Always there to help you Register your product and get support at www.philips.com/welcome Question?
Question?
Contact Contact Philips Philips EN SB365 Register online at www.philips.com/welcome today to get the very most from your purchase. Register online at www.philips.com/welcome to ensure:
EN Short User Manual ES Manual de usuario corto FR Bref mode demploi Congratulations on your purchase, and welcome to the family!
Dear PHILIPS product owner:
P.S. To get the most from your PHILIPS purchase, be sure to register online at:
www.philips.com/welcome This bolt of lightning indicates unin-
sulated material within your unit may cause an electrical shock. For the safety of everyone in your household, please do not remove product covering. The exclamation point calls atten-
tion to features for which you should read the enclosed literature closely to pre-
vent operating and maintenance problems. WARNING: To reduce the risk of fire or electric shock, this apparatus should not be exposed to rain or moisture and objects filled with liquids, such as vases, should not be placed on this apparatus. CAUTION: To prevent electric shock, match wide blade of plug to wide slot, fully insert. ATTENTION: Pour viter les choc lec-
triques, introduire la lame la plus large de la fiche dans la borne correspondante de la prise et pousser jusquau fond. For Customer Use Enter below the Serial No. which is locat-
ed on the rear of the cabinet. Retain this information for future reference. Model No.__________________________ Serial No. ________________________ P&F USA, Inc. PO Box 2248, Alpharetta, GA 30023-2248 P&F USA Inc. PO Box 2248 Alpharetta, GA 30023-2248 Phone 1 866 309 0845 Meet Philips at the Internet http://www.philips.com/welcome 2014 WOOX Innovations Limited. All rights reserved. This product was brought to the market by WOOX
,QQRYDWLRQV/LPLWHGRURQHRILWVDIOLDWHVIXUWKHUUHIHUUHG
WRLQWKLVGRFXPHQWDV:22;,QQRYDWLRQVDQGLVWKH
manufacturer of the product. P&F is the warrantor in relation to the product with which this booklet was packaged. Philips and the Philips Shield Emblem are registered trademarks of Koninklijke Philips N.V. SB365_37_Short User Manual_V1.0 FR
*Avis sur la scurit des prod En enregistrant votre produit, vous serez avis - directement par le fabriquant. rez de tous les privilges auxquels vous avez droit y compris des offres-rabais spciales. Nous vous flicitons de votre achat et vous souhaitons la bienvenue dans la famille !
Cher propritaire dun produit PHILIPS :
de fabrication et de garantie suprieures parmi les meilleurs disponibles sur le march. Et nous ferons tout en notre pouvoir pour que vous soyez pleinement satisfait de votre achat pour des annes venir. En tant que membre de la famille PHILIPS, vous avez droit une protection ingale par lune des garanties les plus compltes de lindustrie. De plus, votre achat garantit que vous recevrez toutes les informations et offres spciales auxquelles vous avez droit, ainsi quun accs facile toute une gamme daccessoires disponibles via notre rseau de tlachat. Mais ce qui est encore plus important, vous pouvez compter sur notre engagement total quand il sagit de votre entire satisfaction. Cest notre faon de vous souhaiter la bienvenue et de vous remercier de votre investissement dans un produit PHILIPS. PHILIPS, assurez-vous de vous enregistrez en ligne www.philips.com/welcome AVIS Ce symbole dclair sapplique aux matriaux non isols prsents dans votre appareil et pouvant causer un choc lectrique. Pour assurer la scurit des membres de votre famille, veuillez ne pas enlever le couvercle de votre produit. Les points dexclamation ont pour but dattirer votre attention sur des carac-
tristiques propos desquelles vous devez lire soigneusement la documentation accompagnant lappareil afin dviter tout problme dexploita-
tion ou dentretien. AVERTISSEMENT : Afin de rduire les risques dincendie ou de choc lectrique, ne pas exposer cet appareil la pluie ou lhumidit et les objets remplis de liquide, comme les vases, ne doivent pas tre placs sur le dessus de lappareil. CAUTION : To prevent electric shock, match wide blade of plug to wide slot, fully insert. ATTENTION : Pour viter les chocs lec-
triques, introduire la lame la plus large de la fiche dans la borne correspondante de la prise et pousser fond. lusage du client Entrez ci-dessous le numro de srie qui se trou-
ve larrire du botier du dispositif. Conservez ces informations pour rfrence ultrieure. No. de modle : ________________________ No. de srie : __________________________ Registrar su producto garantiza que recibir todos los privilegios a los cuales tiene derecho, incluyendo las ofertas especiales para ahorrar dinero. ES
*Seguridad del producto del fabricante). Felicitaciones por su compra y bienvenido a la familia!
productos mejor construidos y con mejor respaldo disponible hoy satisfecho con su compra durante muchos aos. estar protegido con una de las garantas ms completas de la toda la informacin y ofertas especiales a las que tiene derecho, adems de un fcil acceso a los accesorios desde nuestra cmoda red de compra desde el hogar. irrestricto compromiso con su satisfaccin total. Todo esto es nuestra manera de decirle bienvenido y gracias por P AVISO Este relmpago indica material no aisla-
do dentro de la unidad que puede causar una descarga elctrica. Para la seguridad de todos en su hogar, por favor no retire la cubierta del producto. El signo de exclamacin llama la atencin hacia funciones sobre las que debera leer con atencin en la literatura adjunta para evitar problemas operativos y de mantenimiento. ADVERTENCIA Para reducir el riesgo de incendios o de descarga elctrica, este aparato no se debe exponer a la lluvia ni a la humedad, y no se le deben colocar encima objetos llenos de lquido como jarrones. PRECAUCIN: Para evitar descargas elctric-
as, haga que la paleta ancha del enchufe coincida con la ranura ancha e introdzcala hasta el fondo. ATTENTION: Pour viter les chocs lec-
triques, introduire la lame la plus large de la fiche dans la borne correspondante de la prise et pousser jusquau fond. Slo para uso del cliente Escriba a continuacin el N de serie, el cual se ubica en la parte posterior del gabinete. Guarde esta informacin para futura referencia. N de modelo. __________________________ __________________________ N de serie. Important 1 Scurit Avertissement Ne retirez jamais le botier de cette enceinte. Ne graissez jamais aucun composant de cette enceinte. Ne posez jamais cette enceinte sur un autre quipement lectrique.
&RQVHUYH]FHWWHHQFHLQWHjO DEULGHVUD\RQVGXVROHLOGHVDPPHVQXHVHWGHWRXWHVRXUFHGHFKDOHXU
Consignes de scurit importantes a /LVH]DWWHQWLYHPHQWFHVFRQVLJQHV
b &RQVHUYH]VRLJQHXVHPHQWFHVFRQVLJQHV
c 7HQH]FRPSWHGHWRXVOHVDYHUWLVVHPHQWV
d 5HVSHFWH]WRXWHVOHVFRQVLJQHV
e 1XWLOLVH]SDVFHWDSSDUHLOjSUR[LPLWpGXQHVRXUFHGHDX
f 1HWWR\H]ODSSDUHLODYHFXQFKLIIRQVHFXQLTXHPHQW
g 1REVWUXH]SDVOHVRULFHVGHYHQWLODWLRQ,QVWDOOH]ODSSDUHLOFRQIRUPpPHQWDX[
consignes du fabricant. h 1LQVWDOOH]SDVODSSDUHLOjSUR[LPLWpGHVRXUFHVGHFKDOHXUWHOOHVTXHGHVUDGLDWHXUV
UHJLVWUHVGHFKDOHXUSRrOHVRXDXWUHVDSSDUHLOV DPSOLFDWHXUVSDUH[HPSOH
produisant de la chaleur. i eYLWH]GHPDUFKHUVXUOHFRUGRQGDOLPHQWDWLRQRXGHOHSLQFHUQRWDPPHQWDXQLYHDX
GHVFKHVGHVSULVHVGHFRXUDQWHWGHVRQSRLQWGHVRUWLHVXUODSSDUHLO
j 8WLOLVH]XQLTXHPHQWOHVSLqFHVGH[DWLRQDFFHVVRLUHVVSpFLp H VSDUOHIDEULFDQW
k 'pEUDQFKH]FHWDSSDUHLOHQFDVGRUDJHRXSHQGDQWOHVORQJXHVSpULRGHV
dinutilisation. l &RQH]WRXWHVOHVWkFKHVGHPDLQWHQDQFHjXQSHUVRQQHOTXDOLp'HVWUDYDX[GH
PDLQWHQDQFHVRQWQpFHVVDLUHVHQFDVGHQGRPPDJHPHQWGHODSSDUHLO SDUH[HPSOH
GpYHUVHPHQWGHOLTXLGHRXFKXWHGREMHWVjOLQWpULHXUGHODSSDUHLOH[SRVLWLRQGH
ODSSDUHLOjODSOXLHRXjOKXPLGLWpG\VIRQFWLRQQHPHQWRXFKXWHGHODSSDUHLO
Important 1 Safety Warning Never remove the casing of this speaker. Never lubricate any part of this speaker. Never place this speaker on other electrical equipment. HHSWKLVVSHDNHUDZD\IURPGLUHFWVXQOLJKWQDNHGDPHVRUKHDW
Important safety instructions a Read these instructions. b Keep these instructions. c Heed all warnings. d Follow all instructions. e Do not use this apparatus near water. f Clean only with dry cloth. g Do not block any ventilation openings. Install in accordance with the manufacturers instructions. h 'RQRWLQVWDOOQHDUDQ\KHDWVRXUFHVVXFKDVUDGLDWRUVKHDWUHJLVWHUVVWRYHVRURWKHU
DSSDUDWXV LQFOXGLQJDPSOLHUV WKDWSURGXFHKHDW
i 3URWHFWWKHSRZHUFRUGIURPEHLQJZDONHGRQRUSLQFKHGSDUWLFXODUO\DWSOXJV
FRQYHQLHQFHUHFHSWDFOHVDQGWKHSRLQWZKHUHWKH\H[LWIURPWKHDSSDUDWXV
j 2QO\XVHDWWDFKPHQWVDFFHVVRULHVVSHFLHGE\WKHPDQXIDFWXUHU
k Unplug this apparatus during lightning storms or when unused for long periods of time. l 5HIHUDOOVHUYLFLQJWRTXDOLHGVHUYLFHSHUVRQQHO6HUYLFLQJLVUHTXLUHGZKHQWKH
DSSDUDWXVKDVEHHQGDPDJHGLQDQ\ZD\VXFKDVOLTXLGKDVEHHQVSLOOHGRUREMHFWVKDYH
IDOOHQLQWRWKHDSSDUDWXVWKHDSSDUDWXVKDVEHHQH[SRVHGWRUDLQRUPRLVWXUHGRHV
QRWRSHUDWHQRUPDOO\RUKDVEHHQGURSSHG
Importante 1 Seguridad Advertencia Nunca retire la carcasa del altavoz. No lubrique ninguna pieza del altavoz. No coloque nunca el altavoz sobre otro equipo elctrico. No exponga el altavoz a la luz solar directa, al calor o a las llamas. Instrucciones de seguridad importantes a Lea estas instrucciones. b Guarde estas instrucciones. c Preste atencin a todas las advertencias. d Siga todas las instrucciones. e No use este aparato cerca del agua. f 8WLOLFH~QLFDPHQWHXQSDxRVHFRSDUDODOLPSLH]D
g No bloquee las aberturas de ventilacin. Realice la instalacin de acuerdo con las indicaciones del fabricante. h 1RLQVWDOHFHUFDQLQJXQDIXHQWHGHFDORUFRPRSRUHMHPSORUDGLDGRUHVUHMLOODV
GHFDOHIDFFLyQKRUQRVXRWURVDSDUDWRVTXHSURGX]FDQFDORU LQFOXLGRVORV
DPSOLFDGRUHV
i (YLWHTXHHOFDEOHGHDOLPHQWDFLyQVHSLVHRVHGREOHHQSDUWLFXODUMXQWRDORV
HQFKXIHVWRPDVGHFRUULHQWH\HQHOSXQWRGRQGHVDOHGHODSDUDWR
j 8VHH[FOXVLYDPHQWHORVGLVSRVLWLYRVDFFHVRULRVLQGLFDGRVSRUHOIDEULFDQWH
k Desenchufe el aparato durante las tormentas elctricas o cuando no lo utilice durante un periodo largo de tiempo. l (OVHUYLFLRWpFQLFRGHEHUHDOL]DUORVLHPSUHSHUVRQDOFXDOLFDGR6HUHTXHULUiVHUYLFLR
GHDVLVWHQFLDWpFQLFDFXDQGRHODSDUDWRVXIUDDOJ~QWLSRGHGDxRFRPRSRUHMHPSOR
TXHVHKD\DGHUUDPDGROtTXLGRRKD\DQFDtGRREMHWRVGHQWURGHODSDUDWRTXHpVWH
VHKD\DH[SXHVWRDODOOXYLDRKXPHGDGTXHQRIXQFLRQHQRUPDOPHQWHRTXHVHKD\D
cado. m Utilisation des piles ATTENTION Pour viter les fuites de piles pouvant endommager lappareil ou entraner des blessures corporelles ou des dgts PDWpULHOVUHVSHFWH]OHVFRQVLJQHVVXLYDQWHV
Installez correctement toutes les piles, en prenant garde aux sens + et - indiqus sur lappareil.
Ne mlangez pas les piles (neuves et anciennes, au carbone et alcalines, etc.).
Retirez les piles du compartiment si vous nutilisez pas lappareil pendant une longue priode. n /HVSLOHVQHGRLYHQWSDVrWUHH[SRVpHVjXQHFKDOHXUH[FHVVLYH OXPLqUHGXVROHLOIHX
RXVRXUFHDVVLPLOpH
o 9RWUHDSSDUHLOQHGRLWSDVrWUHH[SRVpDX[IXLWHVJRXWWHjJRXWWHRXDX[
claboussures. p 1HSODFH]SDVGREMHWVVXVFHSWLEOHVGHQGRPPDJHUYRWUHDSSDUHLOjSUR[LPLWpGH
FHOXLFL SDUH[HPSOHREMHWVUHPSOLVGHOLTXLGHRXERXJLHVDOOXPpHV
q 6LODFKHGHODGDSWDWHXUSOXJLQ'LUHFWHVWXWLOLVpHFRPPHGLVSRVLWLIGHGpFRXSODJH
elle doit rester facilement accessible. Remarque La plaque signaltique est situe sous l'appareil. 2 Avertissement 7RXWHPRGLFDWLRQDSSRUWpHjFHWDSSDUHLOTXLQHVHUDLWSDVDSSURXYpHH[SUHVVpPHQWSDU:22;
,QQRYDWLRQVSHXWLQYDOLGHUOKDELOLWDWLRQGHOXWLOLVDWHXUjXWLOLVHUODSSDUHLO
Remarque pour les tats-Unis et le Canada
&HWDSSDUHLOHVWFRQIRUPHjODVHFWLRQGHODUpJOHPHQWDWLRQ)&&HWjODQRUPH566H[HPSWHGH
licence du Canada. Lexploitation est autorise aux deux conditions suivantes :
1 2 cet appareil ne doit pas provoquer dinterfrences nuisibles ;
cet appareil doit tre capable de supporter diffrentes interfrences, y compris les interfrences susceptibles de provoquer un dysfonctionnement.
OLVVXHGHVWHVWVGRQWLODIDLWOREMHWFHWpTXLSHPHQWDpWpGpFODUpFRQIRUPHjODVHFWLRQ
GHODUpJOHPHQWDWLRQ)&&DSSOLFDEOHDX[DSSDUHLOVQXPpULTXHVGHFODVVH%Ces limites sont FRQoXHVSRXUIRXUQLUXQHSURWHFWLRQVXIVDQWHFRQWUHOHVLQWHUIpUHQFHVQXLVLEOHVGDQVOHVLQVWDOODWLRQV
rsidentielles. Cet quipement gnre, utilise et peut mettre des ondes radiolectriques. Il est susceptible de crer des interfrences nuisibles dans les communications radiolectriques sil nest pas install ou utilis conformment au mode demploi. Cependant, labsence dinterfrences dans une installation particulire nest pas garantie. Dans le cas o cet quipement crerait des interfrences avec la rception radio ou tlvise, ce qui peut tre m Battery usage CAUTION To prevent battery leakage which may result in bodily Install all batteries correctly, + and - as marked on the unit. LQMXU\SURSHUW\GDPDJHRUGDPDJHWRWKHXQLW
Do not mix batteries (old and new or carbon and alkaline, etc.).
Remove batteries when the unit is not used for a long time. n %DWWHU\VKDOOQRWEHH[SRVHGWRH[FHVVLYHKHDWVXFKDVVXQVKLQHUHRUWKHOLNH
o $SSDUDWXVVKDOOQRWEHH[SRVHGWRGULSSLQJRUVSODVKLQJ
p 'RQRWSODFHDQ\VRXUFHVRIGDQJHURQWKHDSSDUDWXV HJOLTXLGOOHGREMHFWVOLJKWHG
FDQGOHV
q :KHUHWKHSOXJRIWKH'LUHFW3OXJLQ$GDSWHULVXVHGDVWKHGLVFRQQHFWGHYLFHWKH
disconnect device shall remain readily operable. Note The type plate is located on the bottom of the apparatus. 2 Notice
$Q\FKDQJHVRUPRGLFDWLRQVPDGHWRWKLVGHYLFHWKDWDUHQRWH[SUHVVO\DSSURYHGE\:22;
Innovations may void the users authority to operate the equipment. Notice for the USA and Canada This device complies with Part 15 of the FCC Rules and license-exempt RSS standard of Industry Canada. Operation is subject to the following two conditions:
1 2 this device may not cause harmful interference, and this device must accept any interference received, including interference that may cause undesired operation. 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKHOLPLWVIRUD&ODVV%GLJLWDOGHYLFH
pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instruction manual, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:
Relocate the receiving antenna. Increase the separation between equipment and receiver.
Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. Consult the dealer or an experienced radio/TV technician for help.
5)5DGLDWLRQ([SRVXUH6WDWHPHQW This equipment complies with FCCs and ICs RF radiation exposure limits set forth for an uncontrolled environment. The antenna(s) used for this transmitter must be installed and operated to provide a separation distance of at least 20 cm from all persons and must not be collocated or operating in conjunction with any other antenna or transmitter. Installers must ensure that 20cm separation distance will be maintained between the device
(excluding its handset) and users.
&$1,&(6 % 10% %
Disposal of your old product and batteries Your product is designed and manufactured with high quality materials and components, which can be recycled and reused. Never dispose of your product with other household waste. Please inform yourself about the local rules on the separate collection of electrical and electronic products and batteries. The correct disposal of these products helps prevent potentially negative consequences on the environment and human health. Your product contains batteries, which cannot be disposed of with normal household waste. Please inform yourself about the local rules on separate collection of batteries. The correct disposal of batteries helps prevent potentially negative consequences on the environment and human health. Please visit www.recycle.philips.com for additional information on a recycling center in your area. Environmental information
$OOXQQHFHVVDU\SDFNDJLQJKDVEHHQRPLWWHG:HKDYHWULHGWRPDNHWKHSDFNDJLQJHDV\WRVHSDUDWH
into three materials: cardboard (box), polystyrene foam (buffer) and polyethylene (bags, protective foam sheet.) Your system consists of materials which can be recycled and reused if disassembled by a specialized company. Please observe the local regulations regarding the disposal of packaging materials, exhausted batteries and old equipment. The Bluetooth word mark and logos are registered trademarks owned by Bluetooth SIG, Inc. and DQ\XVHRIVXFKPDUNVE\:22;,QQRYDWLRQVLVXQGHUOLFHQVH
The N Mark is a trademark or registered trademark of NFC Forum, Inc. in the United States and in other countries.
Aumente la separacin entre el aparato y el receptor.
&RQHFWDUHOHTXLSRDXQDWRPDGHFRUULHQWHGHXQFLUFXLWRGLVWLQWRDOTXHHVWiFRQHFWDGRHOUHFHSWRU
Para obtener ayuda, pngase en contacto con el distribuidor o con un tcnico de radio o televisin con experiencia.
'HFODUDFLyQVREUHODH[SRVLFLyQDODVUDGLDFLRQHVGHUDGLRIUHFXHQFLD Este equipo cumple con los lmites de exposicin a las radiaciones de radiofrecuencia que establece la FCC e IC para proteger el medio ambiente. Las antenas utilizadas para este transmisor deben instalarse y ponerse en funcionamiento para proporcionar una distancia mnima de 20 cm de separacin de todas las personas y no deben colocarse ni funcionar junto con cualquier otra antena o transmisor. Los instaladores deben asegurarse de que se mantiene una distancia de 20 cm de separacin entre el dispositivo (excluido el microtelfono) y los usuarios.
&$1,&(6 % 10% %
Cmo deshacerse del producto antiguo y de las pilas El producto ha sido diseado y fabricado con materiales y componentes de alta calidad que pueden reciclarse y reutilizarse. Nunca se deshaga del producto con el resto de la basura domstica. Infrmese de la legislacin local sobre la recogida selectiva de pilas y productos elctricos y electrnicos. La eliminacin correcta de estos productos ayuda a evitar consecuencias potencialmente negativas para el medio ambiente y la salud humana. Este producto contiene pilas que no se pueden desechar con la basura normal del hogar. Infrmese de la legislacin local sobre la recogida selectiva de bateras. La eliminacin correcta de las bateras ayuda a evitar consecuencias potencialmente negativas para el medio ambiente y la salud humana. Visite www.recycle.philips.comSDUDREWHQHUPiVLQIRUPDFLyQVREUHXQFHQWURGHUHFLFODMHGHVX]RQD
Informacin medioambiental 6HKDVXSULPLGRHOHPEDODMHLQQHFHVDULR+HPRVLQWHQWDGRTXHHOHPEDODMHVHDIiFLOGHVHSDUDU
HQWUHVPDWHULDOHV FDUWyQ FDMD HVSXPDGHSROLHVWLUHQR FRUFKR \SROLHWLOHQR EROVDVOiPLQDGH
espuma protectora). El sistema se compone de materiales que se pueden reciclar y volver a utilizar si lo desmonta una empresa especializada. Siga la normativa local acerca del desecho de materiales de embalaje, pilas agotadas y equipos antiguos. Unidos y otros pases. La marca nominativa Bluetooth y los logotipos son marcas comerciales registradas propiedad de
%OXHWRRWK6,*,QF:22;,QQRYDWLRQVXWLOL]DVLHPSUHHVWDVPDUFDVFRQOLFHQFLD
La marca N es una marca comercial o marca comercial registrada de NFC Forum, Inc. en los Estados La marque N est une marque commerciale ou une marque dpose de NFC Forum, Inc. aux tats-
Unis et dans dautres pays. m ATENCIN con el uso de las pilas. Para evitar fugas de las pilas que puedan causar OHVLRQHVFRUSRUDOHVGDxRVHQODSURSLHGDGRDODXQLGDG
Instale todas las pilas correctamente, siguiendo las indicaciones de los polos + y - de la unidad. No mezcle pilas (antiguas y nuevas, o de carbn y alcalinas, etc.).
Quite las pilas cuando no use la unidad durante un periodo largo de tiempo. n 1RH[SRQJDODVSLODVDWHPSHUDWXUDVDOWDVFRPRODVTXHHPLWHQODOX]VRODUHOIXHJR
o similares. o 1RH[SRQJDHODSDUDWRDJRWHRVQLVDOSLFDGXUDV
p 1RFRORTXHVREUHHODSDUDWRREMHWRVTXHSXHGDQVXSRQHUXQSHOLJUR SRUHMHPSOR
REMHWRVTXHFRQWHQJDQOtTXLGRRYHODVHQFHQGLGDV
q CXDQGRVHXWLOL]DHOHQFKXIHGHODGDSWDGRU'LUHFW3OXJLQ$GDSWHUFRPRGLVSRVLWLYR
GHGHVFRQH[LyQpVWHGHEe estar siempre disponible. Nota
/DSODFDGHLGHQWLFDFLyQHVWiVLWXDGDHQODSDUWHLQIHULRUGHOGLVSRVLWLYR
2 Aviso
&XDOTXLHUFDPELRRPRGLFDFLyQTXHVHUHDOLFHHQHVWHGLVSRVLWLYRTXHQRHVWpDSUREDGD
H[SUHVDPHQWHSRU:22;,QQRYDWLRQVSXHGHDQXODUODDXWRULGDGGHOXVXDULRSDUDXWLOL]DUHOHTXLSR
1RWDSDUD((88\&DQDGi
(VWHGLVSRVLWLYRFXPSOHOD3DUWHGHOUHJODPHQWRGHOD)&&\HOHVWiQGDU566H[HQWRGHOLFHQFLD
GH,QGXVWU\&DQDGD(OIXQFLRQDPLHQWRHVWiVXMHWRDGRVFRQGLFLRQHV
1 este dispositivo no puede causar interferencias dainas y 2 este dispositivo debe aceptar cualquier interferencia que reciba, incluyendo aquellas que puedan causar un funcionamiento no deseado. Este equipo ha sido probado y cumple los lmites establecidos para los dispositivos digitales GHFODVH%GHDFXHUGRFRQODVHFFLyQGHOUHJODPHQWR)&&Estos lmites se han establecido para proporcionar una proteccin razonable contra las interferencias perjudiciales en instalaciones particulares. Este aparato genera, utiliza y puede emitir energa de frecuencias de radio y, si no se instala y utiliza segn el manual de instrucciones, puede provocar interferencias perjudiciales en las comunicaciones de radio. No obstante, no hay garantas de que no se produzcan interferencias en una instalacin particular. Si el equipo causa interferencias perjudiciales en la recepcin de radio o televisin, que se puedan percibir encendiendo y apagando el equipo, se recomienda al usuario que intente corregirlas WRPDQGRXQDRPiVGHODVVLJXLHQWHVPHGLGDV
Cambie la posicin de la antena receptora. YpULpHQpWHLJQDQWHWHQUDOOXPDQWODSSDUHLOLOHVWFRQVHLOOpGHVVD\HUGHFRUULJHUFHVLQWHUIpUHQFHV
en appliquant une ou plusieurs des mesures suivantes :
dplacer lantenne de rception ;
augmenter la distance entre lquipement et le rcepteur ;
UDFFRUGHUOpTXLSHPHQWjXQHSULVHGHFRXUDQWVLWXpHVXUXQFLUFXLWGLIIpUHQWGHFHOXLVXUOHTXHO
le rcepteur est connect ;
SUHQGUHFRQVHLODXSUqVGXQGLVWULEXWHXURXGXQWHFKQLFLHQUDGLR79TXDOLp
'pFODUDWLRQUHODWLYHjOH[SRVLWLRQDXUD\RQQHPHQW5) cet appareil est conforme aux limites dexposition au rayonnement RF stipules par la FCC et lIC pour une utilisation dans un environnement non contrl. Les antennes utilises pour cet metteur doivent tre installes et GRLYHQWIRQFWLRQQHUjDXPRLQVFPGHGLVWDQFHGHVXWLOLVDWHXUVHWQHGRLYHQWSDVrWUHSODFpHV
prs dautres antennes ou metteurs ou fonctionner avec ceux-ci. Les installateurs doivent sassurer TXXQHGLVWDQFHGHFPVpSDUHODSSDUHLO jOH[FHSWLRQGXFRPELQp GHVXWLOLVDWHXUV
&$1,&(6 % 10% %
Mise au rebut de votre ancien produit et des piles Votre produit a t conu et fabriqu avec des matriaux et des composants de haute qualit pouvant tre recycls et rutiliss. Ne jetez pas ce produit avec les ordures mnagres. Renseignez-vous sur les rglementations locales concernant la collecte des produits lectriques et lectroniques et des piles. La mise au rebut citoyenne de ces produits permet de protger lenvironnement et la sant. Votre produit contient des piles qui ne doivent pas tre jetes avec les ordures mnagres. Renseignez-vous sur les rglementations locales concernant la collecte des piles. La mise au rebut citoyenne des piles permet de protger lenvironnement et la sant. Visitez www.recycle.philips.com pour plus dinformations sur les centres de recyclage dans votre rgion. Informations sur lenvironnement 7RXWHPEDOODJHVXSHUXDpWpVXSSULPp1RXVDYRQVIDLWQRWUHSRVVLEOHSRXUSHUPHWWUHXQH
sparation facile de lemballage en trois matriaux : carton (bote), polystyrne mouss (qui amortit les chocs) et polythylne (sacs, feuille protectrice en mousse). 9RWUHDSSDUHLOVHFRPSRVHGHPDWpULDX[UHF\FODEOHVHWUpXWLOLVDEOHVjFRQGLWLRQGrWUHGpPRQWpV
par une entreprise spcialise. Respectez les rglementations locales pour vous dbarrasser des emballages, des piles usages et de votre ancien quipement. Les logos et la marque Bluetooth sont des marques dposes de Bluetooth SIG, Inc. ; toutes les XWLOLVDWLRQVGHFHVPDUTXHVSDU:22;,QQRYDWLRQVVRQWUpJLHVSDUGHVDFFRUGVGHOLFHQFH
SB365_37_SUM_V1.0.indd 1 1/20/2014 3:46:51 PM PDF www.philips.com/support. Always there to help you Register your product and get support at www.philips.com/welcome Question?
Contact Philips User Manual EN To download the full user manual, visit www.philips.com/support. ES Para descargar el manual de usuario completo, visite www.philips.com/support. FR Pour tlcharger le manuel dutilisation complet, rendez-vous sur www.philips.com/
support. Always there to help you Register your product and get support at www.philips.com/welcome Question?
Contact Philips Short User Manual EN Before using your product, read all the safety information. ES Antes de utilizar el producto, lea toda la informacin de seguridad que se adjunta. FR Avant dutiliser le produit, lisez lensemble des informations sur la scurit qui laccompagnent. A B Philips SB365 NFC DC IN 4 x AA EN Either AC power or battery can be used as power supply of this product. ES Se puede utilizar alimentacin de CA o pilas como fuente de alimentacin de este producto. FR Ce produit peut tre aliment par secteur ou par piles. EN Connect Connect a device manually 1 Press on the speaker. 2 On your Bluetooth device, enable Bluetooth and search for Bluetooth devices (refer to the 3 :KHQ[SB365] is displayed on your device, select it to start pairing and connection. If The Bluetooth indicator user manual of the device).
EHJLQVWRDVK
necessary, enter default password 0000. After successful pairing and connection, the speaker beeps twice, and the Bluetooth indicator turns solid blue. details). on the speaker. Connect a device through NFC 1 Press 2 Enable the NFC feature on your Bluetooth device (see the user manual of the device for 3 Touch the NFC tag on the speaker with the back of your Bluetooth device. 4 On your Bluetooth device, accept the pairing request with SB365. If necessary, input 5 1RWH
0000 as the pairing password. Follow the on-screen instructions to complete the pairing and connection. The speaker can memorize a maximum of 4 paired devices. Keep away from any other electronic device that may cause interference.. EN Play After successful Bluetooth connection, play audio on the Bluetooth device. ES Reproduccin Cuando la conexin Bluetooth se realice correctamente, reproduzca audio en el dispositivo Bluetooth. FR Lecture Une fois la connexion Bluetooth tablie, lancez la lecture audio sur le priphrique Bluetooth. ES Conectar
&RQH[LyQPDQXDODXQGLVSRVLWLYR 1 Pulse en el altavoz. El indicador de Bluetooth empieza a parpadear. 2 En el dispositivo, active la funcin Bluetooth y busque dispositivos Bluetooth. 3 Seleccione [SB365] en el dispositivo para iniciar el emparejamiento y la conexin. Si es necesario, introduzca la contrasea predeterminada 0000. Despus de que el emparejamiento y la conexin se realicen correctamente, el altavoz emite dos pitidos y el indicador de Bluetooth se ilumina en azul de forma permanente. FR
&RQQH[LRn
&RQQH[LRQPDQXHOOHGXQSpULSKpULTXH 1 Appuyez sur le bouton sur lenceinte. Le voyant Bluetooth
FRPPHQFHjFOLJQRWHU
2 Sur votre appareil, activez Bluetooth et lancez une recherche de priphriques Bluetooth. 3 Slectionnez [SB365] sur votre appareil pour dmarrer lappairage et tablir la connexion. Si ncessaire, saisissez le mot de passe par dfaut 0000 . Une fois le couplage et la connexion termins, lenceinte met deux signaux sonores et le voyant Bluetooth reste allum en bleu. Bluetooth. en el altavoz.
&RQH[LyQGHXQGLVSRVLWLYRDWUDYpVGH1)&
1 Pulse 2 Active la funcin NFC en el dispositivo Bluetooth. 3 Toque la etiqueta NFC en la parte superior del altavoz con la parte posterior del dispositivo 4 En el dispositivo Bluetooth, acepte la solicitud de emparejamiento con el SB365. Si es 5 Siga las instrucciones en pantalla para completar el emparejamiento y la conexin. 1RWD
(ODOWDYR]SXHGHPHPRUL]DUXQPi[LPRGHGLVSRVLWLYRVHPSDUHMDGRV
Mantenga el sistema alejado de cualquier otro dispositivo electrnico que pueda causar interferencias. necesario, introduzca 0000 como contrasea de emparejamiento. sur lenceinte. priphrique Bluetooth.
&RQQH[LRQGXQSpULSKpULTXHSDU1)&
1 Appuyez sur le bouton 2 Activez la fonctionnalit NFC sur votre priphrique compatible Bluetooth. 3 Touchez ltiquette NFC situe sur la partie suprieure de lenceinte avec larrire de votre 4 Sur votre priphrique Bluetooth, acceptez la demande dappairage avec SB365 . Si 5 6XLYH]OHVLQVWUXFWLRQVjOpFUDQSRXUWHUPLQHUOHFRXSODJHHWpWDEOLUODFRQQH[LRQ
5HPDUTXH
/HQFHLQWHSHXWPpPRULVHUMXVTXjDSSDUHLOVFRXSOpV
7HQH]OHV\VWqPHjGLVWDQFHGHWRXWDXWUHGLVSRVLWLIpOHFWURQLTXHVXVFHSWLEOHGHSURYRTXHUGHV
interfrences. ncessaire, saisissez 0000 comme mot de passe de couplage. CHARGING EN Charge your mobile devices with a USB cable (not supplied). ES Cargue sus dispositivos mviles mediante un cable USB (no suministrado). FR 5HFKDUJH]YRVDSSDUHLOVPRELOHVjODLGHGXQFkEOH86% QRQIRXUQL
EN 6SHFLFDWLRQV
$PSOLHU Rated Output Power Signal to Noise Ratio
$8;,QSXW Bluetooth Bluetooth version 6XSSRUWHGSUROHV Range General information Power Supply
- AC Power (power adapter)
;:506
> 65 dBA 600 mV V4.0 A2DP, AVRCP 10 m (Free space) Brand name: PHILIPS;
Model: OH-1015A0901660U1-UL;
Input: 100-240 V~, 50/60 Hz, 350 mA
- Battery Charging Voltage and Current Operation Power Consumption Standby Power Consumption
'LPHQVLRQV0DLQ8QLW :[+['
:HLJKW0DLQ8QLW Output: 9 V 4 x 1.5 V LR6 AA 1.66 A;
1 A 5 V
:
:
201 x 101 x 35 mm 0.5 kg ES (VSHFLFDFLRQHV
(VSHFLFDFLRQHV
$PSOLFDGRU Potencia de salida Relacin seal/ruido
(QWUDGD$8;
Bluetooth Versin de Bluetooth 3HUOHVFRPSDWLEOHV Alcance Informacin general Fuente de alimentacin
- Alimentacin de CA (adaptador de alimentacin)
[:506
> 65 dBA 600 mV V4.0 A2DP, AVRCP 10 m (espacio libre) Nombre de la marca: PHILIPS;
Modelo: OH-1015A0901660U1-UL;
Entrada: 100-240 V~, 50/60 Hz, 350 mA
- Pilas Voltaje y corriente de carga Consumo de energa en funcionamiento Consumo en modo de espera Dimensiones: unidad principal
(ancho x alto x profundo) Peso: unidad principal Salida: 9 V 4 LR6 AA de 1,5 V 1,66 A;
1 A 5 V
:
:
201 x 101 x 35 mm 0,5 kg FR Caractristiques techniques
$PSOLFDWHXU Puissance de sortie nominale Rapport signal/bruit
(QWUpH$8;
;:506
> 65 dBA 600 mV Bluetooth Version Bluetooth 3UROVSULVHQFKDUJH Porte Informations gnrales V4.0 A2DP, AVRCP 10 m (sans obstacle) Alimentation
- Alimentation secteur (adaptateur secteur) Marque : PHILIPS ;
- Piles Tension et courant de charge Consommation lectrique en mode de fonctionnement Consommation lectrique en mode veille Dimensions - Unit principale
(l x H x P) Poids - Unit principale Modle : OH-1015A0901660U1-UL;
Entre : 100-240 V~ 50/60 Hz, 350 mA;
Sortie : 9 V 4 piles AA LR6 1,5 V 1,66 A ;
1 A 5 V
:
:
201 x 101 x 35 mm 0,5 kg SB365_37_SUM_V1.0.indd 2 1/20/2014 3:46:55 PM