING If your TV does not operate normally or cannot be turned on, please check the following WURXEOHVKRRWLQJTXHVWLRQV5HPHPEHUDOVRWRFKHFNDQ\RWKHUFRQQHFWHGHOHFWURQLFGHYLFH
such as a DVD or Blu-ray player to pinpoint the problem. If the TV still fails to operate normally, please contact technical support. The TV does not operate properly The TV does not respond when pressing any buttons The TV may freeze up during use. Disconnect the power cord from the power socket for a few minutes. Reconnect the power cord and try to operate it again as usual. TV cannot be switched on Check that the TV is connected to the power supply. Make sure all connected AV devices are switched off before switching on your TV. The remote control does not work Power is suddenly turned off
- to -). The video function does not work No picture & no sound Picture appears slowly after switching on No or poor color or poor picture Horizontal/Vertical bar or picture shaking Poor reception on some channels Check to see if there are any objects between the TV and the remote control causing an obstruction. Ensure that you are pointing the remote control directly at the TV. Ensure that the batteries are installed with the correct polarity (+ to +, Install new batteries. Check the power of the TV. The power supply maybe interrupted. Check if the sleep timer is set. Check whether the Auto Standby is activated. Check whether the TV is switched on. Try another channel. The problem may be caused by the broadcaster. 7KLVLVQRUPDOWKHLPDJHLVPXWHGGXULQJWKH79VWDUWXSSURFHVV
Please contact your service centre if the picture has not appeared after 5 minutes. Adjust the settings in the Picture menu. Try another channel. The problem may be caused by the broadcaster. Check if video cables are connected properly. Check for local interference such as an electrical appliance or power tool. 7KHVWDWLRQRUFDEOHFKDQQHOPD\EHH[SHULHQFLQJSUREOHPVWXQHWR
Station signal may be weak, reposition the antenna for better another station. reception. Lines or streaks in pictures No pictures when connecting HDMI Pictures appear in wrong ratio The audio function does not work Check for sources of possible interference. Check antenna (change the position of the antenna.) Check if the input source is HDMI1/HDMI2/HDMI3. Adjust the Aspect Ratio settings in the SETUP menu or press the ASPECT button on the remote control. Picture OK but no sound No output from one of the speakers Unusual sound from inside the TV No sound when connecting HDMI Audio noise Press the VOL +/- buttons. Sound muted? Press the MUTE button. Try another channel. The problem may be caused by the broadcaster. Adjust the Balance settings in the AUDIO menu. A change in ambient humidity or temperature may result in an unusual noise when the TV is switched on or off and does not indicate a fault with the TV. Check if the input source is HDMI1/HDMI2/HDMI3. Keep the RF coaxial cable away from the other connected cables. En 23 TROUBLESHOOTING Select the SET PASSWORD setting in the LOCK menu, then enter the following master password 8899. The master password clears your previous password and allows you to enter a new password. Password Lost password There is a problem in PC mode The signal is out of range
(invalid format) Vertical bar or stripe on background & Horizontal Noise & Incorrect position Screen color is unstable or show a single color If the WIFI connection fails or APP has connection issue, please check the following troubleshooting questions. Adjust the resolution, horizontal frequency, or vertical frequency. Check the signal cable. Reinstall the PC video card. Check signal strength for WIFI connection, the TV may be too far away from WIFI router. Check "authentication" setting. Make sure password is entered with correct upper or lower case Check if TV is connected correctly. Try powering off and unplugging TV to reset TV. Try resetting the WIFI router, and also check for interference or WIFI channel problems. Check if internet connection is fast enough for streaming HD or 4K WIFI connection fails letters. Problems with video streaming has connection issue videos. Can't use Vudu and Pandora Vudu is only available in US and Pandora only avaliable in limited Maintaining countries. Do not use your TV in areas that are too hot or too cold, because the cabinet may warp or the screen may malfunction. Your TV works best in temperatures that are comfortable to you. Storage temperatures are 32 to 122F(0 to 50C). Working temperatures are 32 to 95F(0 to 35C). Do not place your TV in direct sunlight or near a heat source.
- the ventilation should not be impeded by covering the ventilation openings with items, such as newspapers, table-cloths, curtains, etc.;
apparatus;
- attention should be drawn to the environmental aspects of battery disposal. En 24 SPECIFICATION Panel Size Display Type Panel Technology Panel 60 Hz Vs. 120 Hz Display Resolution HDMI Support Panel Resolution Aspect Ratio Dynamic Contrast Ratio-Panel Response Time (G To G) Lamp Life (Typ. Hours) Horizontal Viewing Angle (At CR>10) Vertical Viewing Angle (At CR>10) Wall-mount(LxW-mm) The FCC Wants ou to Know 32 inch diagonally DLED TFT 60 Hz 1366 x 768 1360 x 768 1366 x 768 16:9 1200:1 8 ms 30,000 hours 178 178 200*100 VESA(mm) FCC STATEMENT This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions:
1. This device may not cause harmful interference, and 2. This device must accept any interference received, including interference that may cause undesired could void the user's authority to operate the equipment. NOTE This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:
1. Reorient or relocate the receiving antenna. 2. Increase the separation between the equipment and receiver. 3. Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. 4. Consult the dealer or an experienced radio/TV technician for help. FCC Radiation E posure Statement This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment. This equipment should be installed and operated with minimum distance 20cm between the radiator & your body. En 25 If you want to know about these APP information or get more service. Please refer to following content. OTT APP SERVICE You can call the following telephone for more help: 866-579-7172 If your matter is regarding customer service, please refer to alternative contact information. for YouTube You can browse the following website for more help:
https://productforums.google.com/forum/#!categories/youtube/smart-tvs VUDU You can call the following telephone for more help: 888-554-8838 TG You can call the following telephone for more help: 888-874-5411 Pandora You can send E-mail to Pandora for more help: pandora-support@pandora.com AccuWeather You can send E-mail to AccuWeather for more help: CustomerService@AccuWeather.com OBTAINING WARRANTY SERVICE Please call Westinghouse Electronics at (800) 701-0680 for the locations of the nearest Westinghouse Electronics service center or to obtain in-home services. En 26 CONTEN Consignes de s curit importantes Renseignements sur la s curit Pr paration l ments compris Vue avant Vue arri re Installation du socle Retrait du socle en vue d un montage mural Vis de montage mural T l commande Conne ion des appareils e ternes Personnalisation des param tres du t l viseur Diffusion Muse MES M DIAS Visionnement de photos coute de musique Regarder des vid os PARAM TRES TV G r ral Image Audio R seau Canal Heure Verrouillage Param tres de APP Source Contr le parental D pannage Entretien Caract ristiques technique OTT APP Service arantie limit e 1Fr CONSI NES DE S C RIT IMPORTANTES
Lisez ces consignes Avant d utiliser ce produit,
Conservez ces consignes ous vous vous devez lire toutes les consignes li es la s curit et au fonctionnement de l appareil. MISE EN ARDE pour r duire les risques d incendie et de choc lectrique, n exposez pas cet appareil la pluie ou l humidit . e l exposez pas non plus aux gouttements ou aux claboussures. e placez pas d objets remplis de liquide, par exemple un vase, sur le dessus de l appareil. MISE EN ARDE n exposez pas les piles une chaleur excessive comme celle induite par la lumi re du soleil, un feu ou autrement. MISE EN ARDE la prise secteur sert de dispositif de d saccouplage elle doit demeurer facilement accessible. MISE EN ARDE AFI RIS LE CO VERCLE (O LE PA CAR IL L TILISATE R R PARATIO S ES D LECTROC TIO , RETIRE PAS EA ARRI RE), A A C E PI CE R PARABLE PAR L I T RIE R. CO FIE LES DE R D IRE LES TECH ICIE ALIFI
. Le symbole repr sentant un clair termin quilat ral vise avertir l utilisateur du danger de la presence d une tension dangereuse pr sent e pardes pi ces non isol es l int rieur de l appareil, ventuellement d lectrocution. Le symbole de point d exclamation l int rieur un triangle quilat ral, vise informer l utilisateur de la pr sence de consignes de fonctionnement et de maintenance importantes dans la documentation qui accompagne l appareil. Cet quipement est un appareil lectrique de classe II ou double isolation. Il a t con u de sorte ne pas n cessiter une connexion de s curit mise la terre. TCe produit contient des composants lectriques ou lectroniques. S ils ne sont pas mis auxrebuts ad quatement, ces composants pourraient nuire l environnement ou la sant des humains. La pr sence de cette tiquette sur le produit tantque d chet non tri , mais faire l objet d une collecte s lective. Comme consommateur, vous devez vous assurer que ce produit est mis aux rebuts de la bonne mani re. conseillons de conserver les consignes li es s curit et au fonctionnement de l appareil pour consultation future. devez suivre toutes les consignes li es au fonctionnement et l utilisation de l appareil.
Observez toutes les mises en garde Vous
Suivez toutes les consignes Vous devez suivre
N utilisez pas cet appareil pr s de l eau toutes les consignes li es au fonctionnement et l utilisation de l appareil. L appareil ne doit pas tre utilis pr s de l eau ou dans un lieu humide, par exemple dans un sous-
sol humide ou pr s d une piscine et autres. ettoyez uniquement l aide d un chiffon sec. l appareil conform ment aux consignes du fabriquant. installez pas l appareil proximit d une source de chaleur comme un radiateur, une bouche de chaleur, une cuisini re ou d autres appareils qui produisent de la chaleur (y compris les e contournez pas le dispositif de s curit de la mise la terre comporte deux lames, en plus d une broche de masse. La lame plus large ou la broche de masse vise assurer votre s curit . Si prise, adressez-vous un lectricien pour faire remplacer la prise, qui est probablement d su te. Protect the power cord from being wal ed on or pinched particularly at plugs, convenience receptacles, and the point where they exit from the apparatus. Placez le cordon d alimentation de sorte qu il ne risque pas d tre pi tin ou coinc , prise de courant, ainsi qu au point de sortie de l appareil. recommand s par le fabricant. tilisez l appareil uniquement avec le chariot de manutention, le support, le tr pied ou la table recommand par le fabricant ou vendu avec l appareil. Si vous utilisez un chariot, d placez- le vous blesser. D branchez l appareil en cas d orage ou lorsqu il reste inutilis pendant une p riode prolong e. ne r paration est n cessaire si l appareil a t endommag d une mani re ou d une autre, par exemple lorsque le cordon d alimentation renvers sur l appareil, ou si des objets sont tomb s sur celui-ci, l'appareil a t expos la pluie ou l'humidit , s il fonctionne mal ou s il est tomb . Please eep the unit in a well-ventilated environment. Veuillez installer l appareil un endroit bien a r . 2Fr RENSEI NEMENTS S R LA S C RIT 3RXUYRXVDVVXUHUGXIRQFWLRQQHPHQWDEOHHWVpFXULWDLUHGHFHWpTXLSHPHQWYHXLOOH]OLUHDYHFDWWHQWLRQ
les consignes de ce guide dutilisation, et plus particulirement les renseignements ci-dessous portant sur la scurit. S C RIT LECTRI E
/HWpOpYLVHXUQHGRLWrWUHUDFFRUGpTXjODOLPHQWDWLRQSULQFLSDOHjXQHWHQVLRQFRUUHVSRQGDQWjFHOOH
indique sur ltiquette larrire de lappareil. Pour viter les surcharges, ne branchez pas plusieurs autres appareils lectroniques sur la prise utilise pour le tlviseu. gens circulent. Pour viter le pitinement et les chutes, ne placez pas les cbles de connexion des endroits o les Pour viter dendommager les cbles de connexion, ne posez pas dobjets lourds sur ceux-ci.
/RUVGXGpVDFFRXSOHPHQWGHODFKHGXQHSULVHWLUH]VXUODFKHHWQRQVXUOHFkEOH
En cas dorage ou lorsque le tlviseur reste inutilis pendant une priode prolonge, fermez linterrupteur dalimentation larrire de lappareil. vitez de laisser de leau ou de lhumidit pntrer lintrieur du tlviseur ou de ladaptateur de courant. Nutilisez PAS lappareil dans une pice mouille ou humide, comme une salle de bain ou une cuisine pleine de vapeur, ou prs dune piscine.
'pEUDQFKH]LPPpGLDWHPHQWODSSDUHLOHWGHPDQGH]ODLGHGXQSURIHVVLRQQHOVLODFKHRXOHFkEOHHVW
endommag, si du liquide a t renvers sur le tlviseur, si celui-ci est expos accidentellement de OHDXRXGHOKXPLGLWpVLXQREMHWTXHOFRQTXHSpQqWUHGDQVOHVRULFHVGHYHQWLODWLRQSDULQDGYHUWDQFHRX
si le tlviseur ne fonctionne pas normalement. Laissez les couvercles de scurit en place. Il ny a aucune pice rparable par lutilisateur lintrieur. Il HVWGDQJHUHX[GHWHQWHUSDUYRXVPrPHGHUpSDUHUODSSDUHLOHQRXWUHFHODSRXUUDLWDQQXOHUODJDUDQWLH
GXSURGXLW6HXOVGHVWHFKQLFLHQVTXDOLpVSHXYHQWUpSDUHUFHWDSSDUHLO
Pour viter quelles fuient, retirez les piles de la tlcommande si vous ne lutilisez pas pendant une priode prolonge ou si les piles sont puises. Nouvrez pas les piles et ne les jetez pas au feu lorsquelles sont puises. Pour de meilleurs rsultats , utilisez le type AAA ( exemple - alcalines , carbone - zinc , etc. ) batteries.
,QVWDOOH]XQLTXHPHQWGHVSLOHVQHXYHVGXPrPHW\SHGDQVYRWUHSURGXLW
Le dfaut d'insrer les piles en respectant la polarit , comme indiqu dans le compartiment de la batterie , peut raccourcir la dure de vie des batteries ou piles risqueraient de fuir. Ne pas mlanger piles neuves et anciennes. Ne pas mlanger des piles alcalines , standard ( carbone - zinc) ou rechargeables ( nickel-cadmium ) ou (
/HVEDWWHULHVGRLYHQWrWUHUHF\FOpHVRXpOLPLQpHVFRQIRUPpPHQWDX[OLJQHVGLUHFWULFHVQDWLRQDOHVHW
nickel mtal hydrure ) rechargeables. locales. Ne tentez pas de recharger les piles jetables. Ne pas les bornes de la batterie en court-circuit. Gardez loin des enfant. S C RIT PH SI E de ptrole. 1REVWUXH]SDVOHVRULFHVGHYHQWLODWLRQVXUOHSDQQHDXDUULqUH9RXVSRXYH]SODFHUOHWpOpYLVHXUGDQV
un meuble, mais assurez-vous de . laisser un espace de dgagement dau moins 5 cm (2 po) tout autour. Ne tapez sur lcran du tlviseur et ne le secouez pas; vous risqueriez dendommager les circuits lintrieur. Prenez bien soin de la tlcommande. Pour nettoyer le tlviseur, utilisez un chiffon doux sec. Nutilisez pas de solvants, ni de liquides base Ninstallez pas lappareil proximit dune source de chaleur comme un radiateur, une bouche de FKDOHXUXQHFXLVLQLqUHRXGDXWUHVDSSDUHLOVTXLSURGXLVHQWGHODFKDOHXU\FRPSULVOHVDPSOLFDWHXUV
1HFRQWRXUQH]SDVOHGLVSRVLWLIGHVpFXULWpGHODFKHSRODULVpHRXGHODFKHGHW\SHPLVHjODWHUUH
8QHFKHSRODULVpHFRPSRUWHGHX[ODPHVGRQWOXQHHVWSOXVODUJHTXHODXWUH8QHFKHDYHFPLVHjOD
terre comporte deux lames, en plus dune broche de masse. La lame plus large ou la broche de masse YLVHjDVVXUHUYRWUHVpFXULWp6LODFKHIRXUQLHQHVWSDVFRPSDWLEOHDYHFYRWUHSULVHDGUHVVH]YRXVj
un lectricien pour faire remplacer la prise, qui est probablement dsute. 3ODFH]OHFRUGRQGDOLPHQWDWLRQGHVRUWHTXLOQHULVTXHSDVGrWUHSLpWLQpRXFRLQFpSDUWLFXOLqUHPHQWDX
QLYHDXGHODFKH
Dbranchez l'appareil lors des orages ou inutiliss pendant de longues priodes.
&RQH]WRXWHUpSDUDWLRQjXQWHFKQLFLHQTXDOLp8QHUpSDUDWLRQHVWQpFHVVDLUHVLODSSDUHLOIRQFWLRQQH
mal ou sil a t endommag dune manire ou dune autre (y compris le cordon dalimentation ou la FKH
Une rparation est aussi ncessaire lorsquun liquide a t renvers sur lappareil ou que des objets sont tombs sur celui-ci, si lappareil a t expos la pluie ou lhumidit, ou sil est tomb.
FPGLVWDQFHVPLQLPDOHVDXWRXUGHO DSSDUHLOSRXUXQHYHQWLODWLRQVXIVDQWH
/DYHQWLODWLRQQHGRLWSDVrWUHHPSrFKpHHQFRXYUDQWOHVRXYHUWXUHVGHYHQWLODWLRQDYHFGHVREMHWVWHOV
que des journaux, nappes, rideaux, etc. No hay fuente de llamas, como una vela encendida, se deben colocar sobre el aparato.
/
DWWHQWLRQGRLWrWUHDWWLUpHVXUOHVDVSHFWVHQYLURQQHPHQWDX[GHO pOLPLQDWLRQGHODEDWWHULH
3Fr PR PARATION l ments compris
I
Poste de t l vision T l commande et piles Socle de t l vision uatre vis
) 62x4B(
Manuel d utilisation uide uick Connect arantie Carte Manuel d utilisation Guide uic Connect Garantie Carte 4Fr Vue avant PRPARATION POWER LED IR 7 Pour faire basculer le tlviseur entre les modes Sous tension et Veille. Appuyez sur cette touche pour choisir la source du signal dentre. MISE SO S TENSION
. SO RCE
. MEN
. CH
-
. VOL -
. T moin de mise sous tension Apparat en bleu lorsque le tlviseur est allum. IR (Rcepteur infrarouge) Appuyez sur cette touche pour rgler le volume. Appuyez sur cette touche pour choisir un canal. Apparat en rouge lorsque le tlviseur est en mode veille. Reoit les signaux IR de la tlcommande. 5Fr PR PARATIO Vue arri re
. Cordon d alimentation Se branche dans une prise de courant c.a. Prise pour couteurs
. Port S Se raccorde aux couteurs. Se raccorde un dispositif de stoc age photos compatibles. LAN
. Entr es HDMI Se raccordent Le port de connexion de r seau. un appareil avec signal
. Entr e V A Se raccorde un ordinateur ou appareils dot s d une interface VGA. d autres
. Entr e PC A DIO Se raccorde la sortie audio d un ordinateur. Fr 6 10 LAN HDMI V A
. Entr e DTV TV Se raccorde VHF/ HF) E
. OPTI la prise de l antenne
l aide du c le coaxial RF. cette prise. Pour connecter un syst me de son num rique
. Entr e Audio Se raccorde la prise A DIO (L / R) de connecteurs de sortie des appareils audio externes. COMPOSITE COMPOSANT IN Se raccorde aux appareils AV avec prises de sortie vid o et audio pour composite/
composants ( /Pb/Pr). La vid o composite/
composante( /PB/PR) partage avec l entr e audio (D/G). Installation du socle PR PARATIO
1. Couchez le t l viseur face vers le bas sur une surface plate et coussin e pour viter de lendommager ou de rayer l cran.
2. Fixez le support de stand gauche l'unit principale en utilisant les 2 vis fournies . B ( 4 2 ) 6
3. Fixez le support de stand droite l'unit principale en utilisant les 2 vis fournies . B ( 4 2 ) 6 Retrait du socle en vue dun montage mural
1. Couchez le t l viseur face vers le bas sur une surface plate et coussin e pour viter de lendommager ou de rayer l cran.
2. Desserrez les 4 vis en tenant le socle, puis retirez-les.
3. Fixez le support mural au t l viseur en utilisant les trous de fixation larri re du t l viseur. Installez ce t l viseur en suivant les consignes comprises avec le support mural. VIS MONTAGE MURAL Monte el soporte VESA utilizando 4*M6*8 isom trica rosca tornillos( on compris ). MISE E GARDE MISE EN GARDE e jamais placer un t mur selon les instructions d'installation. l viseur dans un endroit instable. n t de graves blussures ou la mort.Plusieurs blessures,surtout aux enfants,peuvent en prenant de simples pr cautions comme:
tiliser les supports recommand s par le fabricant du t tiliser uniquement des meubles pouvant supporter s curitairement le t l viseur. tre vit es l viseur. l viseur pourrait tomber et causer l viseur ne d passe pas le bord du meuble. l viseur sur les meubles lev s(par exemple,armoires ou Assurer que le t e pas installer le t e pas placer le t l viseur sur un linge ou d autres mat riaux qui pourraient tre situ s entre le t l viseur et le meuble-support. Informer les enfants sur les dangers de monter sur les meubles pour toucher au t l viseur ou r gler les contr les. Si votre t l viseur actuel est est retenu ou d m nag ,les memes consid rations mentionn es ci-haut s'appliquent. 7Fr PRPARATION T L OMMANDE Fr TV) tlviseur. Sous tension et Veille. Pour basculer le tlviseur entre les modes Pour activer ou dsactiver le son du Pour slectionner un canal. ( ode ATV Pour entrer plusieurs numros de canal par 1. 2. 3. A S Appuyez sur pour slectionner l APPS
. MENU Pour afficher le menu daffichage
. SOUR E Pour choisir parmi les diffrentes I Pour revenir au canal prcdent. sources du signal dentre. TV exemple - . souhaite. lcran. I
. I S V A AV omponent. Vous permet de naviguer dans les Retour au menu prcdent. syst me en fonction de vos prfrences. Pour slectionner un canal. Pour rgler le volume. RETURN AS E T RATIO Pour slectionner le format de limage standard ide ide zoom zoom. VOL TV Appuyez sur pour mettre en mode TV. ancez la lecture ou mettre en pause. Inverser rapidement la lecture. Avancer rapidement la lecture. Passer au dbut de la prcdente chapitre 1 . O onfirme la slection dans les menus 11. 12. E IT Pour quitter le menu OS . 13. 1 . 1 . 1 . 1 . 1 . 1 . 2 . 21. 22. REE E 23. piste photo. 2 . ADD ERASE 2 . AV 2 . IN O 2 . MTS Pour basculer entre les diffrents canaux 2 . Passer au dbut de la prochaine chapitre On ute(A TIV SA TIV ST activ sur son slection du sous-titrage ON OFF audio STEREO ONO SAP. Afficher la chane prfre. e gel de la photo. Arr ter la lecture. piste photo. I dsactiv). 2 . V
.MODE Pour slectionner le mode de limage 3 . 31. S.MODE Pour slectionner le mode audio 32. LIST CONNE ION DES APPAREILS E TERNES Enregistreur Blu-ray /Lecteur Console de jeu OR C ble d antenne Cam ra vid o satellite VCR R cepteur satellite Syst me audio num rique C ble composite / composante
(non compris) C ble Audio (non compris) C ble RF (non compris) LAN HDMI HDMI V A C ble optique
(non compris) T N E N O P M O C O D I A I M D H I L A C T P O C ble VGA
(non compris) C ble audio de 3.5 mm (non compris) audio C ble
(non compris) C ble de r seau(non compris) couteurs Soundbar Ordinateur Appareil HDMI C ble HDMI (non compris) WIFI 9Fr PERSONNALISATION DES PARAM TRES D T L VISE R ne fois toutes les connexions physiques dans la prise de courant. t moin DEL rouge s allumera. cette tablies, branchez le cordon d alimentation tape, le t l viseur passera en mode Veille et le ne fois sous ce mode, appuyez sur la touches de l appareil ou de la t l commande pour allumer le t l viseur. Le t moin DEL rouge passera au bleu. t el zemulla suov euq siof erimerp aL noitarugifnoc ed tnatsissal ,ruesivl Westinghouse 5
Sil est impossible de trouver des canaux, cette fentre saffiche automatiquement. 7 o e omicile si vous choisissez ce mode, le mode de limage sera Standard. o e agasin slectionnez Dynamic Mode (Mode Dynamique) si vous souhaitez que limage soit plus claire. Ce mode peut parfois consommer plus dnergie lorsque vous utilisez le mode Volume/Son et le mode Image. a consommation E evrait tre inf rieure nergie u E E W. 0. Fr 10 VISIONNEMENT DE PHOTOS PERSO ALISATIO DES PARAM TRES D T L VISE R l'option PHOTOS et appuyez sur OK, puis il sautera OK pour entrer. Apr s avoir entr PHOTOS pour entrer. OK DEVICE FO ND DEVICE FO ND Lorsque l'image est en cours, la barre image de la s lectionner la fonction d sir e disponible sur la barre. CO TER DE LA M SI E tilisez les touches fl ches pour mettre en surbrillance l'option M SIC et appuyez sur OK, puis il sautera pour confirmer le lecteur ins r , appuyez sur OK pour entrer. DEVICE FO ND DEVICE FO ND Apr s avoir entr M SIC, utilisez les touches fl ches pour s lectionner le fichier musique et appuyez sur OK pour entrer. Apr s avoir entr le fichier musique, utilisez les touches fl ches pour s lectionner le musique souhait e, puis appuyez sur le bouton de lecture pour afficher. Lorsque le musique est en cours, la barre musique de la fonction sera affiche. pour s lectionner la fonction d sir e disponible sur la barre. tilisez les touches fl ches Fr 13 DEVICE FO ND DEVICE FO ND PERSO ALISATIO DES PARAM TRES D T L VISE R R RAL Appuyez sur MEN R LA ES TV et appuyez sur OK OOM MODE OOM G R RAL pour entrer et ajuster chaque param tre d'option. LAN E MEN TRANSPARENCE Pour s lectionner la langue des menus: anglais, fran ais ou espagnol. le d faut langue des menus l cran est l anglais. Pour activer ou d sactiver la fonction de transparence. ARR T/MARCHE OOM MODE M/
M /
slectionner le mode de zoom
/CI M Remarque vec un Source dentre diffrente, les options du mode zoom peuvent varier. V A R LA E Pour r gler les param tres des options avanc es: H-POS, V-POS, Horloge, Phase ou A TOMATI
(Mode Source VGA seulement) E. SO S TITRA E Mode CC Arret/marche S lection de base S lection avanc e CC1CC2CC3CC4 TE TE1,TE T2,TE TE3, TE TE4 Service1/Service2.../
Service6. Option Mode,MOD LE CARACT RES, AILLE,CARACT RES,MOD LE T DE CO TO R,CO LE R DE CO TO R,FG-COLOR, B B G-COLOR,OPACIT TE TE, G-OPACIT DLC S lectionnez cette option pour activer ou d sactiver la fonction de commande dynamique de la luminance/ARRET/MARCHE RESTA RER D FA T Pour restaurer les param tres par d faut du t l viseur. Fr 15 PERSO ALISATIO DES PARAM TRES D T L VISE R LA ES TV et appuyez sur OK Appuyez sur MEN R IMA E pour entrer et ajuster chaque param tre d'option. MODE D'IMA E Cycle entre les modes d image:
tilisateur. Dynamique/ orme/Fil/
CRAN LE L MINOSIT CONTRASTE CO LE R NETTET TINTE signal est faible ou inexistant.ARRET/MARCHE Permet d accro tre ou de diminuer la quantit de blanc dans l image. Permet de r gler l cart entre les parties clair es et sombres de l image. Permet de r gler l intensit des couleurs. Permet de r gler le niveau de nettet des contours entre les parties clair es et sombres de l image. Permet de r gler l quilibre entre les niveaux de rouge etde. TEMP RAT RE DE CO LE R Permet de basculer entre les temp ratures de couleur: Froid/ ormale/Chaud LA E R AVANC R duction du bruit R duire le niveau Fixer les options suivantes:
de bruit STRO G/ARRET/FAIBLE/MO E IMA E NORME Fr 16 AUDIO PERSO ALISATIO DES PARAM TRES D T L VISE R R SEAU Appuyez sur MENU R GLAGES TV et appuyez sur O AUDIO pour entrer et ajuster chaque param tre d'option. MODE SAIN ASS TRE LE ALAN E SORTIE AUDIO NUM RI UE AM IO ONIE SOUND AUTO VOLUME LANGUE AUDIO Permet de s lectionner une technique d am lioration audio : ORME/
M SI E/FIL/ TILISATEVR. Pour r gler l intensit relative des sons plus graves. Pour r gler l intensit relative des sons plus aigus. Pour r gler le volume relatif des haut-
parleurs dans un syst me qui en compte plusieurs. Pour s lectionner le mode de sortie audio num rique: RAW ou PCM. ARRET/MARCHE pour fournir une exp rience d' coute am lior e. ARRET/MARCHE pour contr ler automatiquement les niveaux de volume. Pour s lectionner la langue audio :
anglais, fran ais, espagnol. Appuyez sur MENU R GLAGES TV et appuyez sur O R SEAU pour entrer et ajuster chaque param tre d'option. T E DE R SEAU puis connectez le t l viseur au r seau MON R SEAU ADRESSE DE I connectez. Fr 17 PERSO ALISATIO DES PARAM TRES D T L VISE R La premi re fois lors de la connexion du r seau et tablir une connexion avec succ s, le menu CONFI RATION D R SEA appara tra, et confirmer NE T pour entrer le menu PERMETTRE TV INTERACTIVE. Ensuite, utilisez les touches fl ches pour s lectionner ACTIVER D SACTIVER la t pour confirmer. l vision interactive, et appuyez sur le bouton OK ou Nou HAVE INTERACTIVE TV Ensuite, vous entrerez le menu MAINTENANT VO S AVE TV INTERACTIVE, et utilisez la fl che HA T de la t l' mission que vous regardez. l commande pour obtenir le maximum de LA ES TV et appuyez sur OK Appuyez sur MEN R CANAL pour entrer et ajuster chaque param tre d'option. AIR C LE A TO SCAN FAVORIS MONTRER CACHER N M RO DE CANAL TI ETTE DE CANAL RENSEI NEMENTS S R LE SI NAL Pour s lectionner l antenne : Air ou C ble. S lectionnez la fonction Auto Scan pour scanner vos cha nes c bl es disponibles. comme canal favori. s lectionn . actuel. actuel. CANAL 50-1 KOCE-HD GOOD Fr 18 HE RE 6:05PM 05/01/1980 VERRO PERSO ALISATIO DES PARAM TRES D T L VISE R Appuyez sur MEN LA ES TV et appuyez sur OK R HE RE pour entrer et ajuster chaque param tre d'option. TIMER DE VEILLE Pour s lectionner une dur e au bout de laquelle le t l viseur passe automatiquement en mode Veille:
ARRET/10/.../180/240 min. OSD MIN TERIE F SEA HORAIRE ARRET/15s/30s/60s/120s/240s. Pour s lectionner un fuseau horaire:
Pacifique/Alas a/Hawalli/ ewfoundland/
Atlantique/Est/Centre/Mountagnes. ewfoundland. HE RE AVANC E Pour activer ou d sactiver l heure avanc e. Arret/Marche. HORLO E Appuyez sur MEN LA ES TV et appuyez sur OK R vERRO pour entrer et ajuster chaque param tre d'option. emar ue e mot de passe par dfaut est
. CHAN E PASSWORD tilisez les touches 0 9 pour entrer l ancien mot de passe, puis entrez le nouveau mot de passe 4 chiffres. Entrez le nouveau mot de S STEM LOCK S lectionnez cette option pour activer ou d sactiver le verrouillage du syst me. Les options suivantes S, Canada, RRT Setting and Reset RRT ( SA, Canada, R glage RRT et R initialisation RRT) ne seront accessibles que lorsque vous activerez le verrouillage du syst me. SA CANADA T l vision MPAA Canada Anglais Canada Fran ais Classement T l : Appuyez sur la touche O pour verrouiller ou d verrouiller le classement t l
. S lectionner le classement de la MPAA :
C-17 ou
/A,G, PG, PG-13, R,
. Permet de s lectionner le classement de la MPAA pour les anglophones:E,C,C8 ,G,PG,14 18 . Permet de s lectionner le classement de la MPAA pour le u bec : E, G, 8 ans , 13 ans , 16 ans , 18 ans .. PARAM TRES DE R INITIALISATION S lectionnez cette option pour r initialiser le r glage RRT. SERR RE CLAIR Effacer tous les param tres de verrouillage. RRT RRT Fr 19 PERSONNALISATION DES PARAMTRES DU TLVISEUR PARAM TRES DE APP Appuyez sur MEN SRXUDIFKHUO LQWHUIDFHSULQFLSDOH
XWLOLVH]OHVWRXFKHVpFKHVSRXUPHWWUHHQpYLGHQFH
R LA ES TV et appuyez sur OKSRXUFRQUPHU
(QVXLWHXWLOLVH]OHVWRXFKHVpFKHVSRXUVpOHFWLRQQHU
PARAM TRES DE APP pour entrer et ajuster chaque paramtre d'option. informations du compte. D SACTIVER APP 'pVDFWLYHU1HWL[HWHIIDFHUOHV
D SACTIVER APP Dsactiver Vudu et effacer les PARAM TRES TV INTERACTIVE informations du compte. 3RXUDFFpGHUjOD0XVHHWSURWHUGHV
diffrents programmes et spectacles de la tlvision Samba. Numro de srie lectronique. ESN SO RCE Appuyez sur SO RCE sur la tlcommande ou sur l'appareil principal pour afficher le menu de la source, puis utilisez les touches flches pour faire dfiler parmi les diffrentes sources d'entre:TV/AV/COMPONENT/HDMI1/HDMI2/HDMI3/VGA/USB, puis utilisez la flche pour mettre en surbrillance la source dsire, puis appuyez sur OK pour confirmer. Fr 20 CONTR LE PARENTAL Appuyez sur la touche MENU de lappareil principal ou de la tlcommande, puis sur les touches pour slectionner le menu VERRO. Utilisez les touches 0 9 pour entrer le mot de passe 4 chiffres qui vous permettra douvrir le menu VERROU. Si vous utilisez cette fonction, vous pouvez bloquer la diffusion de la programmation tlvisuelle indsirable. Contrle parental offre aux utilisateurs une grande varit d'options et de paramtres qui limitent ou "bloc '' la programmation qui peut apparatre sur le tlviseur. Contrle SDUHQWDOSHUPHWDX[XWLOLVDWHXUVGHGpQLUTXHOSURJUDPPHQRWHTX LOVFRQVLGqUHQWFRPPH
DFFHSWDEOHSRXUXQVSHFWDWHXUSOXVVHQVLEOHSOXVMHXQH,OSHXWrWUHSUpUpJOpHHWVRLWDOOXPp
RXpWHLQWSDUO XWLOLVDWHXUTXLVSpFLHOHQXPpURFRGHVHFUHWGXPRWGHSDVVHOHQRPEUH
G KHXUHVEORTXpHVSHXWpJDOHPHQWrWUHVSpFLp
$XGLHQFHJpQpUDOHHWOHEORFGHVHQIDQWVGHYUDLHQWWRXVGHX[rWUHSURJUDPPpVGDQVOD
PpPRLUHGXWpOpYLVHXU6pSDUHUOHVGLIIpUHQWHVFRWHVG pFRXWHVRQWVSpFLpHVSRXUOHV79
HWOHPRXYHPHQWLPDJHLQGXVWULHOHVGHX[V\VWqPHVGHQRWDWLRQGHYUDLHQWrWUHXWLOLVpVHW
bass sur l'ge des enfants. Vue d ensemble 3RXUDVVXUHUXQHFRXYHUWXUHFRPSOqWHGHWRXVOHVSURJUDPPHVGHWpOpYLVLRQOPVHW
mission de tlvision rgulire) en utilisant l'option Bloquer l'ge, choisissez une note la fois la MPAA et de tlvision tables indicatives des parents sur la page suivante. En outre, vous pouvez ajouter d'autres restrictions choisies dans le menu bloc de contenu et de sous-
menus. eOpPHQWVGRQWLOIDXWWHQLUFRPSWHDYDQWGHFRQJXUHUOHFRQWU{OHSDUHQWDO Dterminer qui note que vous considrez sont acceptables pour diffrents tlspectateurs. Par exemple, si vous choisissez TV-PG, les cotes plus restrictives sera automatiquement bloqu; certains tlspectateurs ne seront pas en mesure de voir: TV-PG, TV-14 ou TV-MA programmes nots. Vous pouvez bloquer la source vido auxiliaire entirement. Utilisez l'option de contenu Blk pour bloquer le programme contenu en fonction des paramtres individuels tels que: forte de dialogue, Bad langue, Scnes de sexe, Scnes de violence ou de fantaisie. Allez dans l'option Set Password et utilisez les touches numriques de la tlcommande SRXUGpQLUXQPRWGHSDVVHVHFUHWSXLVHQUHJLVWUH]OHPRWGHSDVVHLOHVWOHVHXOPR\HQ
G DFFpGHUDXPHQXGHFRQWU{OHSDUHQWDOHWGHPRGLHUOHUpJODJHGHVQRWHVRXGpVDFWLYHUOH
contrle parental. 9RXVSRXYH]GpQLUGLIIpUHQWHVUHVWULFWLRQVGHYLVLRQQHPHQWSRXUJUDQGSXEOLFHWSRXU
HQIDQWVFHOOHVFLSHXYHQWrWUHDFWLYHVSRXUOHVGHX[W\SHVGHWpOpVSHFWDWHXUVHQPrPH
temps. Indiquer simplement un blocage de contenu, par exemple les scnes de sexe, ne bloquera pas automatiquement la programmation issue des sources vido. 0rPHVLYRXVGpFLGH]GHQHSDVEORTXHUOHVHQWUpHV$8;OHVFRWHVTXHYRXVLQGLTXH]
bloqueront automatiquement la programmation issue des sources vido. Vous ne pouvez pas dsactiver le contrle parental en dbranchant le tlviseur de la prise de courant. Si lalimentation estcoupe, la plage dheures bloques sera automatiquement rinitialise sa valeur par dfaut. Fr 21 CONTRLE PARENTAL S st me de classement de la MPAA Description P P R NC 6LJQLFDWLRQ Le contenu noffensera pas la majorit des tlspectateurs.
/HVSDUHQWVSRXUUDLHQWYRXORLUHPSrFKHUOHXUV
enfants de regarder lmission en raison de son contenu. Lmission est inapproprie pour les pradolescents;
son contenu est plus choquant que celui des missions avec une cote PG. Grand public Surveillance parentale recommande Accord parental fortement recommand Rserv aux adultes Not for children under 17-contains strong element of sex and/or violence. En aucun cas destin aux enfants de moins de 17 Interdit aux moins ans. Prsente du contenu sexuel explicite. de 17 ans Films quivalent la cote NC-17. pornographiques Aucun classement La MPAA na pas attribu de cote cette mission. Aucun classement S st me de classement TV Parental uideline Rating S stem Slectionnez l'option VERRO dans les paramtres du WpOpYLVHXUSXLVXWLOLVH]OHVWRXFKHVpFKHVSRXUPHWWUH
en surbrillance USA et appuyez sur le bouton OK pour entrer. Slectionnez TV pour entrer ensemble parental systme de classement de TV. Description Tous les enfants Enfants de 7 ans Grand public TV TV TV TV P surveillance parentale recommande TV TVMA Accord parental fortement recommand Rserv aux adultes 6LJQLFDWLRQ Le contenu noffensera pas la majorit des tlspectateurs Jug convenable pour les enfants de plus de 7 ans;
peut contenir des scnes de YLROHQFHFWLYH
Convient tous les auditoires;
les enfants peuvent regarder cette programmation sans supervision. Ne convient pas aux jeunes enfants; peut contenir des propos suggestifs, un langage grossier et des scnes de sexe et de violence. Ne convient pas aux enfants de moins de 14 ans; peut contenir des propos abusifs, un langage. Adultes uniquement; peut contenir des propos abusifs, un langage grossier et des scnes de sexe et de violence.
Le classement canadien-anglais est utilis dans tout le Canada anglophone (C, C8+,G, PG,14+, 18+).
Le classement canadien-franais est utilis au Qubec (G,8 ans+, 13 ans+,16 ans+, 18 ans+).
La puce V-Chip bloquera automatiquement certaines catgories plus restrictive . Si vous bloquez la catgorie TV-Y, la catgorie TV-Y7 sera alors automatiquement bloque. De la mme manire, si vous bloquez la catgorie TV-G, alors toutes les catgories du groupe jeunes adultes seront bloques (TV-G, TV-PG,TV-14 et TV-MA).
TV-NO: Le canal est pas verrouill.. Fr 22 D PANNA E Si votre tlviseur ne fonctionne pas normalement ou si vous narrivez pas lallumer, YHXLOOH]YpULHUOHVpOpPHQWVGHGpSDQQDJHVXLYDQWV3RXULGHQWLHUOHSUREOqPHSHQVH]
DXVVLjYpULHUWRXVOHVDXWUHVDSSDUHLOVpOHFWURQLTXHVFRQQHFWpVSDUH[HPSOHOHOHFWHXUGH
DVD ou le lecteur Blu-ray. Si le tlviseur ne fonctionne toujours pas normalement, s'il vous plat contacter le support technique. Le t l viseur ne fonctionne pas normalement Le t l viseur ne r pond pas quand vous appu ez sur les touches Il est impossible d allumer le t l viseur
,ODUULYHTXHOHWpOpYLVHXUVHJHHQFRXUVGXWLOLVDWLRQ'pEUDQFKH]
le cordon dalimentation de la prise de courant pendant quelque minutes. Rebranchez lappareil et tentez de lutiliser de la manire habituelle. Assurez-vous que le tlviseur est branch dans la prise lectrique Assurez-vous que tous les appareils AV connects sont teints avant dallumer le tlviseur La t l commande ne fonctionne pas Le t l viseur s teint subitement La fonction vid o est inop rante Pas d image et pas de son L image appara t lentement apr s avoir allum le t l viseur Aucune couleur, ou couleur ou image de pi tre qualit arre horizontale ou verticale, ou tremblement de l image Mauvaise r ception sur certains canau Des lignes ou des stries dans les images Aucune image lors de la conne ion Le format de l image semble incorrect La fonction audio est inop rante L image est bonne, mais il n a pas de son Aucune sortie de l un des haut parleurs Son inhabituel depuis l int rieur du t l viseur Aucune son lors de la conne ion HDMI Audio noise 9pULH]VLGHVREMHWVVLWXpVHQWUHOHWpOpYLVHXUHWODWpOpFRPPDQGH
peuvent bloquer le signal. Assurez-vous de viser directement le tlviseur avec la tlcommande.
-). 9pULH]VLODSRODULWpGHVSLOHVLQVWDOOpHVHVWDGpTXDWHYHUVYHUV
Installez de nouvelles piles. 9pULH]ODOLPHQWDWLRQGXWpOpYLVHXU/DSULVHpOHFWULTXHHVWSHXWrWUH
9pULH]VLOHPLQXWHXUGHPLVHHQYHLOOHHVWSURJUDPPp
9pULH]VLODIRQFWLRQGHPLVHHQYHLOOHDXWRPDWLTXHHVWDFWLYpH
coupe. 9pULH]VLOHWpOpYLVHXUHVWDOOXPp
(VVD\H]GHFKDQJHUGHFKDvQH/HSUREOqPHSURYLHQWSHXWrWUHGX
tldiffuseur. Cest normal; limage est cache pendant le processus de dmarrage du tlviseur. Veuillez communiquer avec le service dassistance si limage napparat pas au bout de cinq minutes. tldiffuseur. Rglez les paramtres dans le menu IMAGE.
(VVD\H]GHFKDQJHUGHFKDvQH/HSUREOqPHSURYLHQWSHXWrWUHGX
9pULH]VLOHVFkEOHVYLGpRVRQWELHQUDFFRUGpV
Cherchez une source dinterfrence locale, par exemple un appareil mnager ou un outil lectrique. GLIFXOWpVFKDQJH]GHFKDvQH meilleure rception.
/DVWDWLRQRXODFKDvQHFkEOpHpSURXYHQWSHXWrWUHGHV
6LJQDOGHODVWDWLRQSHXWrWUHIDLEOHUHSRVLWLRQQHUO DQWHQQHSRXUXQH
Recherchez des sources d'interfrences possibles. 9pULH]ODQWHQQHFKDQJH]VDSRVLWLRQ
9pULH]VLODVRXUFHGHQWUpHHVW+'0,+'0,+'0,
Rglez les paramtres de format dimage dans le menu CONFIGURATION ou appuyez sur la touche ASPECT de la tlcommande. Appuyez sur les touches VOL +/-. Le son est-il dsactiv? Appuyez sur la touche MUTE
(VVD\H]GHFKDQJHUGHFKDvQH/HSUREOqPHSURYLHQWSHXWrWUHGX
tldiffuseur. Rglez les paramtres dquilibrage dans le menu AUDIO Un changement de lhumidit ou de la temprature ambiante peut provoquer un bruit inhabituel au moment dallumer ou dteindre le tlviseur; cela nindique pas une dfaillance de lappareil. 9pULH]VLODVRXUFHG HQWUpHHVW+'0,+'0,+'0,
Keep the RF coaxial cable away from the other connected cables. Fr 23 TROUBLESHOOTING Mot de passe Mot de passe perdu There is a problem in PC mode Le signal est hors de port e(format non valide) arre verticale ou strie sur l arri re plan, bruit horizontal et position incorrecte Couleur instable l cran ou verticale. la position H/V dans le menu LOCK (VERROU), puis entrez le mot de passe matre suivant : 8899 . Celui-ci efface votre mot de passe prcdent et vous permet dentrer un nouveau mot de passe. Rglez la rsolution, la frquence horizontale ou la frquence Rinstallez la carte vido du PC. les questions de d pannage suivantes. tre trop loin du routeur WIFI. Assurez-vous que le mot de passe est entr avec correctes lettres majuscules ou minuscules. Essayez d'teindre et de dbrancher la tlvision pour rinitialiser la tlvision. interfrences ou canal WIFI problmes. vidos 4K en streaming Vudu est disponible uniquement aux tats-Unis et Pandora disponible uniquement dans les pays limits. Probl mes avec le streaming vid o conne ion Vous ne pouvez pas utiliser Vudu et Pandora ENTRETIEN Ne pas utiliser le tlviseur dans des endroits trop chauds ou trop froids, car le meuble pourrait se gauchir ou lcran pourrait ne pas fonctionner correctement. Le tlviseur fonctionne de faon optimale des tempratures dans lesquelles vous tes laise. Conserver le tlviseur une temprature variant entre 0 C et 50 C (soit entre 32 F et 122 F). La temprature de fonctionnement varie entre 0 C et 35 C (soit entre 32 F et 95 F). Ne pas installer le tlviseur dans un endroit expos directement la lumire du soleil ou proche dune source de chaleur.
- la ventilation ne doit pas tre empche en couvrant les ouvertures de ventilation avec des objets tels que des journaux, nappes, rideaux, etc. ;
placs sur l'appareil
- l'attention doit tre attire sur les aspects environnementaux de l'limination de la batterie. Fr 24 CARACT RISTI ES TECHNI E Taille de l cran Technologie de l cran cran 60 Hz ou 120 Hz Soutien HDMI R solution de l cran Format de l image Ratio de contraste dynamique de l cran Temps de r ponse (G Dur e de vie de la lampe (Calcul e en heures) Angle de visionnement horizontal Angle de visionnement vertical Montage mural (LxW-mm) CR>10) CR>10) G) D claration de la FCC 32 pouces en diagonales DLED TFT 60 Hz 1366 x 768 1360 x 768 1366 x 768 16:9 1200:1 8 ms 30,000 hours 178 178 200*100 VESA(mm) Cet appareil est conforme la partie 15 des r glements FCC. Son fonctionnement est soumis aux deux conditions suivantes : (1) l'appareil ne provoquera pas d'interf rences nuisibles, et (2) il doit accepter les interf rences re es, y compris celles pouvant provoquer un fonctionnement ind sir . NOTE Cet appareil a et jug conforme aux limitations des appareils num riques de classe B en vertu de la section 15 des r glements de la FCC. Ces limitations sont con ues pour fournir une protection raisonnable contre les interf rences nocives dans un environnement domestique Cet quipement produit, utilise et peut mettre de l nergie radio pr sentes consignes, peut causer des interf rences nuisibles aux communications radio. Il n existe toutefois aucune garantie que de telles interf rences ne se produiront pas dans une installation particuli re. Si cet appareil cause des interf rences nuisibles la r ception des signaux de radio ou de t lectrique et, s il n est pas install et utilis conform ment aux l vision, ce qui peut test t tre d termin en allumant et en teignant l appareil, l utilisateur peut tenter de r soudre le probl me en prenant une ou plusieurs des mesures suivantes: 1)r orienter ou d placer l antenne r ceptrice 2)augmenter la distance s parant l quipement du r cepteur 3)brancher l appareil sur un circuit diff rent de celui du D claration d'e position au ra onnements de la FCC non contr l rayonnant et votre corps. Cet quipement doit tre install et utilis une distance minimale de 20 cm entre l'
l ment Fr 25 Si vous voulez savoir sur ces informations APP ou obtenir plus de service. Sil vous plat se rfrer la suite du contenu. OTT APP SEVICE Vous pouvez appeler le tlphone suivant pour plus daide: 866-579-7172 Si votre question est relative au service la clientle, sil vous plat se rfrer com/help pour obtenir les coordonnes alternative. YouTube Vous pouvez consulter le site Web suivant pour plus daide:
https://productforums.google.com/forum/#!categories/youtube/smart-tvs VUDU Vous pouvez appeler le tlphone suivant pour plus daide: 888-554-8838 TG Vous pouvez appeler le tlphone suivant pour plus daide: 888-874-5411 Pandora Vous pouvez envoyer un e-mail Pandora pour plus daide: pandora-support@pandora.com AccuWeather Vous pouvez envoyer un e-mail AccuWeather pour plus daide: CustomerService@AccuWeather.com COMMENT BNFICIER DE LA GARANTI services domicile, veuillez composer le (800) 701-0680. Fr 26 CONTENIDO Instrucciones de seguridad importantes Informaci n de seguridad Preparaci n u se incluye Vista frontal Vista posterior Instalaci n del soporte Extracci n del soporte para el montaje en la pared Control remoto Cone i n de dispositivos e ternos Personalizar la configuraci n del televisor Flujo Muse Mis Medios Ver im genes Escuchar m sica Viendo videos Ajustes de TV General Imagen Audio Red Canal Hora Bloqueo Ajustes de APP Source Control parental Soluci n de problemas Mantenimiento OTT APP Servicio arant a limitada 1Es RIDAD IMPORTANTES ADVERTENCIA Para reducir el riesgo de incendio o descarga el ctrica, no exponga este aparato a la lluvia ni a la humedad. El aparato no debe ser expuesto a goteos o salpicaduras. o se deben colocar sobre el aparato ADVERTENCIA Las pilas no se deben exponer a un calor excesivo como el del sol, fuego o similares. ADVERTENCIA EL enchufe de la red se utiliza como dispositivo de desconexi n, el dispositivo de desconexi n debe estar siempre disponible. ADVERTENCIA Para reducir el riesgo de descarga el ctrica, no retire la cubierta (o parte posterior) ya que no hay piezas que el usuario pueda reparar. Remita el de un tri ngulo equil tero est destinado a alertar al usuario de la presencia de voltaje peligroso sin aislamiento dentro de la carcasa del producto constituir un riesgo de descarga el ctrica. El signo de exclamaci n dentro de un tri ngulo equil tero est destinado a alertar al usuario de la presencia de instrucciones importantes de funcionamiento y mantenimiento en la informaci n que acompa a al aparato. Este equipo es de Clase II o producto el ctrico de doble aislamiento. Se ha dise ado de tal manera que no requiere una conexi n de seguridad de tierra el ctrica. Este producto contiene materiales el ctricos o electr nicos. La presencia de estos materiales pueden, si no se desechan adecuadamente, tener posibles efectos adversos sobre el medio ambiente y la salud humana. La presencia de debe desechar como residuo dom stico y se debe recoger por separado. Como consumidor, es responsable de asegurarse que este producto se deseche adecuadamente. INSTR CCIONES DE SE Lea estas instrucciones todas las instrucciones de seguridad y sobre el funcionamiento se deben leer antes de utilizar este producto. Guarde estas instrucciones las instrucciones de seguridad y sobre el funcionamiento se deben conservar para futuras referencias. Tome en cuenta todas las advertencias todas las advertencias en el producto y en las instrucciones sobre el funcionamiento se deben cumplir. Follow all instructions All operating and use instructions should be followed. o use este aparato cerca del agua el producto no se debe usar cerca del agua o la humedad, por ejemplo, en un s tano h medo o cerca de una piscina, y similares. Limpie s lo con un pa o seco. o bloquee las aberturas de ventilaci n. Instale de acuerdo con las instrucciones del fabricante. o lo instale cerca de fuentes de calor, como radiadores, calefactores, estufas u otros aparatos o anule el prop sito de seguridad del enchufe polarizado o con conexi n a tierra. n enchufe polarizado tiene dos patas,una m s ancha que la otra. n enchufe con conexi n a tierra tiene dos patas y una tercera clavija con conexi n a tierra. La pata ancha o la tercera clavija se proporciona para su seguridad. Si el enchufe proporcionado no encaja en el tomacorriente, consulte a un electricista para que reemplace el tomacorriente obsoleto. Proteja el cable de alimentaci n para que no sea pisado o aplastado, especialmente en la parte de los enchufes,recept culos y en el punto en el que salen del aparato. fabricante. se s lo con un carro, base, tr pode, soporte o mesa aparato. Cuando se utiliza un carro o un estante, tenga cuidado cuando mueva la combinaci n de carro/aparato para evitar lesiones si ste se vuelca. Desenchufe el aparato durante las tormentas el ctricas o cuando no los utilice durante per odos de tiempo prolongados. Se requiere servicio cuando el aparato ha sido da ado de cualquier manera, como cuando el cable de alimentaci n o el enchufe est da ado, se ha derramado l quido o han ca do objetos dentro del aparato, el aparato ha sido expuesto a la lluvia o a la humedad, si no funciona normalmente o se ha ca do. Mantenga la unidad en un ambiente bien ventilado. 2Es INFORMACI N DE SE RIDAD 3DUDJDUDQWL]DUTXHHVWHHTXLSRWHQJDXQIXQFLRQDPLHQWRFRQDEOH\VHJXUROHDFXLGDGRVDPHQWHWRGDV
ODVLQVWUXFFLRQHVGHHVWDJXtDGHOXVXDULRHVSHFLDOPHQWHODVLJXLHQWHLQIRUPDFLyQGHVHJXULGDG
Seguridad el ctrica El televisor slo se debe conectar a una fuente de alimentacin principal con el voltaje que coincida con la etiqueta en la parte trasera del producto. 3DUDSUHYHQLUXQDVREUHFDUJDQRFRPSDUWDODPLVPDWRPDGHFRUULHQWHFRQGHPDVLDGRVFRPSRQHQWHV
electrnicos. No coloque los cables de conexin en donde puedan ser pisados o se puedan tropezar con ellos. 1RFRORTXHREMHWRVSHVDGRVVREUHQLQJ~QFDEOHGHFRQH[LyQ\DTXHSXHGHGDxDUHOFDEOH
6RVWHQJDHOHQFKXIHSULQFLSDOQRORVFDEOHVDOUHWLUDUORGHXQHQFKXIH
'XUDQWHXQDWRUPHQWDHOpFWULFDRFXDQGRQRXWLOLFHHOWHOHYLVRUGXUDQWHXQSHULRGRSURORQJDGRGHVFRQHFWHHO
interruptor de encendido en la parte posterior del televisor. 1RSHUPLWDTXHHQWUHDJXDRKXPHGDGDOWHOHYLVRURDODGDSWDGRUGHFRUULHQWH12ORXVHHQiUHDVPRMDGDVR
K~PHGDVFRPREDxRVFRFLQDVKXPHDQWHVRFHUFDGHSLVFLQDV
([WUDLJDHOHQFKXIHGHLQPHGLDWR\EXVTXHD\XGDSURIHVLRQDOVLHOHQFKXIHRHOFDEOHVHGDxDQVHKD
GHUUDPDGROtTXLGRHQHODSDUDWRVLHOWHOHYLVRUDFFLGHQWDOPHQWHVHKDH[SXHVWRDDJXDRKXPHGDGVLDOJR
penetra accidentalmente por las ranuras de ventilacin o si el televisor no funciona con normalidad. 1RUHWLUHODVFXELHUWDVGHVHJXULGDG1RKD\SLH]DVTXHHOXVXDULRSXHGDUHSDUDU(VSHOLJURVR\SXHGHDQXODU
ODJDUDQWtDGHOSURGXFWRVLLQWHQWDUHSDUDUODXQLGDGXVWHGPLVPR6yORHOSHUVRQDOFDOLFDGRGHEHUHDOL]DUHO
mantenimiento de este aparato. 3DUDHYLWDUIXJDVGHODVSLODVUHWLUHODVSLODVGHOFRQWUROUHPRWRFXDQGRHOFRQWUROUHPRWRQRVHXVDGXUDQWH
PXFKRWLHPSRRFXDQGRVHDJRWDQODVSLODV
1RDEUDQLWLUHODVSLODVXVDGDVDOIXHJR
3DUDREWHQHUORVPHMRUHVUHVXOWDGRVHOXVRGHWLSR$$$HMHPSORDOFDOLQDVGHFDUERQR]LQFHWFEDWHUtDV
Instale slo pilas nuevas del mismo tipo en su producto.
)UDFDVRSDUDLQVHUWDUODVSLODVFRQODSRODULGDGFRUUHFWDWDOFRPRVHLQGLFDHQHOFRPSDUWLPLHQWRGHODEDWHUtD
SXHGHDFRUWDUODYLGD~WLOGHODVEDWHUtDVRFDXVDUIXJDVHQODVSLODV
No mezcle pilas viejas y nuevas. 1RPH]FOHSLODVDOFDOLQDVHVWiQGDUFDUERQR]LQFRUHFDUJDEOHVQtTXHOFDGPLRREDWHUtDVQtTXHOPHWDO
Las bateras deben reciclarse o desecharse de acuerdo con las normas estatales y locales. 1RLQWHQWHUHFDUJDUODVSLODVGHVHFKDEOHV
No cortocircuite los terminales de la batera. Mantener alejado de los nios. 1REORTXHHODVUDQXUDVGHYHQWLODFLyQHQODFXELHUWDSRVWHULRU3XHGHFRORFDUHOWHOHYLVRUHQXQPXHEOHSHUR
DVHJ~UHVHGHTXHKD\DFPGHHVSDFLRSRUWRGRVODGRV
1RJROSHHQLVDFXGDODSDQWDOODGHOWHOHYLVRU\DTXHSXHGHGDxDUORVFLUFXLWRVLQWHUQRV&XLGHELHQHOFRQWURO
3DUDOLPSLDUHOWHOHYLVRUXVHXQSDxRVXDYH\VHFR1RXWLOLFHVROYHQWHVRXLGRVDEDVHGHSHWUyOHR
1RORLQVWDOHFHUFDGHIXHQWHVGHFDORUFRPRUDGLDGRUHVFDOHIDFWRUHVHVWXIDVXRWURVDSDUDWRVLQFOX\HQGR
DPSOLFDGRUHVTXHSURGX]FDQFDORU
1RDQXOHHOSURSyVLWRGHVHJXULGDGGHOHQFKXIHSRODUL]DGRRFRQWRPDGHWLHUUD8QHQFKXIHSRODUL]DGRWLHQH
GRVSDWDVXQDPiVDQFKDTXHODRWUD8QHQFKXIHFRQFRQH[LyQDWLHUUDWLHQHGRVSDWDV\XQDWHUFHUDFODYLMD
FRQFRQH[LyQDWLHUUD/DSDWDDQFKDRODWHUFHUDFODYLMDVHSURSRUFLRQDSDUDVXVHJXULGDG6LHOHQFKXIH
SURSRUFLRQDGRQRHQFDMDHQHOWRPDFRUULHQWHFRQVXOWHDXQHOHFWULFLVWDSDUDTXHUHHPSODFHHOWRPDFRUULHQWH
obsoleto. 3URWHMDHOFDEOHGHDOLPHQWDFLyQSDUDTXHQRVHDSLVDGRRDSODVWDGRHVSHFLDOPHQWHHQODSDUWHGHORV
enchufes.
'HVHQFKXIHHODSDUDWRGXUDQWHODVWRUPHQWDVHOpFWULFDVRFXDQGRQRORVXWLOLFHGXUDQWHSHUtRGRVSURORQJDGRV
5HPLWDWRGRPDQWHQLPLHQWRDXQSHUVRQDOGHVHUYLFLRFDOLFDGR6HUHTXLHUHVHUYLFLRFXDQGRHODSDUDWRQR
IXQFLRQDQRUPDOPHQWHRVLHODSDUDWRLQFOX\HQGRHOFDEOHGHDOLPHQWDFLyQRHOHQFKXIHVHKDGDxDGRGH
DOJXQDPDQHUD
7DPELpQVHUHTXLHUHVHUYLFLRVLVHKDGHUUDPDGROtTXLGRRKDQFDtGRREMHWRVGHQWURGHODSDUDWRFXDQGRKDVLGR
expuesto a la lluvia o a la humedad o si se ha cado.
FPPtQLPDVDOUHGHGRUGHODSDUDWRSDUDXQDYHQWLODFLyQDGHFXDGD
/DYHQWLODFLyQQRGHEHLPSHGLUVHDOFXEULUODVDEHUWXUDVGHYHQWLODFLyQFRQREMHWRVFRPRSHULyGLFRVPDQWHOHV
FRUWLQDVHWF
$XFXQHVRXUFHGHDPPHQXHWHOOHTXHGHVERXJLHVDOOXPpHVGRLYHQWrWUHSODFpVVXUO DSSDUHLO
Debe prestarse atencin a los aspectos ambientales de la eliminacin de la batera. KLGUXUR
remoto. Seguridad f sica 3Es PREPARACI N u se inclu e
I
Televisor Control remoto con pilas Soporte de TV Cuatro Tornillos
) 62x4B(
Manual del usuario u a de cone i n r pida arant a Tar eta Manual del usuario Gu a de conexi n Garant a Tarjeta r pida 4Es Vista Frontal PREPARACI POWER LED IR 7 Encienda el televisor entre modo Encendido / De espera. Presione para seleccionar entre las diferentes fuentes de se al de entrada. ENCENDIDO
. F ENTE
. MEN
. CH
-
. VOL -
Presione para ajustar el volumen. Visualice el men principal. Presiones para seleccionar un canal. Indicador de POWER Se iluminar en azul cuando el televisor est Se iluminar en rojo cuando el televisor est
. IR (Receptor de infrarro o) Recibe las se ales del IR del control remoto. encendido. en modo de espera. 5Es PREPARA I N Vista posterior 10 LAN HDMI V A
. Entrada DTV TV onecte a la toma ( 5 V F antena con el cable coaxial RF. PTICA onectar un sistema de sonido digital a F) de
. esta toma. Entrada de A DIO onecte a la toma A IO ( R) Tomas de salida de los dispositivos de audio externos. COMPOSITE COMPONENT IN onectar a dispositivos AV con una toma de salida de v deo y de audio composite componente( Pb Pr). El v deo compuesto y componente( P PR) se comparte con el Audio en( R). Cable de alimentaci n onecte a la toma de alimentaci n de corriente alterna ( A). Toma de auriculare
. Puerto S onecte los auriculares. onecte a un dispositivo de almacenamiento S para reproducir pel cula compatible y archivos de fotos. LAN
. Entradas HDMI Puerto de conexi n de red. onecte a un dispositivo de salida de
. Entrada V A onecte a una computadora u otros dispositivos con una interfaz V A. Entrada de A DIO de PC onecte a una salida de audio de la computadora. Es Instalaci n del soporte de la base
PREPARACI
.Coloque el televisor boca abajo sobre una superficie lisa y acolchonada para evitar que se da e o raye. Fije el soporte de la base izquierda de la unidad principal con 2 pcs tornillos proporcionados . Fije el soporte de la base derecho de la unidad principal con 2 pcs tornillos proporcionados . B ( 4 2 ) 6 B ( 4 2 ) 6
E tracci n del soporte para el monta e en la pared
.Coloque el televisor boca
acolchonada para evitar que se da e o raye. Afloje los 4 tornillos que sujetan el conjunto del soporte y elim nelos. Fije el soporte del montaje en la pared al televisor usando los agujeros de montaje en la parte posterior del televisor. Monte este televisor de acuerdo con las instrucciones incluidas en el soporte del montaje en la pared. Tornillos de monta e en pared Monte el soporte VESA utilizando 4 *M6*8 isom trica rosca tornillos ( o suministrado).
ADVERTENCIA pared seg n las instrucciones de instalaci n. ADVERTENCIA unca coloque el televisor en un lugar inestable. Puede que el televisor caiga, causando serios da os personales o la muerte. Podr evitar muchas lesiones, especialmente en las criaturas, tomando simples precauciones tales como:
se armarios o soportes recomendados por el fabricante del televisor. se un mueble que pueda soportar el televisor de manera segura. Aseg rese de que el televisor no sobresalga del borde del mueble. o coloque el televisor encima de muebles altos (por ejemplo, armarios o estanter as) sin haber sujetado tanto el mueble como el televisor a un soporte adecuado. o coloque el televisor encima de ropa u otros materiales que puedan estar ubicados entre el televisor y los muebles de soporte. Eduque a los ni os acerca de los peligros de subirse a los muebles para llegar al televisor o los controles de ste. Si va a conservar su televisor actual y va a colocarlo en otro lugar, igualmente deber tener en cuenta lo anteriormente expuesto. 7Es PREPARA I N Control Remoto Es nivel de sonido. Encienda el televisor E encendido o Silenciar y restaurar el sonido del televisor. Seleccione un programa (modo ATV TV) Introduzca el n mero de canal del programa
. apagado. m ltiple tal como - . Regresa al canal de visualizaci n anterior. APP Pulse para seleccionar la herramienta deseada. MEN Visualice la mano men del televisor. SO RCE Seleccione entre las diferentes fuentes de se al de entrada TV AV PbPr
. OS y a ustar la configuraci n del sistema seg n sus preferencias. OK
. RET RN Vuelve al men anterior. E IT Salir del men principal de TV. ASPECT Seleccione la relaci n de aspecto. onfirme la selecci n en el men OS e permite navegar por los men s
(On Screen I V A. isplay). I I settings standard ide ide zoom zoom ust Scan
(
by ot(V A). Pulse para aumentar di sminuir el Presione para cambiar los canales. Saltar al principio del cap tulo pista Saltar al principio del siguiente cap tulo aga avanzar la reproducci n r pidamente. Iniciar oro la reproducci n en pausa. Reproducci n hacia atr s r pidamente. I) ot
. VOL
. CH
. TV En el canal de televisi n. etenga la reproducci n. FREE E ongele la imagen. ADD ERASE Agregar o eliminar canales favoritos. FAV uestra la lista de canales favoritos. INFO uestra la fuente de entrada actual y
. MTS ambiar entre audio diferente CC Selecci n de subt tulos ON OFF
. ute. V CHIP onfigure el control parental. P.MODE Seleccione el modo de imagen
. S.MODE Seleccione el modo de sonido
. CH.LIST ostrar la lista de programas. On canales STEREO ONO SAP. dynamic movie user standard. standard music movie user. la informaci n del canal. foto anterior. pista foto. CONE I N DE DISPOSITIVOS E TERNOS Grabador Blu-ray/Reproductor Consola de Juegos OR Cmara de Video Satlite Cable de antena VCR Receptor de Satlite Sistema de Audio Digital Cable ptico(no se incluye) Cable Compuesto/
componente(no se incluye) Cable de Audio(no se incluye) Cable RF(no se incluye) LAN HDMI HDMI V A T N E N O P M O C O D I A I M D H I L A C T P O Cable de Audio
(no se incluye) Cable VGA(no se incluye) Cable de Audio de 3.5 mm(no se incluye) Auriculares Soundbar Cable de Red(no se incluye) WIFI Ordenador Dispositivo HDMI Cable HDMI (no se incluye) 9Es PERSONALI AR LA CONFI RACI N DEL TELEVISOR Conecte el cable de alimentaci n a la toma de corriente despu s de haber completado todas las conexiones f sicas. En esta etapa, el televisor pasar al modo de espera y el indicador LED rojo se iluminar . En el modo de espera, presione el bot n encender el televisor. El indicador LED rojo cambiar a azul. de la unidad principal o en el control remoto para
-
Westinghouse MODO DE ENCENDIDO MODO INICIO MODO RETAIL ATRAS Modo F cil optimiza ajustes de v deo del modo est ndar tilice las flechas arriba y abajo del mando a distancia TV o el teclado pare seleccionar el modo de energ a 5 7
Si no se pueden encontrar los canales, este marco se mostrar autom ticamente. o e omicile si vous choisissez ce mode, le mode de limage sera Standard. o e agasin slectionnez Dynamic Mode (Mode Dynamique) si vous souhaitez que limage soit plus claire. Ce mode peut parfois consommer plus dnergie lorsque vous utilisez le mode Volume/Son et le mode Image. El EEP-
E Po er (mo o e sus ensi n e alimentaci n) ebe ser inferior a 0. W. Es 10 VIS ALI ACI N DE FOTOS PERSONA I AR A ONFI RA I N E TE EVISOR DEVICE FO ND DEVICE FO ND ESC CHAR M SICA DEVICE FO ND DEVICE FO ND FOTOS y pulse OK unidad insertado pulse OK para entrar. espus de introducir FOTOS utilice los botones de OK para entrar espus de entrar en el archivo de imagen utilice los a continuaci n pulse el bot n de uego para mostrar. uando la imagen se reproduce se mostrar la barra seleccionar la funci n deseada disponible en la barra. tilice los botones de flecha para resaltar la opci n de M SICA y pulse OK entonces saltar para confirmar la unidad insertado pulse OK para entrar. espus de introducir M SICA utilice los botones de flecha para seleccionar el archivo de m sica y pulse OK para entrar. espus de entrar en el archivo de m sica utilice los botones de flecha para seleccionar la m sica deseada a continuaci n pulse el bot n de uego para mostrar uando la m sica se reproduce se mostrar la barra de m sica Funci n. para seleccionar la funci n deseada disponible en la barra. tilice los botones de flecha Es DEVICE FO ND DEVICE FO ND ENERAL OOM MODO DE OOM PERSO ALI AR LA CO FIG RACI DEL TELEVISOR Pulse MEN para visualizar la interfaz principal, utilice A STES DE TV ENERAL, de y pulse OK entrar y ajustar cada valor de la opci n. IDIOMA DEL MEN TRANSPARENCIA Seleccione el idioma del men :
Ingl s, Franc s o Espa ol. El valor predeterminado en pantalla del idioma del men es el Ingl s Seleccione para APAGADO/E CE DIDO la funci n de transparencia. MODO DE OOM Seleccione el modo zoom:
oom/ ORMAL/AMPLIA/CI EMA ota Con una fuente de entrada diferente, las opciones de modo de zoom pueden diferir. A STES DE V A avanzada: H-POS, V-POS, Reloj, Fase. Automatico (S lo en modo de fuente VGA) CIERREDE DE TIT LDS DLC RESTA RAR DEFECTO Modo CC Encendido/Apagado B sicosde Selecci n Selecci n Avanzada CC1CC2CC3CC4, TE TO1,TE TO2, TE TO3,TE TO4 Servicio1/Servicio2/.../
Servicio6. Modo, estilo de fuente, tama o de fuente, estilo del borde de fuente, el color del borde, color de frente, BG Color, FG Opacidad Opacidad BG. Seleccione para Encendido/Apagado la funci n de Dynamic Luminance Control. Opci n Restaure el televisor a la f brica. Es 15 PERSO ALI AR LA CO FIG RACI IMA EN DEL TELEVISOR Pulse MEN para visualizar la interfaz principal, utilice pulse OK TV SETTIN S y IMA EN, de entrar y ajustar cada valor de la opci n. MODO DEL IMA EN Ciclo entre los modos de imagen:
Din mico/Est ndar/Pel cula/ suario. PANTALLA A L Permite que el fondo azul se encedido/apagado RILLO CONTRASTE COLOR DEFINICION TEMPERAT RA DE TINTE COLOR durante condiciones de se al d bil o ninguna. Aumente o disminuya la cantidad de blanco en la imagen. Ajuste la diferencia entre los niveles de luz y oscuridad en las fotos. Controlar la intensidad del color. Ajuste el nivel de nitidez en los bordes entre las zonas claras y oscuras de la imagen. Ajuste el balance entre los niveles de rojo y verde. Ciclo entre las temperaturas de color:Fr o/ ormal/
Calitnte. A STES DEL APP Establecer las siguientes opciones:
Abaisser bruit Reduce el nivel de ruido del dispositivo conectado: Apagado/D bil/Medio/
Fuerte. EST NDAR Ajustes Del APP Es 16 A DIO PERSO ALI AR LA CO FIG RACI DEL TELEVISOR Pulse MEN para visualizar la interfaz principal, utilice A STES DE TV y pulse OK A DIO, de entrar y ajustar cada valor de la opci n. MODO SANO A O TRE LE ALANCE SALIDA DE A DIO DI ITAL Permite la selecci n de una t cnica de mejora de audio: Est ndar/M sica/
Pel cula/ suario. Controle la intensidad relativa de los sonidos de tono m s bajos. Controle la intensidad relativa de los sonidos de tono m s altos. Ajuste el volumen relativo de los altavoces en un sistema de m ltiples altavoces. Seleccione el modo de salida de audio digital entre RAW/PCM. ENVOLVENTE SO ND Proporcione una experiencia de sonido mejorada.Encendido/apagado VOL MEN Los niveles de volumen se controlan A TOM TICO autom ticamente.Encendido/apagado IDIOMA DE A DIO Seleccione el idioma de audio entre:
Ingl s, Franc s, Espa ol RED Pulse MEN para visualizar la interfaz principal, utilice A STES DE TV y pulse OK RED, de entrar y ajustar cada valor de la opci n. TIPO DE RED Seleccione LA y la red inal mbrica, a continuaci n, conectar el televisor a la red cableada o buscar en la red inal mbrica a trav s de b squedas MI RED DIRECCI N IP Mostrar la red actual a la que se conecta. Mostrar la informaci n de IP actual. Es 17 PERSO ALI AR LA CO FIG RACI DEL TELEVISOR La primera vez cuando se conecta a la red y hacer la conexi n con xito, de menu RED ACT ALI ACI N pop-up, y confirme SI IENTE para entrar en el men de ACTIVAR TV INTERACTIVA. Luego de seleccionar la opci n ACTIVAR y pulse el bot n OK para interactiva televisor y hacer algunos ajustes. ou Nou HAVE INTERACTIVE TV A continuaci n, se entra en el men AHORA TIENES TV INTERACTIVA, y el uso de flecha hacia arriba en el control remoto para obtener la mayor parte del programa que est viendo. Pulse MEN para visualizar la interfaz principal, utilice A STES DE TV y pulse OK CANAL, de entrar y ajustar cada valor de la opci n. AIRE CA LE A TO ESC NER Seleccione la antena entre aire y cable. Seleccione la funci n de auto esc ner para escanear los canales de cable disponibles. FAVORITOS canales favoritos. MOSTR OC LT Mostr/Ocult el canal seleccionado. N MERO DE CANAL Muestra el nombre del canal actual. ETI ETA CANAL Muestra el etiqueta del canal actual. SE AL DE Muestra la calidad de la actual se al INFORMACI N de informaci n. CANAL 50-1 KOCE-HD GOOD Es 18 HORA PERSO ALI AR LA CO FIG RACI DEL TELEVISOR 4:07PM 05/01/1980 LO EO Pulse MEN para visualizar la interfaz principal, utilice A STES DE TV HORA, de entrar y y pulse OK ajustar cada valor de la opci n. RELO DE DORMIR Seleccione un per odo de tiempo despu s del cual el televisor cambie autom ticamente al modo de espera:
Apagado/5/10/
/180/240 min. TEMPORI ADOR EN OSD ONA HORARIA Ajuste el temporizador de OSD:
Apagado/15s/30s/60s/120s/240s. Seleccione una zona horaria: Hawai/
Atl ntico/ enfound land HORA DE VERANO Seleccione para encender o apagar el horario de verano. Apagado/encendido Mostrar la hora del reloj. RELO Pulse MEN para visualizar la interfaz principal, utilice A STES DE TV LO EO, de y pulse OK entrar y ajustar cada valor de la opci n. ota a contrase a predeterminada es
. CAM IA CONTRASE A se los botones 0-9 para introducir la contrase a antigua y luego ingrese la nueva contrase a de 4 d gitos. Vuelva a introducir la LO EO DEL SISTEMA Seleccione para O /OFF el bloqueo del sistema. Las siguientes opciones (EE. Canad , Ajustes de RRT y Restaurar RRT), s lo se podr n acceder al encender el bloqueo del sistema. , EE. CANAD TV MPAA Canad Ingl s bot n OK para bloquear o desbloquear G, PG, PG-13, R, C-17, o
. los hablantes en ingl s Canad : E, C, C8 , G, PG, 14 , 18 . Canad Franc s Canad : E, G,8 ans , 13 ans , 16 ans , 18 ans . A STES DE RRT Ajuste el vector de caracter sticas de la regi n. RESET RRT LO EO DE CLARO RRT. Es 19 3(5621$/,=$5/$&21),*85$&,1'(/7(/(9,625 A STES DE APP Pulse MEN SDUDYLVXDOL]DUODLQWHUID]SULQFLSDOXWLOLFH
ORVERWRQHVGHHFKDSDUDUHVDOWDUA STES DE TV y pulse OKSDUDFRQUPDU$FRQWLQXDFLyQXWLOLFHORV
ERWRQHVGHHFKDSDUDVHOHFFLRQDUA STES DE APP
de entrar y ajustar cada valor de la opcin. DESACTIVAR APP 'HDFWLYDWH1HWL[DQGFOHDUWKHDFFRXQW
DESACTIVAR APP Deactivate Vudu and clear the account information. A STES TV INTERACTIVA ESN information. Para entrar en el Muse y disfrutar de los GLIHUHQWHVSURJUDPDV\HVSHFWiFXORVHQ
la televisin Muse. Nmero de serie electrnico. F ENTE Pulse F ENTE en el mando a distancia o en la unidad principal para visualizar el men GHIXHQWHDFRQWLQXDFLyQXWLOL]DUORVERWRQHVGHIOHFKDSDUDGHVSOD]DUVHHQWUHODV
GLIHUHQWHVIXHQWHVGHHQWUDGD79$9&RPSRQHQWH+'0,+'0,+'0,9*$86%D
FRQWLQXDFLyQXWLOLFHOD)OHFKDSDUDUHVDOWDUODIXHQWHGHVHDGD\SXOVHOK para confirmar. Es
CONTROL PARENTAL Presione el botn MEN HQODXQLGDGSULQFLSDORHQHOFRQWUROUHPRWR\OXHJRSUHVLRQHORVERWRQHV
izquierda o derecha para seleccionar el men de LO EO8VHORVERWRQHV3DUDLQWURGXFLU
ODFRQWUDVHxDGHGtJLWRVSDUDLQJUHVDUDOPHQ~GH LO EO6LVHXWLOL]DHVWDFDUDFWHUtVWLFD
GHRSFLyQSXHGHEORTXHDU
ODSURJUDPDFLyQQRGHVHDGDTXHDSDUH]FDHQHOWHOHYLVRU
&RQWUROSDUHQWDORIUHFHDOXVXDULRXQDDPSOLDYDULHGDGGHRSFLRQHV\FRQJXUDFLRQHVTXH
UHVWULQJHQREORTXHDQ
ODSURJUDPDFLyQTXHSXHGHDSDUHFHUHQHOWHOHYLVRU(OFRQWUROSDUHQWDO
SHUPLWHDOXVXDULRGHQLUTXpFODVLFDFLyQGHSURJUDPDFRQVLGHUDQDFHSWDEOHSDUDHOHVSHFWDGRU
PiVVHQVLEOH\MRYHQ3XHGHVHUSURJUDPDGR\HQFHQGLGRRDSDJDGRSRUHOXVXDULRTXH
HVSHFLFDODFRQWUDVHxDGHQ~PHURV(OXVXDULRSXHGHHVSHFLFDUDTXpKRUDEORTXHDUOD
SURJUDPDFLyQ
/RVEORTXHRVSDUDHOS~EOLFRJHQHUDO\SDUDORVQLxRVGHEHQVHUSURJUDPDGRVHQODPHPRULDGHO
WHOHYLVRU6HSDUHODVGLIHUHQWHVFODVLFDFLRQHVGHS~EOLFRTXHVHHVSHFLFDQHQODWHOHYLVLyQ\OD
LQGXVWULDFLQHPDWRJUiFDVHGHEHQXVDUDPERVVLVWHPDVGHFODVLFDFLyQ\HQEDVHDODVHGDGHV
de los nios. Descripci n general 3DUDDVHJXUDUXQDFREHUWXUDFRPSOHWDGHWRGRVORVSURJUDPDVGHWHOHYLVLyQSHOtFXODV
\SURJUDPDVUHJXODUHVGH79HOLMDODFODVLFDFLyQGH03$$DVtFRPRODV'LUHFWULFHVGH
FODVLFDFLyQSDWHUQDOHVGH79HQODSiJLQDVLJXLHQWH$GHPiVVLORGHVHDSRGUiDxDGLURWUDV
restricciones seleccionndolas del men de bloqueo de contenido y los submens.
$VSHFWRVDWHQHUHQFXHQWDDQWHVGHFRQJXUDUHO&RQWUROSDUHQWDO
'HWHUPLQHTXpFODVLFDFLRQHVFRQVLGHUDDFHSWDEOHVSDUDORVGLIHUHQWHVHVSHFWDGRUHV3RU
HMHPSORVLHOLJH793*ODVFODVLFDFLRQHVPiVUHVWULFWLYDVVHEORTXHDUiQDXWRPiWLFDPHQWH
DOJXQRVHVSHFWDGRUHVQRSRGUiQYHU3URJUDPDVFODVLFDGRVSDUDPHQRUHVGHDxRVFRQ
VXSHUYLVLyQSDUHQWDOSRUPD\RUHVGHDxRVRSRUPD\RUHVGHDxRV3XHGHEORTXHDUOD
fuente de vdeo auxiliar en su totalidad. 8VHODRSFLyQGHEORTXHRGH&RQWHQLGRSDUDEORTXHDUORVFRQWHQLGRVGHSURJUDPDVVHJ~Q
SDUiPHWURVLQGLYLGXDOHVWDOHVFRPRGLiORJRIXHUWHOHQJXDMHJURVHURHVFHQDVGHVH[RHVFHQDV
violentas o de fantasa. Vaya a la opcin de Establecer contrasea con las teclas de nmeros del mando a distancia para HVWDEOHFHUXQDFRQWUDVHxDVHFUHWD/XHJRJXDUGHODFRQWUDVHxDHVOD~QLFDIRUPDGHDFFHGHU
DOPHQ~GH&RQWUROSDUHQWDO\FDPELDUODFRQJXUDFLyQGHFODVLFDFLyQRGHVDFWLYDUHO&RQWURO
Parental. Puede establecer diferentes restricciones de visualizacin del Control Parental para pblico en JHQHUDO\QLxRVDPERVSXHGHQHVWDUDFWLYRVDOPLVPRWLHPSR
(VSHFLFDUXQEORTXHGHFRQWHQLGRFRPRHVFHQDVGHVH[RQRUHVWULQJLUiDXWRPiWLFDPHQWHOD
SURJUDPDFLyQTXHVHGHVSUHQGHGHODVIXHQWHVGHYLGHR
1FOXVRVLGHFLGHGHMDUODVHQWUDGDV$8;GHVEORTXHDGDVODVFODVLFDFLRQHVTXHVHHVSHFLFDQ
UHVWULQJLUiQDXWRPiWLFDPHQWHODSURJUDPDFLyQTXHVHGHVSUHQGHGHODVIXHQWHVGHYLGHR
No puede desactivar el Control Parental desenchufando el televisor. Las horas de bloqueo se UHVWDEOHFHUiQDXWRPiWLFDPHQWHDODFRQJXUDFLyQGHODKRUDEORTXHRRULJLQDOTXHHVSHFLFDVL
la alimentacin se ha desconectado. Es 21
&21752/3$5(17$/
6LVWHPDGH&ODVLFDFLyQGHOD$VRFLDFLyQ&LQHPDWRJUiFDGHORV(VWDGRV
nidos (MPAA) Catego 3~EOLFRJHQHUDO Gua de los padres 6XJHULGR Para Padres Advertido 5HVWULQJLGR
No se admiten nios PHQRUHVGHDxRV Pelculas hard core 6LQFODVLFDU 6LJQLFDGR El contenido no ofensivo para la mayora de los espectadores. El contenido es tal que los padres no quieren que sus hijos YHDQHOSURJUDPD
(OSURJUDPDHVLQDSURSLDGRSDUDSUHDGROHVFHQWHVFRQ
XQPD\RUJUDGRGHPDWHULDORIHQVLYRVXJHULGRTXHXQ
SURJUDPD3*QRPLQDO
1RUHFRPHQGDGRSDUDQLxRVPHQRUHVGHDxRVWLHQH
contenido alto en sexo y/o violencia. 1RUHFRPHQGDGRSDUDQLxRVPHQRUHVGHDxRVEDMR
QLQJXQDFLUFXQVWDQFLD7LHQHXQDOWRFRQWHQLGRVH[XDO
,JXDOTXHFODVLFDFLyQ1&
03$$QRFODVLFy
No Rating 6LVWHPDVGHFODVLFDFLyQSDWHUQDOHVGH79 P P R NC TV TV Catego Todos los nios
'LULJLGRDDGXOWRV
Nios 6HOHFFLRQDUODRSFLyQGHEORTXHRHQODFRQJXUDFLyQ
de TVDFRQWLQXDFLyQXWLOL]DUORVERWRQHVGHHFKD
para resaltar EE. y pulse el botn OK para entrar. Seleccionar a distancia para entrar aparato de TV SDUHQWDOVLVWHPDGHFODVLFDFLyQGHJXtD
6LJQLFDGR Content not offensive to most viewers.El contenido no ofensivo para la mayora de los espectadores. Considerado apto para nios PD\RUHVGHDxRVSXHGH
contener escenas de violencia de fantasa. Considerado apto para todo S~EOLFRORVQLxRVSXHGHQYHU
sin supervisin. 6XJHULGRLQDGHFXDGRSDUD
QLxRVSHTXHxRVSXHGH
FRQWHQHUOHQJXDMHVXJHUHQWH
OHQJXDMHVRH]VH[R\HVFHQDV
violentas. Inadecuado para nios PHQRUHVGHDxRVSXHGH
FRQWHQHUOHQJXDMHVRH]VH[R
y escenas violentas. 6yORDGXOWRVSXHGHFRQWHQHU
OHQJXDMHIXHUWHOHQJXDMHVRH]
sexo y escenas violentas. TV MA Slo audiencia Gua de los padres 6XJHULGR Para Padres Advertido 3~EOLFRJHQHUDO TV P madura TV TV
El ingls Canadiense es utilizado por toda la habla inglesa de Canad (C, C8+, G, PG, 14+,18+).
El francs canadiense se utiliza en Quebec (G, 8 ans+, 13 ans+, 16 ans+, 18 ans+).
El V-Chip bloquear automticamente ciertas categoras que son "ms restrictivas". Si bloquea la categora TV-Y, se bloquear automticamente TV-Y7. De manera similar, si bloquea la categora TV-G, entonces se bloquearn todas las categoras en el "adulto joven". (TV-G, TV-PG, TV-14, y TV-MA).
TV-NO: El canal no est bloqueado. Es 22 SOL CI N DE PRO LEMAS 6LHOWHOHYLVRUQRIXQFLRQDQRUPDOPHQWHRQRVHSXHGHHQFHQGHUSRUIDYRUUHYLVHODVVLJXLHQWHV
SUHJXQWDVGHVROXFLyQGHSUREOHPDV5HFXHUGHWDPELpQFRPSUREDUFXDOTXLHURWURGLVSRVLWLYRHOHFWUyQLFR
FRQHFWDGRFRPRUHSURGXFWRUGH'9'R%OXUD\SDUDLGHQWLFDUHOSUREOHPD,IWKH79VWLOOIDLOVWRRSHUDWH
QRUPDOO\SOHDVHFRQWDFWWHFKQLFDOVXSSRUW
El televisor no funciona correctamente El televisor no responde cuando se presionan los botones El televisor no se puede encendern alimentacin de la toma de corriente durante unos minutos. Vuelva a conectar el cable de alimentacin e intente hacerlo funcionar de nuevo como siempre. Compruebe que el televisor est conectado a la fuente de alimentacin.
$VHJ~UHVHGHTXHWRGRVORVGLVSRVLWLYRV$9FRQHFWDGRVHVWpQDSDJDGRV
(OWHOHYLVRUVHSXHGHFRQJHODUGXUDQWHVXXVR'HVFRQHFWHHOFDEOHGH
antes de encender el televisor. El control remoto no funciona
&RPSUXHEHVLKD\DOJ~QREMHWRHQWUHHOWHOHYLVRU\HOFRQWUROUHPRWRTXH
SXHGDLQWHUIHULU$VHJ~UHVHGHDSXQWDUHOFRQWUROUHPRWRGLUHFWDPHQWHDO
televisor.
$VHJ~UHVHGHTXHODVSLODVHVWiQLQVWDODGDVHQODSRODULGDGFRUUHFWDWR
WR
Instale pilas nuevas. Compruebe la alimentacin del televisor. La fuente de alimentacin tal vez potencia. fue interrumpida. SUREOHPDVVLQWRQLFHDRWUDHPLVRUD
La emisora o el canal de cable pueden estar experimentando
&RPSUXHEHVLHOWHPSRUL]DGRUHVWiFRQJXUDGR
Compruebe si la opcin En espera automtico est activada. Compruebe si el televisor est encendido. Intente con otro canal. El problema puede ser causado por la emisora.
(VWRHVQRUPDOODLPDJHQHVPXGDGXUDQWHHOSURFHVRGHDUUDQTXHGHO
DSDUDWR&RQWDFWHFRQXQVHUYLFLRWpFQLFRDXWRUL]DGRVLODLPDJHQQRKD
aparecido despus de cinco minutos.
$MXVWHODFRQJXUDFLyQHQHOPHQ~IMA EN. Intente con otro canal. El problema puede ser causado por la emisora. Compruebe que los cables de video estn conectados correctamente. 9HULTXHODLQWHUIHUHQFLDORFDOFRPRDSDUDWRVHOpFWULFRVRKHUUDPLHQWDVGH
La alimentaci n se ha cortado repentinamente La funci n de video no funciona No ha imagen ni sonido La imagen aparece lentamente despu s de encenderlo No ha color o es malo o LPDJHQGHFLHQWH arra horizontal vertical o imagen temblante Mala recepci n en algunos canales L neas o ra as en las No ha fotos al conectar HDMI
/DVLPiJHQHVDSDUHFHQHQ
$MXVWHODFRQJXUDFLyQGHODSURSRUFLyQGHSDQWDOODHQHOPHQ~GH
una equivocada CONFI La funci n de audio no funciona
/DLPDJHQHVWiELHQSHURQR
ha sonido No ha salida de uno de los altavoces Ruidos e tra os que provienen del interior del aparato No ha sonido al conectar HDMI Ruido de audio Presione los botones VOL Se silencia el sonido? Presione el botn M TE6LOHQFLR
Intente con otro canal. El problema puede ser causado por la emisora.
$MXVWHODFRQJXUDFLyQGHOEDODQFHHQHOPHQ~A DIO. AUn cambio en la humedad o temperatura del ambiente pueden producir UXLGRVH[WUDxRVFXDQGRHOWHOHYLVRUHVWiHQFHQGLGRRDSDJDGR\QRLQGLFD
una falla en el televisor. Compruebe si hay posibles fuentes de interferencia. 9HULTXHODDQWHQDFDPELHODSRVLFLyQGHODDQWHQD
/DVHxDOGHODHPLVRUDSXHGHVHUGpELOYXHOYDDFRORFDUODDQWHQDSDUD
Compruebe si la fuente de entrada es HDMI1/HDMI2/HDMI3. Compruebe si la fuente de entrada es HDMI1/HDMI2/HDMI3. RACI N o pulse el botn PANTALLA del 0DQWHQJDHOFDEOHFRD[LDO5)OHMRVGHORVRWURVFDEOHV
mejorar la recepcin. Es 23 SOLUCIN DE PROBLEMAS Contrase a ESTA LECER contrasea en el men LO EO, luego introduzca la siguiente contrasea maestra 8899. La contrasea maestra borra la contrasea anterior y le permite introducir una nueva contrasea. Olvid la contrase a Ha un problema en el modo PC La se al esta fuera de alcance (formato inv lido) Aparecen barras o ra as de fondo el ruido horizontal la posici n incorrecta El color de la pantalla es inestable o muestra un solo color Si falla la cone i n WIFI o APP tiene problema de cone i n, consulte las siguientes preguntas de soluci n de problemas. Compruebe el cable de seal. Vuelva a instalar la tarjeta de video del PC. Ajuste la resolucin, la frecuencia horizontal o la frecuencia vertical. H/V. Comprobar la conexin WIFI, la TV puede estar demasiado lejos del La Cone i n WiFi falla maysculas o minsculas. router WiFi. Compruebe el ajuste "autenticacin". Asegrese de que la contrasea se introduce con letras correctas en Compruebe si la TV est conectado correctamente. Trate de apagar y desenchufar la televisin para restablecer la televisin. Intente reiniciar el router Wi-Fi, y tambin comprobar si hay problemas de interferencia de canal o WIFI. Vudu slo est disponible en los Estados Unidos y Pandora slo est disponible en pases limitados. Los problemas con la transmisi n de v deo cone i n No se puede usar Vudu Pandora MANTENIMIENTO No utilice su televisor en reas que son demasiado calientes o demasiado fras porque el mueble se puede doblar o la pantalla puede funcionar mal. El televisor funciona mejor a temperaturas que son cmodas para usted. Las temperaturas de almacenamiento son de 32F a 122F (0C a 50C). Las temperaturas de funcionamiento son de 32F a 95F (0C a 35C). No exponga el televisor directo al sol o cerca de una fuente de calor.
- 5cm mnimas alrededor del aparato para una ventilacin adecuada;
- La ventilacin no debe impedirse al cubrir las aberturas de ventilacin con objet os como peridicos, manteles, cortinas, etc.;
- no hay fuente de llamas, como una vela encendida, se deben colocar sobre el aparato -;
- debe prestarse atencin a los aspectos ambientales de la eliminacin de la batera. Es 24 ESPECIFICACION Tama o de la pantalla Tipo de pantalla Tecnolog a del panel Panel 60 Hz Vs. 120 Hz Resoluci n de la pantalla Soporte HDMI Resoluci n del panel Proporci n de la pantalla Proporci n de contraste din mico del panel Tiempo de respuesta (G a G) Lamp Life (Typ. Hours) ngulo de visi n horizontal (En CR>10) ngulo de visi n vertical (En CR>10) Montaje en la pared(LxW-mm) 32 pulgadas en diagonal DLED TFT 60 Hz 1366 x 768 1360 x 768 1366 x 768 16:9 1200:1 8 ms 30,000 horas 178 178 200*100 VESA(mm) La FCC quiere que usted sepa Declaraci n de la FCC Este dispositivo cumple con el Apartado 15 de las ormas FCC. Su funcionamiento est sujeto a las dos condiciones siguientes:
1. Este dispositivo no deber causar interferencias perjudiciales, y 2. Deber aceptar cualquier interferencia que reciba, incluyendo interferencias que puedan causar un funcionamiento no deseado. NOTA Este equipo ha sido probado y cumple con los l mites para un dispositivo digital de Clase B, seg n la Parte 15 de las ormas de la FCC. Estosl mites est n dise ados para proporcionar una protecci n razonable contra las interferencias da inas en una instalaci n residencial. Este equipo genera, utiliza y puede irradiar energ a de radiofrecuencia y, si no se instala y utiliza de acuerdo con las instrucciones, puede causar interferencias da inas en las comunicaciones de radio. Sin embargo, no hay garant a de que no se produzcan interferencias en una instalaci n en particular. Si este equipo provoca interferencias da inas a la radio o televisi n, lo cual puede comprobarse encendi ndolo y apag ndolo, se recomienda al usuario que intente corregir la interferencia mediante una o m s de las siguientes medidas:
1. Cambie la orientaci n o ubicaci n de la antena receptora. 2. Aumente la separaci n entre el equipo y el receptor. 3. Conecte el equipo a un tomacorriente en un circuito diferente al que est conectado el receptor. 4. Consulte con el distribuidor o un t cnico con experiencia en radio/TV para obtener ayuda. Declaraci n de e posici n a las radiaciones de la FCC Este equipo cumple con los l mites de exposici n a las radiaciones establecidos por la FCC para entornos no controlados. El equipo deber instalarse y utilizarse con una distancia m nima de 20 cm entre el radiador y su cuerpo. Es 25 SERVICIO DE APP Si usted quiere saber acerca de esta informaci n APP u obtener m s servicio. Por favor, consulte el siguiente contenido. Llame para obtener m s a uda Usted puede navegar a la siguiente pgina web para informacin de contacto alternativo:
ouTube sted puede navegar a la siguiente p gina web para obtener m s a uda https://productforums.google.com/forum/#!categories/youtube/smart-tvs V D sted puede llamar al siguiente tel fono para obtener m s a uda T sted puede llamar al siguiente tel fono para obtener m s a uda Pandora Puede enviar un e mail a Pandora para obtener m s a uda pandora-support@pandora.com AccuWeather ou can send E mail to AccuWeather for more help CustomerService@AccuWeather.com OBTENER SERVICIO DE GARANTA Por favor llame a Westinghouse Electronics al (800) 701-0680 para la ubicacin del centro de servicio de Westinghouse Electronics ms cercano o para obtener servicios a domicilio. Es 26
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2017-09-29 | 2412 ~ 2462 | DTS - Digital Transmission System | Original Equipment |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 | Effective |
2017-09-29
|
||||
1 | Applicant's complete, legal business name |
Chunghsin Technology Group CO.,LTD
|
||||
1 | FCC Registration Number (FRN) |
0024667776
|
||||
1 | Physical Address |
NO.618-2 GONGREN WEST ROAD, JIAOJIANG AREA
|
||||
1 |
NO.618-2 GONGREN WEST ROAD
|
|||||
1 |
TAIZHOU, ZHEJIANG, N/A
|
|||||
1 |
China
|
|||||
app s | TCB Information | |||||
1 | TCB Application Email Address |
t******@siemic.com
|
||||
1 | TCB Scope |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
||||
app s | FCC ID | |||||
1 | Grantee Code |
2AE2W
|
||||
1 | Equipment Product Code |
WD32HBB101
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 | Name |
P****** J****
|
||||
1 | Title |
Manager
|
||||
1 | Telephone Number |
(86) ********
|
||||
1 | Fax Number |
(86) ********
|
||||
1 |
j******@cncoptronics.cn
|
|||||
app s | Technical Contact | |||||
n/a | ||||||
app s | Non Technical Contact | |||||
n/a | ||||||
app s | Confidentiality (long or short term) | |||||
1 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 | Equipment Class | DTS - Digital Transmission System | ||||
1 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | 32inch HD DLED TV | ||||
1 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 | Modular Equipment Type | Does not apply | ||||
1 | Purpose / Application is for | Original Equipment | ||||
1 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | No | ||||
1 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 | Grant Comments | Power listed is the maximum conducted output power. Device contains 20 and 40 MHz signal bandwidth. The antenna(s) used for this transmitter must be installed to provide a separation distance of at least 20 cm from all persons and must not be co-located or operating in conjunction with any other antenna or transmitter, except in accordance with FCC multi- transmitter product procedures. End-Users must be provided with transmitter operation conditions for satisfying RF exposure compliance. | ||||
1 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 | Firm Name |
EST Technology Co.,Ltd
|
||||
1 | Name |
I**** H******
|
||||
1 | Telephone Number |
86-76******** Extension:
|
||||
1 |
j******@163.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 15C | 2412.00000000 | 2462.00000000 | 0.0458000 |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC