all | frequencies |
|
exhibits | applications |
---|---|---|---|---|
manual |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 3 |
|
Manual | Users Manual | 1.02 MiB | ||||
1 2 3 | Cover Letter(s) | |||||||
1 2 3 | Cover Letter(s) | |||||||
1 2 3 | Test Report | |||||||
1 2 3 | RF Exposure Info | |||||||
1 2 3 | Cover Letter(s) | March 09 2003 | ||||||
1 2 3 | Cover Letter(s) | March 09 2003 | ||||||
1 2 3 | Test Report | March 09 2003 | ||||||
1 2 3 | Test Report | March 09 2003 | ||||||
1 2 3 | Attestation Statements | |||||||
1 2 3 | External Photos | |||||||
1 2 3 | ID Label/Location Info | |||||||
1 2 3 | Internal Photos | |||||||
1 2 3 | Cover Letter(s) |
1 2 3 | Manual | Users Manual | 1.02 MiB |
Nokia 2220 User Guide What information is needed?
My number Voice mail number Wireless providers number Providers customer care Model number 2220 Phone type Electronic serial number
(ESN) Numbers Where is the number?
Wireless service provider Wireless service provider Wireless service provider Wireless service provider Label on back of phone
(under battery) Label on back of phone
(under battery) Label on back of phone
(under battery). See Find phone information on page 8. The wireless phone described in this guide is approved for use in TDMA and AMPS networks. LEGAL INFORMATION Part No. 9310029, Issue No. 2a Copyright 2003 Nokia. All rights reserved. Nokia, Nokia Connecting People, Nokia 2220, and the Nokia Original Accessories logos, Xpress-on, and Space Impact are trademarks or registered trademarks of Nokia Corporation. All other product and company names mentioned herein may be trademarks or tradenames of their respective owners. Printed in Canada 07/2003 US Patent No 5818437 and other pending patents. T9 text input software Copyright 1999-2003. Tegic Communications, Inc. All rights reserved. Includes RSA BSAFE cryptographic or security protocol software from RSA Security. The information in this user guide was written for the Nokia 2220 phone. Nokia operates a policy of continuous development. Nokia reserves the right to make changes and improvements to any of the products described in this document without prior notice. UNDER NO CIRCUMSTANCES SHALL NOKIA BE RESPONSIBLE FOR ANY LOSS OF DATA OR INCOME OR ANY SPECIAL, INCIDENTAL, AND CONSEQUENTIAL OR INDIRECT DAMAGES HOWSOEVER CAUSED. THE CONTENTS OF THIS DOCUMENT ARE PROVIDED AS IS. EXCEPT AS REQUIRED BY APPLICABLE LAW, NO WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE MADE IN RELATION TO THE ACCURACY AND RELIABILITY OR CONTENTS OF THIS DOCUMENT. NOKIA RESERVES THE RIGHT TO REVISE THIS DOCUMENT OR WITHDRAW IT AT ANY TIME WITHOUT PRIOR NOTICE. EXPORT CONTROLS This product contains commodities, technology or software exported from the United States in accordance with the Export Administration regulations. Diversion contrary to U.S. or Canadian law is prohibited. FCC/INDUSTRY CANADA NOTICE Your phone may cause TV or radio interference (for example, when using a telephone in close proximity to receiving equipment). The FCC or Industry Canada can require you to stop using your telephone if such interference cannot be eliminated. If you require assistance, contact your local service facility. This device complies with part 15 of the FCC rules. Operation is subject to the condition that this device does not cause harmful interference. Nokia 2220 phone at a glance Power key Display screen Scroll up key Left selection key Talk key Scroll down key Star key Earpiece Right selection key End key Number keys Pound key Connection port Microphone Nokia 2220 User Guide
Copyright Nokia 2003
QUICK GUIDE Action Make a call Answer a call Description Enter a phone number, and press the Talk key. Press the Talk key, or select Answer. Answer call during call Press the Talk key. End a call Decline a call Mute a call Redial Press the End key. Press the End key to send the call to voice mail. Select Options > Mute during a call. Press the Talk key twice. Adjust call volume During a call, press the Scroll up key to increase volume or the Scroll down key to decrease volume. Use in-call menu Select Options during a call. Save name and number Enter a number, select Save, enter a name, and select OK. Use 1-touch dialing Press and hold a key (29). You must assign a key to a number in contacts. Look up a name Select Contacts > Find. Check voice mail Press and hold the 1 key (contact your service provider for details). Write text messages Select Menu > Messages > Write Message. Write the message. Send text messages Read new message Reply to a message From the message entry screen, select Options > Send. Enter the recipients number and select Send. Note: Message service is dependent on the service provider. If Message received appears on the display, select Read, highlight the message, then select Read again. While reading a message, select Options > Reply. Select either As message or As e-mail. Write a reply, and select Options > Send. Press Press a key briefly and release it. Press and hold Press a key, hold it for two to three seconds, and release it. Copyright Nokia 2003 Contents Quick guide . iv 1 For your safety . 1 2 About your phone . 3 Wireless network services . 3 Register your phone . 3 Updates . 3 Terms . 3 Icons . 4 Start screen . 5 Scroll bar . 5 Antenna . 5 Battery . 5 Headset . 8 Get help . 8 3 Basic operations . 10 Switch your phone on or off . 10 Make and answer calls . 10 Lock the keypad . 11 Select silent profile . 11 In-phone help . 11 Menus . 12 4 Text entry . 13 Standard mode . 13 Predictive text input . 14 Punctuation and special characters . 15 5 Contact list . 16 Contact list options . 16 Save names, numbers, and e-mail addresses . 16 Nokia 2220 User Guide
Y Copyright 2003 Nokia Recall names and numbers . 16 Make a call . 17 Edit a name or number . 17 Delete names and numbers . 17 Customize your contacts view . 17 Check memory status . 17 6 Call log . 18 Check missed, received, or dialed calls . 18 Clear call lists . 18 Call timers . 19 7 Messages . 20 Voice mail . 20 Text, e-mail, and picture messages . 21 Text messages . 22 Picture messages . 24 E-mail messages . 25 8 Personalization . 27 Profiles . 27 Accessory settings . 29 Display language . 30 Clock . 30 Welcome note . 31 9 Advanced calling features . 32 Active-call options . 32 Voice privacy . 33 Call forwarding . 34 Call waiting . 35 Send own caller ID . 35 Select a phone number . 36 Automatic redial . 36 1-touch dialing . 37 vi Copyright 2003 Nokia Touch tone strings . 37 Link contact list entries . 39 System selection . 39 10 Security . 41 Security code . 41 Call restriction . 41 11 Special features . 43 Alarm clock . 43 Calculator . 43 Business cards . 44 Download a ringing tone . 45 12 Prepaid services . 46 Activate and deactivate . 46 Save your access numbers . 46 Check your balance . 46 Add money to your account . 47 Call customer service . 47 Expiration date . 47 13 Minute Manager . 48 Call information . 48 Account information . 49 Customer care . 49 14 Games . 50 Play . 50 Settings . 50 15 Reference information . 51 Battery statements . 51 Proper care and maintenance . 52 Important safety information . 53 Nokia 2220 User Guide
YLL Copyright 2003 Nokia Make emergency calls . 55 Accessory safety . 58 Accessories . 60 Nokia Xpress-on color covers . 60 Technical information . 62 Nokia One-Year Limited Warranty . 63 Appendix A Message from the CTIA . 67 Appendix B Message from the FDA . 71 Index . 77 viii Copyright 2003 Nokia For your safety 1 For your safety Read these simple guidelines. Breaking the rules may be dangerous or illegal. Further detailed information is given in this manual. Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger. ROAD SAFETY COMES FIRST Dont use a hand-held phone while driving. INTERFERENCE All wireless phones may get interference, which could affect performance. SWITCH OFF IN HOSPITALS Follow any regulations or rules. Switch the phone off near medical equipment. SWITCH OFF IN AIRCRAFT Wireless devices can cause interference in aircraft. SWITCH OFF WHEN REFUELING Dont use the phone at a refueling point. Dont use near fuel or chemicals. SWITCH OFF NEAR BLASTING Dont use the phone where blasting is in progress. Observe restrictions, and follow any regulations or rules. USE SENSIBLY Use only in the normal position. Dont touch the antenna unnecessarily. QUALIFIED SERVICE Only qualified personnel may install or repair phone equipment. Nokia 2220 User Guide
Copyright Nokia 2003 ACCESSORIES AND BATTERIES Use only approved accessories and batteries. Do not connect incompatible products. WATER-RESISTANCE Your wireless phone is not water-resistant. Keep it dry. CALLING Ensure the phone is switched on and in service. Enter the phone number, including the area code, then press the Talk key. To end a call, press the End key. To answer a call, press the Talk key. EMERGENCY CALLS Ensure the phone is switched on and in service. Press the End key as many times as needed (for example, to exit a call, to exit a menu) to clear the display. Enter the emergency number, then press the Talk key. Give your location. Do not end the call until told to do so. 2 Copyright Nokia 2003 About your phone 2 About your phone
WIRELESS NETWORK SERVICES A number of features included in this guide are called Network Services. These are special services you arrange through your service provider. Before you can take advantage of any of these Network Services, you must subscribe to them and obtain instructions for their use from your service provider. Note: Some networks may not support all language-dependent characters and/or services.
REGISTER YOUR PHONE Make sure to register your phone at www.warranty.nokiausa.com or 1-888-NOKIA-2U
(1-888-665-4228) so that we can better serve you, if you should need to call the Nokia Customer Care Center or have your phone repaired.
UPDATES From time to time, Nokia updates this user guide to reflect changes or corrections. The latest version may be available at www.nokia.com/us. Also, an interactive tutorial may be available at www.nokiahowto.com.
TERMS This guide uses certain terms for the parts of the phone and the steps that you are asked to perform.
Highlighted options on the screen are enclosed within a dark bar. The selection keys are used to act on the highlighted option. Selection keys are used to select various phone options. Select means to press the Left selection key or the Right selection key. In the example to the right, press the Left selection key to select Menu, or press the Right selection key to select Contacts. Scroll keys, located just below the screen, are used to move up and down in the menus and contacts.
Nokia 2220 User Guide
Copyright Nokia 2003
ICONS Icon What it means An active call is in progress. Silent has been selected as the current profile. The phone keypad is locked to prevent any accidental key presses. One or more new voice messages are waiting. One or more new text messages are waiting. (If blinking, the text message memory is full.) Digital service is available. Standard text input mode for entering alpha characters. Press # to switch between uppercase and lowercase input. Predictive text mode for quickly entering text messages. Press # to switch between uppercase and lowercase input. 123 mode. This icon appears when you press and hold # while entering text. You can now enter only numbers (not alpha characters). Press and hold # again to return to text entry mode. Special character mode. This appears when you press * while entering text. Once the characters appear, you can select a special character by selecting Insert. Alarm clock is set. 4 Copyright Nokia 2003
START SCREEN When you switch on your phone, a welcome appears, then you see the start screen. The start screen indicates that the phone is idling or standing by. About your phone Signal strength indicator Battery power indicator tab Scroll bar
SCROLL BAR When you press Menu, a vertical scroll bar appears on the right side of the screen. This scroll bar has a tab which moves up or down to indicate your location in the menu.
ANTENNA Your phone has a built-in antenna. As with any other radio transmitting device, do not touch the antenna unnecessarily when the phone is switched on. Hold the phone as you would any other telephone with the antenna pointed up and over your shoulder.
BATTERY You will need to remove the battery when replacing it, or to view the phone label
(located under the battery). For important safety information on using batteries and chargers, see Accessory safety on page 58. Install the battery 1 Place the battery in the compartment with the label side facing up and the golden contact area of the battery aligned with the contact prongs inside the phone. Press down on the battery until it snaps into place. 2 1 2 Nokia 2220 User Guide
Copyright Nokia 2003 3 4 Align the cover over the back of the phone, placing the end of the cover approximately 1/4 inch past the end of the phone. Lower the back cover onto the phone. 1/4 inch Press down slightly and slide the cover until it locks into place. Remove the battery If you purchase a new battery or need to access information on the phone label, you may need to remove the battery. Make sure the phone has been turned off for at least 10 seconds. Important: Dispose of batteries according to applicable local regulations
(for example, recycling). Do not dispose as household waste. 1 2 Hold the phone with the back facing you. At the bottom corners of the phone, press the battery cover with your thumb and forefinger. Place the thumb of your other hand in the groove, approximately 1 inch from the top of the phone. Apply pressure with the thumb, slide the back cover toward you to release it, then remove it. 6 Copyright Nokia 2003 About your phone 3 4 5 Look for the battery latch that runs along the end of the battery nearest the top of the phone. Place your thumbs on the corners of the latch and press away from the battery. Once the battery is released from the latch, it will lift slightly so that it can be removed from the phone. Warning: Use only your hands to remove the battery. Do not use any objects that may damage the phone or the battery. Charge the battery Before you begin using your phone, you need to prepare your phone by charging the battery. 1 Plug the charger into a standard wall outlet; then connect the lead from the charger to the bottom of the phone. The battery power indicator (or battery bar) appears on the screen and starts scrolling. Charging appears if the phone is on. 2 3 When the battery bar stops scrolling, the battery charge is complete. Battery full appears if the phone is on. 4 Disconnect the charger from the phone. IMPORTANT BATTERY INFORMATION Use the following guidelines to obtain the best performance from your battery:
With your phone turned off, charge your new battery for three hours before its first use. Use the battery until it is fully discharged. Repeat this procedure twice for a total of three charging cycles. Battery operation time may be less than the estimated times during the first charges. This condition is normal. If the battery is fully discharged, the scrolling bars may not appear immediately when charging. After the first charge, you can make and receive calls during the charging cycle, but the calls interrupt the charge. When the phone call ends, the charge will resume.
Nokia 2220 User Guide
Copyright Nokia 2003
The bars on the screen stop scrolling and remain constant when the phone is charged. If you leave the phone connected to the charger, the battery receives an additional charge. Note: The battery will accept a trickle charge for an additional two hours. See Reference information on page 51 for more information on batteries. Charging time depends on the charger and battery used. See Batteries on page 59 for charging, talk, and standby times. PROLONG BATTERY LIFE For good operation times with NiMH batteries, discharge the battery from time to time by leaving your phone switched on until it turns itself off. Ignore any messages to recharge your battery and let the battery completely discharge. Important: Do not attempt to discharge the battery by any other means.
HEADSET Plug the headset plug into the bottom of your phone. Put the earbud into one ear. Your phone is compatible with the HDC-5, HDC-10, HDE-2, and HDB-5 headsets. To connect the headset:
1 2 With the headset connected, you can make and answer calls as usual. The microphone for the headset hangs at the side of your head. Although the microphone may seem far from your mouth, you can speak at a normal volume. Note: You can set your phone to answer automatically when the headset is connected. See Automatic answer on page 29 for more information.
GET HELP Find phone information We recommend that you have the following available before contacting the Nokia Customer Care Center or the service provider:
Your phone model number (Nokia 2220)
ESN (Electronic serial numberlocated on the label under the battery) Your billing address ZIP code
The phone or accessory in question The type label is located under the battery inside the back cover. Do not remove or deface the label. 8 Copyright Nokia 2003 About your phone Contact Nokia Nokia Customer Care Center, USA Customer Care Centre, Canada Nokia Mobile Phones 7725 Woodland Center Blvd. Suite #150 Tampa, Florida 33614 Nokia Products Ltd. 601 Westney Road South Ajax, Ontario L1S 4N7 Tel: 1-888-NOKIA-2U
(1-888-665-4228) Fax: 1-813-249-9619 For TTY/TDD users: 1-800-24-NOKIA
(1-800-246-6542) Tel: 1-888-22-NOKIA
(1-888-226-6542) Fax: 1-905-427-1070 Web site: www.nokia.ca Contact your service provider You may want to save your service providers customer support telephone number into your phone. This will let you easily contact your provider if you have questions or issues with your phone service. Accessibility information Nokia is committed to making mobile phones easy to use for all individuals, including those with disabilities. Nokia maintains an internet site that is dedicated to accessibility solutions. For more information about phone features, accessories and other Nokia products designed with your needs in mind, visit the web site at:
www.nokiaaccessibility.com Nokia 2220 User Guide
Copyright Nokia 2003 3 Basic operations
SWITCH YOUR PHONE ON OR OFF Warning: Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger. To switch on the phone, press and hold the Power key for 2 seconds. To switch off the phone, press and hold the Power key.
MAKE AND ANSWER CALLS Power key Enter the phone number, including the area code if needed. Press the Talk key. There are several ways to make and answer calls on your phone. You will discover other tips throughout this guide when reading about the phone features. Make a call 1 2 End a call Press the End key to end the call or to cancel the call attempt. Answer a call When your phone rings, press the Talk key, press one of the scroll keys twice, or press any key except the Power key or the End key. Note: If Keyguard is active, the keypad will unlock when you have an incoming call. Silence an incoming call Press the End key or select Silent to mute the ringing of an incoming call. Redial the last-dialed number Press the Talk key twice. 10 Copyright Nokia 2003 Basic operations Adjust the earpiece volume Adjust the earpiece volume during a call by pressing the scroll keys located just below the screen.
Press the Scroll up key to increase the volume. Press the Scroll down key to decrease the volume.
LOCK THE KEYPAD Keyguard disables your keypad to prevent accidental key presses.
To lock the keys, select Menu and press *. To unlock the keys, select Unlock and press *. To answer a call when Keyguard is active, select Answer or press the Talk key. If you are connected to a headset or loopset, press and hold the End key to end the call. After you end the call, Keyguard automatically becomes active again. If you need the phone lights while Keyguard is on, press the Power key to quickly switch the lights on for 15 seconds. Connecting your phone to a car kit automatically disables Keyguard.
Note: When Keyguard is on, calls may be possible to the emergency numbers programmed into your phone (such as 911 or other official emergency number). Key in the emergency number and press the Talk key. The number is displayed only after you have keyed in its last digit.
SELECT SILENT PROFILE If you do not want the phone to disturb others, you can select the profile in which the ringing tone and all other tones are silenced. 1 2 At the start screen, quickly press and release the Power key. Scroll to Silent and select Select.
IN-PHONE HELP Many menu items have brief help text. To view the help text, scroll to the menu item and wait for about 15 seconds. Select More or press the Scroll down key to continue reading the text. Select Back to exit, or wait a few seconds to return to the current menu. Nokia 2220 User Guide
Copyright Nokia 2003
MENUS A menu is a list of choices you can make to change settings on your phone or use various phone features. Each menu can contain several levels of submenus. You can use menus and submenus two ways: by scrolling or by using a shortcut. This guide uses the scroll method when describing how to use the phone features. Scroll method 1 At the start screen, select Menu; then scroll through the menus using the Scroll up and Scroll down keys. Use the scroll and selection keys to navigate the submenus. Press the End key to return to the start screen. 2 3 For example, when you see From the menus, select Profiles > Silent, the scrolling method is as follows: at the start screen, press the Left selection key (under the word Menu), scroll to Profiles, press the Left selection key (under the word Select), scroll to Silent, and press the Left selection key (under the word Options). Shortcuts Menus and options are numbered so that you can quickly find your way to an option. The numbers appear in the top right corner of the screen and show your location in the menu. 1 2 Within 3 seconds, enter the first number of the menu function you want Select Menu. to access. Repeat until you have entered all the numbers. 3 For example, to select the Silent profile, select Menu 3-2-1. Menu Tips
You can scroll upward to quickly access the last option in a menu list. You can return to the previous menu level by pressing Back. To exit a menu and return to the start screen, press the End key. If you leave a menu by pressing the End key, you cancel any changes you made. Some menus or menu options may not appear or may appear in a different order. Ask your service provider for details.
12 Copyright Nokia 2003 4 Text entry Text entry You can use two methods for entering text and numbers.
Standard mode is the only way to enter names into contacts and to rename caller groups. Predictive text input is a quick and easy method for writing messages.
Press # to switch predictive text on or off and to use predictive text in various modes. Press and hold # to switch between text and numeric entry. As you press #, the following icons (not the descriptions) appear in the upper left of the display:
Icon Indicates... Uppercase text. Predictive text is Off. Lowercase text. Predictive text is Off. Uppercase text. Predictive text is On. Lowercase text. Predictive text is On.
STANDARD MODE Enter text (Abc)
Press a key once to insert the first letter on the key, twice for the second letter, etc. If you pause briefly, the last letter in the display is accepted and the phone awaits the next entry. Select Clear to backspace the cursor and delete a character. Select and hold Clear to backspace continuously and delete characters. Press the 0 key to enter a space and accept a completed word. Press the 1 key to enter a period (.). Press the 1 key repeatedly to cycle through special characters. Pause to insert the displayed character. Press * to display all special characters. See Punctuation and special characters on page 15.
Nokia 2220 User Guide
Copyright Nokia 2003 Switch to and from numeric entry (123) To switch to 123 mode from Abc mode, press and hold # at any message entry screen until the icon in the upper left corner of the display switches from Abc to 123 (or vice versa).
PREDICTIVE TEXT INPUT Predictive text input allows you to enter text quickly using your keypad and the built-in phone dictionary. Activate predictive text 1 2 Enter text
At any text entry screen, select Options > Predictive text. Select the language of your choice. For each letter of the word that you want to spell, press the corresponding key on your keypad only once, even if the letter you want is not the first letter on the key. The phone predicts the word you are trying to spell. If a displayed word is not correct, press * to see other matches. To move forward through a list of matches, keep pressing *. Press the 0 key to accept the word, enter a space, and begin writing the next word. If ? appears after a word, select Spell to add the word to the dictionary. See Add new words to the dictionary on page 14. Press the 1 key to insert a period into your message. Press and hold * to display special characters. See Punctuation and special characters on page 15.
Add new words to the dictionary If you encounter a word that predictive text does not recognize, a question mark
(?) follows the word and Spell appears in the lower left of the display. Select Spell, enter your new word using the keypad, and select OK. The word is added to the dictionary and to the message that you are writing. Keep these factors in mind when adding words:
New words that you accept by selecting OK, the 0 key, or deleting the space between two words are saved to the dictionary. Depending on the language and the length of the words, you may be able to add hundreds of words to the dictionary.
When the dictionary is full, the most recent addition replaces the first. 14 Copyright Nokia 2003 Predictive text example To write Nokia with predictive text on and with the English dictionary selected, press each of the following keys once:
the 6 key the 6 key the 5 key the 4 key the 2 key Text entry The illustration above simulates your display each time a key is pressed.
PUNCTUATION AND SPECIAL CHARACTERS While at any text entry screen, press * to display special characters (press and hold
* if predictive text is on). Navigate special characters using the 2, 4, 6, and 8 keys much as you would a joystick. Once a character is highlighted, press the 5 key to insert the character into your message. To enter a symbol while adding a name to the phone book, press *. To add a special character for creating a number string in the number box, press *. See Touch tone strings on page 37. Nokia 2220 User Guide
Copyright Nokia 2003 5 Contact list The contact list can store up to 200 entries. An entry can consist of a number only or a name and a number. An entry can also include an e-mail address.
CONTACT LIST OPTIONS At the start screen, select Contacts to access the following options:
FindSearch for a specific entry. Add newAdd a new contact to your contact list. Delete allDelete names and numbers one by one or all at once. OptionsGo to options for memory status and scrolling view. 1-touch dialingAssign up to eight keys for speed dialing.
SAVE NAMES, NUMBERS, AND E-MAIL ADDRESSES Enter the phone number using the keypad; then select Save. Enter a name and select OK. For information on entering text, see Text entry on page 13. Quickly save a name and number 1 2 Save an entry using the contact list menu 1 2 3 Save an e-mail address to an existing contact 1 2 3 4 Find the name to which you want to add an e-mail address. If you are not in the Name+number view, select Details. Select Options > E-mail address. Enter the e-mail address, and select OK. At the start screen, select Contacts > Add new. Enter a name; then select OK. Enter a number; then select OK.
RECALL NAMES AND NUMBERS 1 At the start screen, select Contacts > Find; then enter one or two letters of the name you want to recall. Select Find; then scroll to the appropriate entry. 2 You may want to use some of these alternate methods for recalling a number.
At the start screen, select Contacts, enter the first letter of the name, and scroll to the name. At the start screen, press one of the scroll keys to enter your list of names, and scroll to the name you want to dial. At the start screen, press the Talk key to access a list of your last ten dialed calls; then scroll to the one you want to dial.
16 Copyright Nokia 2003
MAKE A CALL When a contacts entry is highlighted, press the Talk key to dial the number. Contact list
EDIT A NAME OR NUMBER You can edit a name, a number, or both. 1 2 3 4 Recall the name or number you want to edit. If you are not in the Name+number view, select Details. Select Options > Edit. Edit the name or number and select OK.
DELETE NAMES AND NUMBERS Deleting stored names and numbers removes them from your phone. Once you delete an item, you can restore it only by re-entering it. Individual entries 1 2 3 Entire contents 1 2 Recall the contact list entry you want to delete. If you are not in the Name+number view, select Details. Select Options > Delete > OK. At the start screen, select Contacts > Delete all > OK. Enter your security code and select OK.
CUSTOMIZE YOUR CONTACTS VIEW To change the way you view names and numbers in your contacts list:
At the start screen, select Contacts > Options > Contacts view. 1 2 Select one of the following options:
Name listDisplays three names on the screen at a time. Name+numberOnly one name and its corresponding number appears on the screen at a time. Name onlyDisplays individual names only. You can view the corresponding phone number by selecting Details and then scrolling up or down. Important: If you select the Name+number contacts view, you will not need to select Details when working with contact list options.
CHECK MEMORY STATUS To check how much contact list memory is free and how much has been used, at the start screen, select Contacts > Options > Memory status. Nokia 2220 User Guide
Copyright Nokia 2003 6 Call log Your phone provides a call log that registers information about calls you make and receive. The call log keeps track of missed, received, and dialed calls. For call log to work properly:
You must be in a digital network, your service provider must support caller ID, and it must be enabled. Your calls cannot be blocked. Your phone must be on and within the service area or in a compatible network if roaming.
CHECK MISSED, RECEIVED, OR DIALED CALLS 1 2 3 From the menus, select Call log; then select either Missed calls, Received calls, or Dialed calls. Scroll to the number you want to view. Select Options; then select one of the following options:
Call timeShow the time when the call was connected. (You must first set the phone clock.) Send messageSend a text message to the person who called you or whom you called. Edit numberEdit the number and save it with a name to your contact list. SaveEnter a name for the number and save both to your contact list. DeleteDelete the number from the call list. View numberView the number. (The callers name and number must be stored in the contact list.) CallDial the number from the call log. When the number of a missed, received, or dialed call is highlighted, you can call the number by pressing the Talk key.
CLEAR CALL LISTS Warning: You cannot undo this operation. 1 2 From the menus, select Call log > Clear call lists. Select either All, Missed, Received, or Dialed. 18 Copyright Nokia 2003 Call log
CALL TIMERS Your phone tracks the amount of time you spend on each call. View call durations 1 2 From the menus, select Call log > Call timers. Select one of the following options:
Duration of last callShow the call duration of the last call. Duration of all callsShow the call duration of all calls that have been made and received since you reset the timers. Clear timersClear all call timers for the currently selected phone number.
(Your phone includes separate timers for each number used.) This action cannot be undone. Note: The actual time invoiced for calls by your service provider may vary, depending upon network features, rounding off for billing, and so forth. Clear call timers 1 From the menus, select Call log > Call timers > Clear timers. 2 Enter your security code and select OK. Turn on a current call timer You can set your phone to show the running elapsed time while a call is active. 1 From the menus, select Settings > Call settings > Current call timer > On. From this point on, the timer is active during each call you make or receive. The time appears on the phone screen. After a call ends, press any key on the phone keypad to clear the current call time from the screen. The All option clears every number in every list, whereas the other options clear only the numbers associated with that option. For example, the Dialed option clears only the numbers associated with calls you previously dialed. 2 Nokia 2220 User Guide
Copyright Nokia 2003 7 Messages Your phone can send and receive voice mail, text and picture messages, and e-mail. Not all messaging features are available in all wireless networks. Contact your service provider for availability and subscription information.
VOICE MAIL From the menus, select Messages > Voice messages > Voice mailbox number. Enter your voice mailbox phone number; then select OK. To use voice mail, you must learn the various greetings, passwords, and prompts. Your service provider can provide instructions. Save the voice mailbox number As part of the network voice mail feature, your service provider gives you a voice mailbox phone number. 1 2 Your voice mailbox number can be up to 32 digits long and is used until you change it. Therefore, if your phone number changes, the voice mail number will probably change also. For further information, contact your service provider. Check for messages When you receive a voice message, your phone beeps and the message New voice message appears on the phone screen, along with the If you receive more than one voice mail message, your phone may show the number of messages that you have received. The wireless network provider determines the type of indication you will receive. Listen to your voice messages The way you listen to your voice messages depends on your service provider. Call your service provider for more information. To listen to a voice message immediately, select Listen and follow the instructions given on the phone. To store a voice message for later listening, select Exit. To listen to stored voice messages, press and hold the 1 key; then follow the prompts. icon. 20 Copyright Nokia 2003
TEXT, E-MAIL, AND PICTURE MESSAGES Messages Your phone is capable of a variety of messaging services including text messages
(SMS or short message service), picture messages, and e-mail messages. Messaging services are Network Services. Consult your service provider for information on availability, subscribing to and using messaging services. Understand messaging Message recipients: The phone to which you send a message must support messages. The recipient may not receive the SMS message you send if the recipients account is with a different service provider or uses a different protocol. Message length: The maximum length of a sent or received message is 160 characters. Your phone has space for several messages, depending on the length of each message. The maximum length of a message also may depend on the capabilities of the network from which the message originated. Message options There are several options available when working with text, picture, and e-mail messages. The order and availability of options may vary depending on the messaging function and your service provider. SendAttempt to send the text message to the recipient. SettingsSet Urgent, Read receipt, Reply req., and Callback no. options for the message. SaveSave the message in the archive folder. Clear textClear the text in the message editor. Exit editorGo back to the Write message menu. Predictive textTurn predictive text on and off. Insert wordIf predictive text (T9) is activated, you can manually spell a word and insert it into your message. Insert numberInsert numbers into the message. Insert symbolAccess the list of special characters. Save pictureSave a picture to the template folder. MatchesList alternative word choices while using predictive text. DetailsWhen viewing a picture message, view the senders name and number. PreviewPreview a picture message before sending. Edit textAdd text to a picture message. DeleteDelete a message. Nokia 2220 User Guide
Copyright Nokia 2003 ForwardForward a message. Use numberUse the number associated with a message. ReplayReplay messages you receive. Edit recipientEdit the e-mail address. Edit subjectEdit the subject of an e-mail message. Folders Your phone has folders for managing text messages. Text message folders are located under the Messages menu. InboxThe inbox stores messages you receive. Messages remain in the inbox until you delete them or save them in the archive folder. You can forward or reply to messages in your inbox. OutboxThe outbox stores messages you have written, sent, edited, and forwarded. Messages in the outbox are not saved messages. As you send new messages, old messages will automatically be removed from the outbox. When message memory is full, one or more messages of the lowest priority are automatically deleted from the outbox. If you want to save a message you have sent, read the message while it is in the outbox and use the Options menu to save it to the archive folder. ArchiveThe archive folder stores messages you have saved. You can save messages to the archive folder from the inbox and the outbox. You can reply to or forward saved messages. Delete messages from folders 1 2 3 From the menus, select Messages > Delete all. Select either All read, Inbox, Archive, or Outbox. Enter your security code; then select OK.
TEXT MESSAGES Write and send a text message 1 2 From the menus, select Messages > Write message. Enter a message of up to 160 characters. A counter in the upper right corner of the screen shows the number of characters remaining. 3 When you have finished writing the message, select Options > Send. 4 Enter or recall the recipients phone number; then select Send. 22 Copyright Nokia 2003 Messages Note: When sending messages using the SMS network service, your phone may display the words, Message Sent. This is an indication that the message has been sent by your phone to the message center number programmed into your phone. This is not an indication that the message has been received at the intended destination. For more details about SMS services, check with your service provider. Read a text message When you receive a text message, the phone beeps and displays Message received and the To read the message immediately:
1 2 3 Select Read to view the message. Use the scroll keys to view the whole message, if necessary. Once you have finished, press the End key to return to the start screen, or select Options for other choices, such as Reply or Forward. indicator in the upper left corner of the screen. Select Messages > Inbox. If you have more than one new message, scroll to the message you want to view. To save the message for later viewing, select Exit to move the new message to the inbox. To read a saved message:
1 2 Messages in the inbox are listed in the order they are received, with the most recent message listed first. Unread messages are indicated by Respond to a text message There are many options available for working with text messages. For a list of options and their descriptions, see Message options on page 21. REPLY TO THE MESSAGE 1 While reading the message, select Options > Reply. 2 Select either As message or As e-mail. When replying as e-mail, see Send an e-mail message on page 25. When replying as message, see Write and send a text message on page 22. FORWARD THE MESSAGE 1 While reading the message, select Options > Forward. 2 Select either As message or As e-mail. When forwarding as e-mail, see Send an e-mail message on page 25. When forwarding as message, see Write and send a text message on page 22. Nokia 2220 User Guide
Copyright Nokia 2003 SAVE A MESSAGE While reading the message, select Options > Save. The message is moved to the archive folder. DELETE A MESSAGE While reading the message, select Options > Delete > OK. WHEN MEMORY IS FULL When message memory is full, one or more read messages of the lowest priority are automatically deleted. When you receive an emergency message, messages may be deleted from any of your message folders. If you have more messages waiting at the network, You can delete old messages to create space for new messages. blinks on the start screen.
PICTURE MESSAGES Your phone offers five picture messages that you can use to send pictures and text to your friends and family. You can also save a new picture by replacing an existing picture. For possible message options, see Message options on page 21. Each picture message is made up of several text messages. Note: This function can be used only if it is supported by your network operator or service provider. Only phones that offer compatible picture message features can receive and display picture messages. Send a picture message 1 2 3 From the menus, select Messages > Picture messages. Scroll to the picture you want to send; then select Show. To choose a different picture, select Back and scroll to another picture; then select Show. 4 When you are viewing the picture you want to use, select Options > Edit text. 5 Enter a text message to send with the picture. After you enter the text, you have several options. To view a list of possible options, see Message options on page 21. To preview the message before sending it, select Options > Preview. After viewing the message, select Back. To send the picture and message, select Options > Send. Enter or recall the recipients phone number; then select Send. 6 7 8 9 24 Copyright Nokia 2003
E-MAIL MESSAGES Receive a picture message 1 When your phone displays Picture message received, select Show. 2 If the picture has a text message with it, scroll up or down to see the entire message. Messages Save a picture message 1 Select Show to view the message; then select Save. You have the option to replace a current message. Scroll to the picture you want to replace; then select Replace. You can send e-mail up to 160 characters in length to anyone with an e-mail address. This is a Network Service.
Messages sent to you by e-mail arrive as regular text messages. You can use all the options described earlier to save, reply to, or forward a message. Contact your service provider to get the e-mail address and gateway number for your phone, and for more information on using e-mail. Send an e-mail message 1 From the menus, select Messages > Write e-mail. Note: If you get a prompt asking you to enter your e-mail gateway number, you must obtain this number from your service provider. At the E-mail address prompt, enter your recipients e-mail address or select Find to retrieve a saved e-mail address from your phone list. Select OK. Enter a subject (optional) for your e-mail message; then select OK. Note: Predictive text is not available when entering an e-mail address or a subject line for your e-mail. Enter the text of your message. A running total of remaining characters appears in the top right corner of the screen. After you finish entering the text of your e-mail, select Options > Send. 6 Receive an e-mail message When you receive an e-mail message, the phone makes a sound and displays Message received and the indicator in the upper left corner of the screen. 2
2 3 4 5 Nokia 2220 User Guide
Copyright Nokia 2003 To read the message, select Read. While reading a received e-mail message, you can choose other options, such as Reply and Forward. See Message options on page 21. Edit an existing e-mail message Edit an e-mail message by replying to the message or forwarding it. You can edit messages from any folder. Reply to an e-mail message 1 While reading the message, select Options > Reply. 2 Select either As message or As e-mail. When replying as e-mail, see Send an e-mail message on page 25. When replying as message, see Write and send a text message on page 22. Forward an e-mail message 1 While reading the message, select Options > Forward. 2 Select either As message or As e-mail. When forwarding as e-mail, see Send an e-mail message on page 25. When forwarding as a message, see Write and send a text message on page 22. 26 Copyright Nokia 2003 Personalization 8 Personalization Your phone can be easily customized to fit your lifestyle. The display language, ringing tones, audio, and accessory settings (among others) can all be modified to suit your needs. Your phone has various profiles which allow you to customize ringing and alert tones for different environments. Once you modify the profiles, you can activate the profile that is appropriate for your surroundings. For example, you can select the Silent profile while at the movies or the Outdoor profile when at a sporting event.
PROFILES Profiles let you set sound settings to match your environment. Pick the profile that suits your current environment: Normal, Silent, Meeting, Outdoor, or Pager. You can customize any of the profiles. Important: You can select a default profile for each of these accessories:
Headset, Handsfree Car Kit, and Loopset. To learn more about accessories, see Accessory settings on page 29. Quickly press and release the Power key. Scroll to the profile you want to use and select Select. From the menus, select Profiles. Scroll to the profile you want to customize and select Options > Customize. Select the option you want to customize. Select a profile 1 2 Customize a profile 1 2 3 RINGING OPTIONS You can choose the type of ring your phone uses to notify you of an incoming call. This setting does not affect any incoming text message alert tones. From the customization options, select Ringing options; then select one of the following:
RingThe phone rings normally. AscendingRinging volume gets louder if the phone is not answered. Ring onceThe phone rings once to indicate an incoming call. Beep onceThe phone beeps once to indicate an incoming call. SilentThe phone makes no sound. Nokia 2220 User Guide
Copyright Nokia 2003 RINGING TONE The ringing tone is the sound your phone makes when you receive a call. Your phone contains preprogrammed ringing tones. You can set the ringing tone to a specific sound or tune to personalize how the phone rings. You can also add custom ringing tones to your phone. See Download a ringing tone on page 45 for more information. From the customization options, select Ringing tone; then scroll through the available tones and select the one that you want to use. As you scroll through the ringing tones, you can listen to a sample of each if your current ringing option is not set to Silent or Beep once. If you have already chosen a ringing option of either Silent or Beep once, the ringing tones are already turned off. See Ringing options on page 27 for details. RINGING VOLUME You can set the default ringing volume for incoming voice calls and message alert tones. From the customization options, select Ringing volume; then scroll through the volume levels and select the one that you want to use. VIBRATING ALERT You can set your phone to vibrate to indicate an incoming call. 1 2 From the customization options, select Vibrating alert. Scroll to On to activate or Off to deactivate, and select OK. The phone does not vibrate when it is connected to or placed in any charging device. MESSAGE ALERT TONE You can set your phone to use a certain tone to indicate an incoming text message. 1 From the customization options, select Message alert tone; then scroll through the tone selections. The phone plays samples of each selection as you scroll to it. 2 When you find the tone you want, select Select. KEYPAD TONES Keypad tones set the volume of the tone you hear when you press phone keys. From the customization options, select Keypad tones; then select the level that you want to use. If you choose Off, no keypad tones are heard. In the Silent profile, the keypad tones are turned off. 28 Copyright Nokia 2003 Personalization WARNING TONES Warning tones include the sounds your phone makes during error conditions, during confirmations, when the battery is low, and when you need to recharge the battery. From the customization options, select Warning tones; then select either On or Off. Rename a profile 1 From the customization options, select Profile name. 2 Enter the new name and select OK. You cannot rename the Normal profile.
ACCESSORY SETTINGS Use your phone with these Nokia accessories:
Headset (HDC-5, HDE-2, HDB-5, and HDC-10) Handsfree Car Kit (CARK-125 and CARK-134) Loopset (LPS-3) TTY/TDD Adapter (HDA-9) Note: You can select a default profile that will be associated with each accessory, such as Normal. However, the Accessory settings menu will not appear until after an accessory has been connected to the phone at least once. Loopset 1 2 Attach the loopset to the phone. From the menus, select Settings > Accessory settings > Loopset > Use loopset > Yes. Automatic answer This feature lets your phone answer incoming calls after just one ring when an accessory is connected to the phone. 1 2 3 From the menus, select Settings > Accessory settings. Select either Headset, Handsfree, or Loopset. Select Automatic answer > On. Nokia 2220 User Guide
Copyright Nokia 2003 Lights (Car kit only) When your phone is connected to a car kit, you have a choice of having the phone lights on continuously or only when the phone is in use. 1 2 From the menus, select Settings > Accessory settings > Handsfree > Lights. Select On (phone lights on continuously) or Automatic (phone lights on only when in use); then select OK. Default profile When you use the headset, car kit or loopset, you can select a default profile. 1 2 3 From the menus, select Settings > Accessory settings. Select either Headset, Handsfree or Loopset. Select Default profile; then select the profile you want. Note: The Active profile uses the current profile setting you have selected for your phone.
DISPLAY LANGUAGE You can choose the phone display language. 1 2 From the menus, select Settings > Phone settings > Language. Select the language you want.
CLOCK Your phone contains a real-time clock that can be set two different ways: the clock can use the time information provided by the wireless system or it can be set manually. Once the time is set, you can display the clock on the start screen. For added convenience, the clock is connected to an alarm clock. See Alarm clock on page 43 for additional information. Time format 1 2 Set the clock 1 2 3 From the menus, select Settings > Time settings > Clock > Set the time. Enter the time in hh:mm format and select OK. If the current time format is am/pm, select either am or pm. From the menus, select Settings > Time settings > Clock > Time format. Select either 24-hour or am/pm. Note: Even if you have selected the am/pm format, you can still set the clock in the 24-hour format. 30 Copyright Nokia 2003 Personalization Automatic update of time You can set your phone to update the time from the network when you turn the phone on. If the clock in your phone is 30 seconds or more off the network time, the phone will automatically update to reflect the network time. Note: Automatic update of time is a network dependent feature. Contact your service provider for details and availability. 1 2 From the menus, select Settings > Time settings > Auto-update of time. Select one of the following options:
OnUpdate the time automatically. Confirm firstRequest confirmation before updating the time. You can accept or decline the update. OffDo not automatically update the time. Display or hide the clock 1 2 From the menus, select Settings > Time settings > Clock. Select either Hide clock or Show clock (togglesonly one choice appears, depending on the current setting).
WELCOME NOTE You can add a welcome note that your phone displays briefly when you turn it on. 1 2 From the menus, select Settings > Phone settings > Welcome note. Enter a note, and select Options > Save. To delete the welcome note, select Settings > Phone settings > Welcome note > Options > Delete. Restore factory settings If you have made changes to your phone profiles (settings), you can restore them to their original or factory settings. The memory, timers, language selection, and security code are not reset. However, profile and accessory settings are reset. 1 2 From the menus, select Settings > Phone settings > Restore factory settings. At the prompt, enter your five-digit security code and select OK. Nokia 2220 User Guide
Copyright Nokia 2003 9 Advanced calling features Not all features described in this guide are available in all wireless networks. Contact your service provider for availability of network services.
ACTIVE-CALL OPTIONS Your phone allows you to use a number of features during a call; however, you may not be able to use all options at all times. Also, the order of in-call options may vary. Note: Many in-call options are network dependent features. To use these options, you may need to contact your service provider. During a call, select Options to see the in-call menu choices:
Lock keysLock the phone keypad during a call. MuteMute the phone microphone. This option can affect the microphones of accessories connected to the phone. End all callsEnd all active calls. Touch tonesSend touch tones. New callMake a call while you have a call in progress. MenuAccess the menus. ContactsAccess the contact list. Make a new call To make a new call while already in a call, dial the number and press the Talk key. End all calls Press the End key. Access the contact list Select Options > Contacts. Save a name and/or number 1 2 3 Mute the microphone Select Options > Mute. Enter the number you want to save. Select Options > Contacts > Add new. Add the name and number as you normally would. 32 Copyright Nokia 2003 Advanced calling features Conference calling While in a call, you can call another number to add a third party to the call. Note: Conference calling is a network dependent feature. Contact your service provider for availability and details. CONFERENCE A CALL 1 While in a call, dial the number you want to add and press the Talk key. 2 When the third party answers, press the Talk key to connect all three parties. DISCONNECT THIRD PARTY While all three parties are connected, press the Talk key to disconnect the third caller while keeping the second partys call active. DISCONNECT SECOND PARTY To disconnect with the second party and remain connected to the third party, have the second party terminate the call on his/her end. RECALL A NUMBER FROM THE CONTACT LIST DURING A CALL 1 2 END A CONFERENCE CALL To end all calls, press the End key. To access the contact list, select Options > Contacts. Select the number in your contact list; then select OK to call the number.
VOICE PRIVACY The voice privacy feature encrypts the voice channel so that people cannot eavesdrop on your phone conversations. Note: Voice privacy is a network dependent feature. Contact your service provider for more information on this feature. From the menus, select Settings > Network services > Voice privacy. Select On to activate, or Off to deactivate. 1 2 During a call, voice privacy becomes active and notifies you with a beep. A notification message also appears on the screen. If you turn this feature on and voice privacy becomes inactive, your phone beeps and displays Voice privacy not active. Note: Use caution when sending confidential information, if voice privacy is not active. Nokia 2220 User Guide
Copyright Nokia 2003
CALL FORWARDING With call forwarding, you can forward incoming calls to another phone number. Before you can use call forwarding, you must first store the feature codes. Once call forwarding has been activated, Call forwarding appears as a menu option. Note: Call forwarding is a network dependent feature. Some networks require that call forwarding be activated manually. Contact your service provider for availability and full details. Feature codes Your network requires separate codes for activating and canceling the various types of call forwarding. Your service provider can provide you with the necessary feature codes for these network services. Once you store these feature codes in your phone, they are sent automatically to the network when you select one of the call forwarding options from your phone menu. Your phone can store the following types of feature codes:
Forward all callsForward all incoming calls to the number you specify. Forward if busyForward incoming calls when you are in a call. Forward if not answeredForward incoming calls when you are unable to answer. Forward if out of reachForward incoming calls when the phone is out of the network or switched off. Cancel all call forwardingCancel all active call forwarding options. Store the feature code 1 2 3 4 5 Activate or cancel 1 From the menus, select Settings > Network services > Network feature setting. Enter the feature code and select OK > Call forwarding. Select the call forwarding option you want; then select Activate. Enter the feature code for canceling call forwarding; then select OK. Press the End key to return to the start screen. From the menus, select Settings > Network services > Call forwarding; then select the desired call forwarding option. Select Activate to activate call forwarding, or Cancel to cancel call forwarding. If you are activating call forwarding, enter the number to which you want your calls forwarded or select Find to recall a number from the contact list; then select OK. 2 3 34 Copyright Nokia 2003 Advanced calling features
CALL WAITING During a call, call waiting beeps to let you know that someone else is calling you. Depending on your caller ID setup, the phone might also display the number of the incoming call. Once call waiting has been activated, Call waiting appears as a menu option. Note: Call waiting is a network dependent feature. In some networks the call waiting code must be activated manually. Contact your service provider for availability and full details. Store the feature code 1 From the menus, select Settings > Network services > Network feature setting. Enter the feature code issued by your service provider and select OK. Select Call waiting > Activate. 2 3 Activate call waiting From the menus, select Settings > Network services > Call waiting > Activate. Manage calls Call waiting works with both local and long distance calls.
To answer an incoming call, press the Talk key. To switch from one call to another, press the Talk key. To end both calls, press the End key.
SEND OWN CALLER ID This feature allows you to block caller ID when you call someone (your number will not be displayed on their caller ID). This feature works on a call-by-call basis. You must enable this feature each time you want to block the sending of your own number to the recipients caller ID. Note: This feature is available only when supported by the wireless network and may not function if you are roaming. Store the feature code Before you can use the Send own caller ID call feature, you must store the feature codes for activating this feature. Once the code is stored in your phone, it is sent automatically to the network when you select this option from your phone menu. 1 From the menus, select Settings > Network services > Network feature setting. Nokia 2220 User Guide
Copyright Nokia 2003 Enter the feature code issued by your service provider and select OK. Select Send own caller ID > Yes. 2 3 Place a call without sending your number 1 2 From the menus, select Settings > Network services > Send own caller ID > No. Enter the desired phone number, or press Find to recall a phone number from the contact list; then select OK. The phone automatically inserts the feature code into the dialing string and dials the phone number. The phone you are calling will not display your phone number through caller ID.
SELECT A PHONE NUMBER Your service provider programs your phone number and system information into your phone memory when your phone is first activated. Your phone can hold up to three numbers. This means that your phone can be activated in three different service areas. For example, your phone could be activated in Dallas, Chicago, and New York. Each service area would assign a different phone number or account to your phone. You must select a phone number for your home system. Only one phone number can be active at a time. If you travel outside your home system, you can choose another number. One phone number is usually enough if your service provider has service or roaming agreements for each area in which you wish to use your phone. Contact your service provider for details. You need at least one active number to make calls. You cannot change from one phone number to another during a call. Note: Phone number selection is a network dependent feature. Some networks may not support more than one number. Contact your service provider for availability and full details. 1 2 From the menus, select Settings > Network services > Own number selection. Select the phone number you want to use.
AUTOMATIC REDIAL When the wireless network is busy or unavailable, automatic redial instructs your phone to retry the call. However, this feature does not automatically retry a number when the number you are calling is busy. From the menus, select Settings > Call settings > Automatic redial > On. If the system is busy, your phone makes three additional call attempts. If you want to stop the automatic redial process before the last attempt, press the End key or select Quit. 36 Copyright Nokia 2003 Advanced calling features
1-TOUCH DIALING You can assign a name from your contact list to a 1-touch dialing location, using keys 29. (The 1 key is used exclusively to dial your voice mailbox.) Once assigned, the phone number you associate with that key is dialed automatically when you press and hold the key. Assign a 1-touch key 1 2 3 4 At the start screen, select Contacts > 1-touch dialing. Scroll to a number that has the message (empty) and select Assign. Select the name and number to which you want to assign this key. To call a number using 1-touch dialing, press and hold the appropriate key for a few seconds. At the start screen, select Contacts > 1-touch dialing. Scroll to the key you want to change and select Options > Change. Scroll through the contact list and select the new number. Change numbers 1 2 3 Delete numbers 1 2 At the start screen, select Contacts > 1-touch dialing. Scroll to the key you want to delete and select Options > Delete > OK.
TOUCH TONE STRINGS Your phone allows you to create special sets of numbers known as touch tone strings which will dial a series of digits after a wait or a pause. For example, you can program your phone to send your account number while you are banking by phone. You must be in the as usual. When you want to insert the special characters, press * repeatedly to switch among *, +, p, w characters. mode to enter these characters. Enter the numbers Note: Use caution when sending confidential information, if voice privacy is not active. p Creates a pause when a number is dialed. The numbers you enter after this special character are automatically sent as touch tones after a 2.5-second pause. w Creates a wait when a number is dialed. This means that your phone waits for you to press the left selection key before it sends the number as touch tones. Sends command strings to the network. Contact your service provider for details. Links a 1-touch dialing number to a number in the contact list.
Nokia 2220 User Guide
Copyright Nokia 2003 Set manual touch tones 1 2 From the menus, select Settings > Phone settings > Touch tones > Manual touch tones. Select one of the following options:
ContinuousSound the tone for as long as you press and hold a key. FixedSet the tone to a fixed length, regardless of how long you press a key. OffTurn off the tones. No tones are sent. Set length You can also set the length of each touch tone. 1 From the menus, select Settings > Phone settings > Touch tones > Touch tone length. Select either Short (0.1 second) or Long (0.5 second). 2 Store You can store touch tone strings the same way that you store names and numbers in your contact list. You can store an entire sequence of digits and send it as touch tones for frequently used strings of numbers. 1 2 3 4 Send 1 Enter the phone number that you want associated with a touch tone. Enter the touch tone character where needed (p, w, or *). Enter the touch tone string. Store the number as you normally would. From the menus, select Settings > Phone settings > Touch tones > Manual touch tones. Select either Continuous or Fixed (not Off). During the call, select Options > Touch tones. Enter the touch tone string or recall the string from the contact list, and select OK. 2 3 4 If you send touch tones while in the analog mode, be careful not to send confidential information. 38 Copyright Nokia 2003
LINK CONTACT LIST ENTRIES Advanced calling features This feature allows you to store a phone number in one contact list location and link it to another contact list entry. For example, you can link the phone number of an automated service, such as automated banking service, with a touch tone string entry in your contact list, such as account and PIN numbers. Then the phone automatically recalls and sends the touch tone string when you call the service. 1 2 Store the touch tone string into your contact list. Assign the contact list entry with the touch tones to a 1-touch dialing location. For more information, see 1-touch dialing on page 37. Edit the automated services phone number by adding +n to the end of the phone number (where n is the 1-touch dialing location). Example: 214-555-1234+3 Select OK to save your changes. Dial the automated service number from your contact list. Your phone automatically sends the touch tones when the call connects. Note: You may need to enter a pause (p) or a wait (w) before the + in order to account for delays in the automated system answering your call
(for example, 214-555-1234p+3). 3 4 5
SYSTEM SELECTION Your phone can operate in residential, private, and public systems (such as your home system). You can choose how your phone selects a network to use. Your phone may not show the options described here. For information, contact your service provider. Search for a network From the menus, select System; then select one of the following options:
AutomaticYour phone automatically searches for available networks and chooses the appropriate one. Every time you turn on your phone, it resets to Automatic. ManualThe phone searches for networks and then shows a list of the ones that are available. If an available network is found, the word Available appears on the screen, followed by the name of the network. To choose the network listed, select OK. New searchYour phone begins a new search for both private and residential systems. When it finds the best system available, the phone shows the system name. If the phone does not find another system, the question Perform an extended search? appears. Select OK to continue searching. Nokia 2220 User Guide
Copyright Nokia 2003 Select a public system When you take your phone outside its home system, the phone is said to be roaming. The phone can search for home-type systems (that is, systems of the same type as your home system). Or, the phone can search for nonhome-type systems. Your service provider programs a list of preferred systems into your phone. These are systems with which your service provider has roaming agreements. Your phone looks for these systems when you are roaming. 1 2 Note: The options described here may not be available for your phone. Contact your service provider for information. From the menus, select Settings > Network services > Public system selection. Select one of the following options:
Any systemWhen service is not available in your home system, the phone searches for a preferred system of either type and then searches for a home-type system. Then it searches for a nonhome-type system. The search continues until your phone finds a system that can be used. Home typeWhen service is not available in your home system, the phone searches for a home-type system first. However, if a nonhome-type system is found, your phone will use that system. Nonhome typeThe phone searches for a nonhome-type system only. The home-type system is not used. Home onlyThe phone uses only its home system. It will not roam. Select digital or analog Your phone can work in both digital and analog modes. 1 From the menus, select Settings > Network services > Digital/analog selection. Select either Digit. & analog, Analog, or Digital. 2 Your phone uses both digital and analog voice channels. The phone always tries to find a digital voice channel first, but if a digital voice channel is not available, the phone looks for an analog voice channel. Note: This feature is available only for certain phones. Contact your service provider for more information. 40 Copyright Nokia 2003 Security 10 Security
SECURITY CODE The security code prevents unauthorized users from changing certain important feature settings on your phone. The phone prompts you to enter the security code when required. The default code is 12345. Nokia recommends that you change the default code immediately. Note: If you enter an incorrect security code 5 times in a row, the phone will not accept the correct code for 5 minutes. Use this procedure to change your security code:
1 2 From the menus, select Settings > Security settings > Change security code. At the Security code prompt, enter the default security code (12345) or your current security code and select OK. At the Enter new security code prompt, enter your new five-digit security code and select OK. At the Verify new security code prompt, enter your new security code again and select OK. 3 4 Keep your security code secret and stored in a safe place away from your phone. If you have changed your security code and do not remember the new code, contact your service provider.
CALL RESTRICTION You can create up to 10 restrictions to restrict incoming and outgoing calls. Before you define restrictions for outgoing calls, Add restriction is the only available option. After you use the Add restriction option to add at least one restriction, the following options become available:
SelectSelect call restrictions from the outgoing calls list. Add restrictionAdd a new restriction. EditEdit an existing call restriction. DeleteDelete an existing call restriction. Note: When calls are restricted, calls may be possible to the emergency number programmed into your phone (for example, 911 or other official emergency number). For example, you could dial 911 and press the Talk key. Nokia 2220 User Guide
Copyright Nokia 2003 Add a number 1 2 3 4 From the menus, select Settings > Security settings > Call restrictions. Enter your security code; then select OK. Select Restrict outgoing calls > Add restriction. At the number prompt, enter the number you want to restrict, and select OK. For example, if you want to restrict all long distance calls that begin with 1, enter 1. If you want to restrict all calls that begin with 972, enter 972. Enter a name for the restriction and select OK. If you select OK without entering a name, the number will be used. 5 Restrict outgoing calls 1 2 3 From the menus, select Settings > Security settings > Call restrictions. Enter your security code; then select OK. Select Restrict outgoing calls > Select to choose from your list of call restrictions. To deactivate a call restriction, scroll to the restriction and select Unmark. OR To activate a call restriction, scroll to the restriction and select Mark. Select Back. At the Save changes? prompt, select Yes. 4 5 6 Restrict all incoming calls 1 2 3 4 From the menus, select Settings > Security settings > Call restrictions. Enter your security code and select OK. Select Restrict incoming calls. If incoming calls are not currently restricted, select Mark to restrict all incoming calls. OR If incoming calls are currently restricted, select Unmark to deactivate restriction of all incoming calls. Select Back. At the Save changes? prompt, select Yes. 5 6 42 Copyright Nokia 2003 11 Special features
ALARM CLOCK Special features From the menus, select Settings > Time settings > Alarm clock. Enter the alarm time in hh:mm format; then select OK. If the time setting is in am/pm format, select either am or pm. The alarm clock feature is based on the internal clock of the phone and sounds an alert at a time you specify. The alarm clock works even if you turn your phone off. Set the alarm clock 1 2 3 Respond to the alarm At the time of the alarm, the phone sounds an alert tone. Select Stop or press the End key to stop the alarm and return to the start screen. Snooze There are several ways to enable the Snooze feature:
Once snooze is enabled, the alarm will sound again in 10 minutes. If you select Stop or press the End key while snoozing, the alarm is turned off. Alarm when phone is off If the alarm time is reached while the phone is off, the phone switches itself on and starts sounding the alarm tone. If you select Stop, the phone asks whether you want to activate the phone for calls. Select No to switch off the phone or Yes to make and receive calls. Select Snooze. Press any key except the End key. Allow the alarm to sound for one minute. Note: Do not select Yes when wireless phone use is prohibited or when it may cause interference or danger. Turn off the alarm clock From the menus, select Settings > Time settings > Alarm clock > Off.
CALCULATOR The calculator adds, subtracts, multiplies, divides, and converts currencies. Note: This calculator has a limited accuracy and rounding errors may occur, especially in long divisions. Nokia 2220 User Guide
Copyright Nokia 2003 1 2 3 From the menus, select Calculator. Enter the first number in the calculation. To enter a decimal point, press #. Select Clear to delete any mistakes. Select Options; then select either Add, Subtract, Multiply, or Divide. OR Press * repeatedly to cycle through the add, subtract, multiply, and divide functions. Enter the second number in the calculation and select Options > Equals. Repeat steps 34 as many times as necessary. 4 5 Convert currency You can use the calculator function to set an exchange rate and then calculate prices based on that exchange rate. SET THE EXCHANGE RATE 1 2 From the menus, select Calculator > Options > Exchange rate. Select one of the following options:
Foreign units converted to home unitsEnter the number of foreign units to a domestic unit. Home units converted to foreign unitsEnter the number of domestic units to a foreign unit. Enter the appropriate exchange rate (press # to enter a decimal point) and select OK. 3 CONVERT A CURRENCY AMOUNT From the menus, select Calculator. 1 2 Enter the amount which you wish to convert. 3 Select Options; then select one of the following options:
To homeConvert foreign units of currency to home units. To foreignConvert home units of currency to foreign units.
BUSINESS CARDS Your phone can send or receive electronic business cards consisting of a name, phone number and e-mail. You can save received business cards in your contact list. This is a network dependent feature. Send a business card 1 Find the name in your contact list. 44 Copyright Nokia 2003 Special features 2 3 Select Options > Send bus. card. Enter or recall the phone number to which you want to send the business card;
then select Send. View a received business card 1 When your phone displays Business card received, select Options > Show. 2 Scroll through the available information. Save a viewed business card 1 2 3 4 Delete a viewed business card After viewing the business card select Back > Discard > OK. After viewing the business card, select Back > Save. At the Name prompt, edit the name if desired; then select OK. At the Number prompt, edit the number if desired; then select OK. At the E-mail prompt, edit the e-mail address if desired; then select OK.
DOWNLOAD A RINGING TONE You can download up to 10 ringing tones to replace the personal entries in your list of ringing tones. Since this is a network dependent feature, methods for downloading ringing tones vary. Contact your wireless service provider for details. If you have this service and your phone receives a downloaded ringing tone, your phone displays Ringing tone received. Listen to received tones 1 When your phone shows Ringing tone received, select Options > Playback >
OK to play the ringing tone. To stop playing the ringing tone, press any key or select Quit. 2 Save a received tone 1 2 After listening to the ringing tone, select Quit > Save tone > Select. Choose which ringing tone you want to replaceeither an empty Personal location, if any are remaining, or a previously downloaded tone. If you are replacing a previously downloaded tone, at the Replace tone?
prompt, select OK to replace the tone or Back to return to the previous menu. 3 Discard a received tone After listening to the ringing tone, select Quit > Discard tone > OK. Nokia 2220 User Guide
Copyright Nokia 2003 12 Prepaid services Depending on your service provider, you may have either prepaid service or Minute Manager. Check with your service provider to determine which of these services, if any, applies to you. If you have Minute Manager, disregard this chapter and see Minute Manager on page 48 for more information. With prepaid service, you buy wireless network services in advance. Your phone works the same way it did before, with some additional features. Since prepaid service may not be available from your wireless service provider, the Prepaid screen may not appear. Contact your service provider for details.
ACTIVATE AND DEACTIVATE After you sign up with your service provider for prepaid service, you can activate the Prepaid menu in your phone. This menu appears on your screen only if you have activated the service. To activate prepaid services, enter the following sequence: *#7766#
To deactivate prepaid services, enter the following sequence: *#77633#
SAVE YOUR ACCESS NUMBERS You can save the prepaid service access numbers in your phone. Contact your service provider for the access numbers. 1 From the menus, select Prepaid > Save access phone numbers > Replenish phone number. Enter the replenish number from your service provider; then select OK. Select Balance phone number. Enter the balance number from your service provider; then select OK. Select Customer service phone number. Enter the customer service number from your service provider; then select OK. 2 3 4 5 6
CHECK YOUR BALANCE You can check the balance remaining in your prepaid account. Contact your service provider for the access number used to check the balance. Note: When no more charging units or currency units are left, calls may only be possible to the emergency number programmed into your phone
(for example, 911). 1 From the menus, select Prepaid > Check account balance. 46 Copyright Nokia 2003 2 3 If you have not already saved the balance number under Save access phone numbers, enter the balance number and select OK. The phone calls the balance number. Follow the operator prompts. Prepaid services
ADD MONEY TO YOUR ACCOUNT 1 2 3 From the menus, select Prepaid > Add money to account. If you have not already saved the replenish number under Save access phone numbers, enter the replenish number and select OK. The phone calls the replenish number. Follow the operator prompts.
CALL CUSTOMER SERVICE You can call the customer service number for your prepaid account. Contact your service provider for the access numbers. 1 2 From the menus, select Prepaid > Call customer service. If you have not already saved the customer service number under Save access phone numbers, enter the customer service number and select OK. The phone calls the customer service number. Follow the operator prompts. 3
EXPIRATION DATE You can store and edit the expiration date of your prepaid credit each time you add money to your account. Enter and change this date manually. Enter a date 1 2 View a date From the menus, select Prepaid > Expiration date. From the menus, select Prepaid > Expiration date. Enter the expiration date and select OK. Nokia 2220 User Guide
Copyright Nokia 2003 13 Minute Manager Depending on your service provider, you may have either prepaid service or Minute Manager. Check with your service provider to determine which of these services, if any, applies to you. If you have prepaid service, disregard this chapter and see Prepaid services on page 46 for more information. With Minute Manager service, you cap monthly spending of mobile service. This section describes how you can use your Minute Manager menu to manage your mobile account. Since this service may not be available from your wireless service provider, the Minute Mgr. screen may not appear. Contact your service provider for details. Note: The actual invoice for calls and services from your service provider may vary, depending upon network features, rounding off for billing, taxes, and so forth.
CALL INFORMATION My charges You can view the current charges for all calls made this billing cycle, or you can view the charge for the last call you made. This information is approximate. The actual charges and minutes will be listed on your monthly bill. 1 2 From the menus, select Minute Mgr. > My calls > My charges. Select either Current or My last call. Note: If you exceed your Minute Manager limit, calls may only be possible to the emergency number programmed into your phone (for example, 911). From the menus, select Minute Mgr. > My calls > My minutes. Select either Minutes used or Package mins. My minutes You can check the minutes you have used in the current billing cycle, as well as the number of anytime minutes remaining in your plan package. This information is for regular plan minutes. It does not include information on long distance calls or SMS messages. 1 2 My data You can check the total number of SMS messages you have sent and received. This number includes any free messages provided by your plan. 1 2 From the menus, select Minute Mgr. > My calls > My data. Select either Messages sent or Msgs received. 48 Copyright Nokia 2003 Minute Manager
ACCOUNT INFORMATION You can check information on your current bill, spending limit, and rate plan. My bill Bill information is updated by your service provider and reflects the current amount owed. To view your current bill, select Minute Mgr. > My account > My bill. My bill date The bill date is the date when the next bill cycle starts. To view your bill date, select Minute Mgr. > My account > My bill date. My limit Your spending limit is set by your service provider during account activation and is independent of any balance information. To view your spending limit, select Minute Mgr. > My account > My limit. My rate plan To view information about your current rate plan, select Minute Mgr. > My account > My rate plan. My number To view your mobile number, select Minute Mgr. > My account > My number.
CUSTOMER CARE You can call the customer care number for your Minute Manager account. This is the same number you will call to make a payment. The customer care number may be preprogrammed in your phone. If not, contact your service provider for the number. Use this procedure to make a payment. 1 From the menus, select Minute Mgr. > Customer care > Make payment. The customer care number appears on the screen. Select Call to dial the number. 2 Nokia 2220 User Guide
Copyright Nokia 2003 14 Games
PLAY 1 2 From the menus, select Games. Select the desired game; then select one of the following options:
ContinueContinue a game that was stopped. New GameStart a new game. Level (Snake II and Pairs II only)Choose the difficulty level. Mazes (Snake II only)Choose among different maze designs. Top scoreDisplay the top score. InstructionsLearn how to play the game. Time trial (Pairs II only)To advance to the next level, you must pair up all tiles before the dynamite fuse runs out. Puzzle (Pairs II only)Reveal pictures to find pairs with as few tries as possible. Visit Nokia games services on the Internet for more hints and tips at:
www.nokia.com/us.
SETTINGS You can turn game sounds, lights, and vibration on or off. 1 2 3 From the menus, select Games > Settings. Select either Game sounds, Game lights, or Shakes. Select either On or Off. 50 Copyright Nokia 2003 Reference information 15 Reference information This section provides information about your phones batteries, accessories, chargers, safety guidelines and technical information. Be aware that the information in this section is subject to change as batteries, chargers, and accessories change.
BATTERY STATEMENTS Charging and discharging Your phone is powered by a rechargeable battery. Note that a new battery's full performance may be achieved only after two or three complete charge and discharge cycles!
The battery can be charged and discharged hundreds of times but it will eventually wear out. When the operating time (talk time and standby time) is noticeably shorter than normal, it is time to buy a new battery. Use only batteries approved by the phone manufacturer and recharge your battery only with the chargers approved by the manufacturer. Unplug the charger when not in use. Do not leave the battery connected to a charger for longer than a week, since overcharging may shorten its lifetime. If left unused, a fully charged battery will discharge itself over time. Temperature extremes can affect the ability of your battery to charge; allow it to cool down or warm up first. For good operation times with NiMH batteries, discharge the battery from time to time by leaving your phone switched on until it turns itself off (or by using the battery discharge facility of any approved accessory available for your phone). Do not attempt to discharge the battery by any other means. Use the battery only for its intended purpose. Never use any charger or battery which is damaged or worn out. Do not short-circuit the battery. Accidental short-circuiting can occur when a metallic object (coin, clip, or pen) causes direct connection of the + and - terminals of the battery (metal strips on the battery), for example, when you carry a spare battery in your pocket or purse. Short-circuiting the terminals may damage the battery or the connecting object. Leaving the battery in hot or cold places, such as in a closed car in summer or winter conditions, will reduce the capacity and lifetime of the battery. Always try to keep the battery between 59F and 77F (15C and 25C). A phone with a hot or cold battery may temporarily not work, even when the battery is fully charged. Batteries' performance is particularly limited in temperatures well below freezing. Nokia 2220 User Guide
Copyright Nokia 2003 Do not dispose of batteries in a fire!
Dispose of batteries according to applicable local regulations (for example, recycling). Do not dispose of as household waste. Note: For information on how to charge and recharge your battery, refer to Important battery information on page 7.
PROPER CARE AND MAINTENANCE Your phone is a product of superior design and craftsmanship and should be treated with care. The suggestions below will help you to fulfill any warranty obligations and to enjoy this product for many years:
Keep the phone and all its parts and accessories out of the reach of small children. Keep the phone dry. Precipitation, humidity and all types of liquids or moisture can contain minerals that will corrode electronic circuits. Do not use or store the phone in dusty, dirty areas. Its moving parts can be damaged. Do not store the phone in hot areas. High temperatures can shorten the life of electronic devices, damage batteries, and warp or melt certain plastics. Do not store the phone in cold areas. When it warms up (to its normal temperature), moisture can form inside and may damage electronic circuit boards. Do not attempt to open the phone. Nonexpert handling may damage it. Do not drop, knock, or shake the phone. Rough handling can break internal circuit boards. Do not use harsh chemicals, cleaning solvents, or strong detergents to clean the phone. Do not paint the phone. Paint can clog the moving parts and prevent proper operation.
Important: Use only the supplied or an approved replacement antenna. Unauthorized antennas, modifications, or attachments could damage the phone and may violate regulations governing radio devices. All of the above suggestions apply equally to your phone, battery, charger or any accessory. If any of them are not working properly, take them to your nearest qualified service facility. The personnel there will assist you, and if necessary, arrange for service. 52 Copyright Nokia 2003
IMPORTANT SAFETY INFORMATION Reference information This section provides additional safety information. A brief overview of safety can be found in For your safety on page 1. Traffic safety Do not use a hand-held telephone while driving a vehicle. Always secure the phone in its holder; do not place the phone on the passenger seat or where it can break loose in a collision or sudden stop. Remember road safety always comes first!
Operating environment Remember to follow any special regulations in force in any area and always switch off your phone whenever it is forbidden to use it, or when it may cause interference or danger. Use the phone only in its normal operating positions. Parts of the phone are magnetic. Metallic materials may be attracted to the phone, and persons with a hearing aid should not hold the phone to the ear with the hearing aid. Always secure the phone in its holder, because metallic materials may be attracted by the earpiece. Do not place credit cards or other magnetic storage media near the phone, because information stored on them may be erased. Electronic devices Most modern electronic equipment is shielded from radio frequency (RF) signals. However, certain electronic equipment may not be shielded against the RF signals from your wireless phone. PACEMAKERS Pacemaker manufacturers recommend that a minimum separation of 6 inches
(approximately 15.3 cm) be maintained between a hand-held wireless phone and a pacemaker to avoid potential interference with the pacemaker. These recommen-
dations are consistent with the independent research by and recommendations of Wireless Technology Research. Persons with pacemakers:
Should always keep the phone more than 6 inches (approximately 15.3 cm) from their pacemaker when the phone is switched on Should not carry the phone in a breast pocket Should use the ear opposite the pacemaker to minimize the potential for interference. If you have any reason to suspect that interference is taking place, switch off your phone immediately.
Nokia 2220 User Guide
Copyright Nokia 2003 HEARING AIDS Some digital wireless phones may interfere with some hearing aids. In the event of such interference, you may want to consult your service provider. Other medical devices Operation of any radio transmitting equipment, including cellular phones, may interfere with the functionality of inadequately protected medical devices. Consult a physician or the manufacturer of the medical device to determine if they are adequately shielded from external RF energy or if you have any questions. Switch off your phone in health care facilities when any regulations posted in these areas instruct you to do so. Hospitals or health care facilities may be using equipment that could be sensitive to external RF energy. Vehicles RF signals may affect improperly installed or inadequately shielded electronic systems in motor vehicles (for example, electronic fuel injection systems, electronic antiskid/
antilock braking systems, electronic speed control systems, air bag systems). Check with the manufacturer or its representative regarding your vehicle. You should also consult the manufacturer of any equipment that has been added to your vehicle. POSTED FACILITIES Switch your phone off in any facility where posted notices so require. Potentially explosive atmospheres Switch off your phone when in any area with a potentially explosive atmosphere and obey all signs and instructions. Sparks in such areas could cause an explosion or fire resulting in bodily injury or even death. Users are advised to switch off the phone when at a refuelling point (service station). Users are reminded of the need to observe restrictions on the use of radio equipment in fuel depots (fuel storage and distribution areas), chemical plants, or where blasting operations are in progress. Areas with a potentially explosive atmosphere are often but not always clearly marked. They include below deck on boats; chemical transfer or storage facilities;
vehicles using liquefied petroleum gas (such as propane or butane); areas where the air contains chemicals or particles, such as grain, dust, or metal powders; and any other area where you would normally be advised to turn off your vehicle engine. Vehicles Only qualified personnel should service the phone or install the phone in a vehicle. Faulty installation or service may be dangerous and may invalidate any warranty which may apply to the unit. 54 Copyright Nokia 2003 Reference information Check regularly that all wireless phone equipment in your vehicle is mounted and operating properly. Do not store or carry flammable liquids, gases or explosive materials in the same compartment as the phone, its parts or accessories. For vehicles equipped with an air bag, remember that an air bag inflates with great force. Do not place objects, including both installed or portable wireless equipment in the area over the air bag or in the air bag deployment area. If in-vehicle wireless equipment is improperly installed and the air bag inflates, serious injury could result. FCC regulations prohibit using your phone while in the air. Switch off your phone before boarding an aircraft. The use of wireless telephones in an aircraft may be dangerous to the operation of the aircraft, disrupt the wireless telephone network, and may be illegal. Failure to observe these instructions may lead to suspension or denial of telephone services to the offender, legal action or both.
MAKE EMERGENCY CALLS Important: This phone, like any wireless phone, operates using radio signals, wireless, and landline networks as well as user-programmed functions. Because of this, connections in all conditions cannot be guaranteed. Therefore you should never rely solely upon any wireless phone for essential communications (for example, medical emergencies). 3 Emergency calls may not be possible on all wireless phone networks or when certain network services and/or phone features are in use. Check with local service providers. To make an emergency call 1 2 If the phone is not on, switch it on, then check for adequate signal strength. Press the End key as many times as needed (for example, to exit a call, to exit a menu, etc.) to clear the display and ready the phone for calls. Key in the emergency number for your present location (for example, 911 or other official emergency number). Emergency numbers vary by location. Press the Talk key. 4 If certain features are in use, (Keyguard, etc.) you may first need to turn those features off before you can make an emergency call. Consult this user guide and your local wireless service provider. When making an emergency call, remember to give all the necessary information as accurately as possible. Remember that your wireless phone may be the only means of communication at the scene of an accidentdo not end the call until given permission to do so. Nokia 2220 User Guide
Copyright Nokia 2003 Certification Information (SAR) THIS MODEL PHONE MEETS THE GOVERNMENTS REQUIREMENTS FOR EXPOSURE TO RADIO WAVES. Your wireless phone is a radio transmitter and receiver. It is designed and manufactured not to exceed the emission limits for exposure to radio frequency (RF) energy set by the Federal Communications Commission of the U.S. Government. These limits are part of comprehensive guidelines and establish permitted levels of RF energy for the general population. The guidelines are based on standards that were developed by independent scientific organizations through periodic and thorough evaluation of scientific studies. The standards include a substantial safety margin designed to assure the safety of all persons, regardless of age and health. The exposure standard for wireless mobile phones employs a unit of measurement known as the Specific Absorption Rate, or SAR. The SAR limit set by the FCC is 1.6W/kg.* Tests for SAR are conducted using standard operating positions accepted by the FCC with the phone transmitting at its highest certified power level in all tested frequency bands. Although the SAR is determined at the highest certified power level, the actual SAR level of the phone while operating can be well below the maximum value. This is because the phone is designed to operate at multiple power levels so as to use only the power required to reach the network. In general, the closer you are to a wireless base station antenna, the lower the power output. Before a phone model is available for sale to the public, it must be tested and certified to the FCC that it does not exceed the limit established by the government-
adopted requirement for safe exposure. The tests are performed in positions and locations (for example, at the ear and worn on the body) as required by the FCC for each model. The following values are the highest SAR values for this model phone as reported to the FCC. When tested for use at the ear:
FCCID # GMLRH40 is 1.2 W/kg FCCID # GMLRH42 is 1.23 W/Kg When worn on the body as described in this user guide:
FCCID # GMLRH40 is 1.2 W/kg FCCID # GMLRH42 is 1.21 W/kg
(Body-worn measurements differ among phone models, depending upon available accessories and FCC requirements). While there may be differences between the SAR levels of various phones and at various positions, they all meet the government requirement. 56 Copyright Nokia 2003 Reference information The FCC has granted an Equipment Authorization for this model phone with all reported SAR levels evaluated as in compliance with the FCC RF exposure guidelines. SAR information on this model phone is on file with the FCC and can be found under the Display Grant section of http://www.fcc.gov/oet/fccid after searching on FCC ID GMLRH-40 and FCC ID GMLRH-42. For body worn operation, this phone has been tested and meets the FCC RF exposure guidelines for use with an accessory that contains no metal and that positions the handset a minimum of 5/8 inch (1.5 cm) from the body. Use of other accessories may not ensure compliance with FCC RF exposure guidelines. If you do not use a body-worn accessory and are not holding the phone at the ear, position the handset a minimum of 5/8 inch (1.5 cm) from your body when the phone is switched on.
*In the United States and Canada, the SAR limit for mobile phones used by the public is 1.6 watts/kilogram (W/kg) averaged over one gram of tissue. The standard incorporates a substantial margin of safety to give additional protection for the public and to account for any variations in measurements. SAR values may vary depending on national reporting requirements and the network band. For SAR information in other regions please look under product information at www.nokia.com/us. Nokia 2220 User Guide
Copyright Nokia 2003
ACCESSORY SAFETY This section provides information about phone batteries, chargers, and accessories. Be aware that the information in this section is subject to change as the batteries, chargers, and accessories change. Check the model number of any charger before use with this phone. This device is intended for use when supplied with power from an ACP-7U, ACP-8U, ACP-12U, or LCH-12 charger. Warning: Use only Nokia original accessories or batteries, chargers, and accessories approved by Nokia, for use with this Nokia phone model. The use of any other types may invalidate any approval or warranty applying to the phone, and may be dangerous. For availability of approved accessories, please check with your dealer. When you disconnect the power cord of any accessory, grasp and pull the plug, not the cord. When you are not using a charger, disconnect it from the power source. When the battery is running out of power and your phone only has a few minutes of talk time remaining, a warning tone sounds and the Battery low message appears briefly. When no more talk time is left, a warning tone is sounded and the phone switches itself off. Practical rules for accessory operation
When you disconnect the power cord of any accessory, grasp and pull the plug, Keep all accessories out of reach of small children.
not the cord. Check regularly that any vehicle-installed accessories are mounted and are operating properly. Installation of any complex car accessories must be made by qualified personnel only. Use only batteries, chargers, and accessories that have been approved by the phone manufacturer. The use of any other types could invalidate any approval or warranty applying to the phone and could be dangerous. Refer to Accessory safety on page 58 for important battery usage information. 58 Copyright Nokia 2003 Reference information Batteries This section provides information about the phone battery. Be aware that the information in this section is subject to change. Note: Dispose of used batteries in accordance with any local regulations. The tables shown in this section provide information about the batteries that are available for your phone, charging times with the Rapid Travel Charger (ACP-8U), the Travel Charger (ACP-12U), the Standard Travel Charger (ACP-7U), talk times, and standby times. Consult your service provider for more information. Charging times The charging times listed below are approximate. Battery option ACP-7U Charger ACP-8U Charger ACP-12U Charger 900-mAh BMC-3 NiMH battery Up to 4 hours Up to 2 hours Up to 1 hour, 40 minutes Standby and talk times Battery talk and standby times are estimates only and depend on signal strength, network conditions, features used, battery age and condition (including the effect of charging habits), temperatures to which the battery is exposed, use in digital mode, and many other factors. Please note that the amount of time a phone is used for calls will affect its standby time. Likewise, the amount of time that the phone is turned on and in standby mode will affect its talk time. Battery option 900-mAh BMC-3 NiMH battery 850-mAh BLC-2 Li-Ion battery Talk Time Standby Time Digital Analog Digital Analog Up to 5 hours Up to 2 hours Up to 15 days Up to 2 days Up to 5 hours Up to 2 hours Up to 16 days Up to 2 days Nokia 2220 User Guide
Copyright Nokia 2003
ACCESSORIES Warning: Use only Nokia original accessories, or batteries, chargers and accessories approved by Nokia, for use with this Nokia phone model. The use of any other types may invalidate any approval or warranty applying to the phone, and may be dangerous. Power
900-mAh NiMH Battery (BMC-3)
850-mAh Li-Ion Battery (BLC-2)
Standard Travel Charger (ACP-7U)
Rapid Travel Charger (ACP-8U)
Travel Charger (ACP-12U)
Mobile Charger (LCH-12)
Spare Battery Charger (DDC-1) is compatible with:
Standard Travel Charger (ACP-7U) Rapid Travel Charger (ACP-8U)
Desktop Charging Stand (DCV-10) is compatible with:
Standard Travel Charger (ACP-7U) Rapid Travel Charger (ACP-8U) Audio
Headset Kit (HDC-5)
Headset (HDE-2)
Boom Headset (HDB-5)
Retractable Headset (HDC-10)
Dual Headset (HDD-1)
Headrest Handsfree (BHF-2) Accessibility
TTY/TDD Adapter (HDA-9)
Loopset (LPS-3) Car
Mobile Holder (MBC-6)
Express Car Kit (CARK-125)
Full Car Kit (CARK-134)
NOKIA XPRESS-ON COLOR COVERS The Xpress-on cover is available in several fashion colors. Extra covers may be purchased from your authorized Nokia dealer. Note: Before changing the cover, always switch off the power and disconnect the phone from the charger or any other device. Always store the phone with covers attached. REMOVE THE BACK COVER 1 Switch off the power and disconnect the phone from the charger or any other device. Push in the release button on the back of the phone, slide the cover toward the top of the phone, and remove it. 2 60 Copyright Nokia 2003 Reference information REMOVE THE FRONT COVER 1 Use the finger rests on each side of the phone and hold the phone face down. 2 While holding the phone, place your finger on the groove between the phone 3 and the cover. Gently pry the front cover away from the phone and lift the phone out of the cover. Lift the keypad from the inside of the front cover. Place the keypad into the new front cover. REMOVE THE KEYPAD 1 2 REPLACE THE FRONT COVER 1 Slide the top of the phone into the top of the front cover. Be careful to align the Power key/IR port with its place in the top of the front cover. Gently push the bottom of the phone into the bottom of the front cover until it snaps into place. REPLACE THE BACK COVER 1 Insert the two catches of the back cover in the corresponding slots in the phone. Slide the cover towards the bottom of the phone until it locks into place. 2 2 Nokia 2220 User Guide
Copyright Nokia 2003
TECHNICAL INFORMATION Feature Specification Weight Volume Frequency range 4.23 oz with BLC-2 battery 5.17 oz with BMC-3 battery 108 cc 824.04848.97 MHz (TX) 869.04893.97 MHz (RX) Transmitter output power Up to 600 mW Battery voltage 3.6 V nominal Operating temperature
-4F to + 104F
(-20C to + 40C) Number of channels Phone numbers 832 Up to 3 Contact list locations Up to 200 62 Copyright Nokia 2003 Nokia One-Year Limited Warranty Reference information Nokia Inc. (Nokia) warrants that this cellular phone (Product) is free from defects in material and workmanship that result in Product failure during normal usage, according to the following terms and conditions:
1 The limited warranty for the Product extends for ONE (1) year beginning on the date of the purchase of the Product. This one year period is extended by each whole day that the Product is out of your possession for repair under this warranty. The limited warranty extends only to the original purchaser (Consumer) of the Product and is not assignable or transferable to any subsequent purchaser/
end-user. The limited warranty extends only to Consumers who purchase the Product in the United States of America. During the limited warranty period, Nokia will repair, or replace, at Nokias sole option, any defective parts, or any parts that will not properly operate for their intended use with new or refurbished replacement items if such repair or replacement is needed because of product malfunction or failure during normal usage. No charge will be made to the Consumer for any such parts. Nokia will also pay for the labor charges incurred by Nokia in repairing or replacing the defective parts. The limited warranty does not cover defects in appearance, cosmetic, decorative or structural items, including framing, and any non-operative parts. Nokias limit of liability under the limited warranty shall be the actual cash value of the Product at the time the Consumer returns the Product for repair, determined by the price paid by the Consumer for the Product less a reasonable amount for usage. Nokia shall not be liable for any other losses or damages. These remedies are the Consumers exclusive remedies for breach of warranty. Upon request from Nokia, the Consumer must prove the date of the original purchase of the Product by a dated bill of sale or dated itemized receipt. The Consumer shall bear the cost of shipping the Product to Nokia in Melbourne, Florida. Nokia shall bear the cost of shipping the Product back to the Consumer after the completion of service under this limited warranty. The Consumer shall have no coverage or benefits under this limited warranty if any of the following conditions are applicable:
a) The Product has been subjected to abnormal use, abnormal conditions, improper storage, exposure to moisture or dampness, unauthorized modifications, unauthorized connections, unauthorized repair, misuse, neglect, abuse, accident, alteration, improper installation, or other acts which are not the fault of Nokia, including damage caused by shipping. 2 3 4 5 6 7 Nokia 2220 User Guide
Copyright Nokia 2003 b) The Product has been damaged from external causes such as collision with an object, or from fire, flooding, sand, dirt, windstorm, lightning, earthquake or damage from exposure to weather conditions, an Act of God, or battery leakage, theft, blown fuse, or improper use of any electrical source, damage caused by computer or internet viruses, bugs, worms, Trojan Horses, cancelbots or damage caused by the connection to other products not recommended for interconnection by Nokia. c) Nokia was not advised in writing by the Consumer of the alleged defect d) e) or malfunction of the Product within fourteen (14) days after the expiration of the applicable limited warranty period. The Product serial number plate or the accessory data code has been removed, defaced or altered. The defect or damage was caused by the defective function of the cellular system or by inadequate signal reception by the external antenna, or viruses or other software problems introduced into the Product. 8 Nokia does not warrant uninterrupted or error-free operation of the Product. If a problem develops during the limited warranty period, the Consumer shall take the following step-by-step procedure:
a) The Consumer shall return the Product to the place of purchase for repair or replacement processing. If a is not convenient because of distance (more than 50 miles) or for other good cause, the Consumer shall ship the Product prepaid and insured to:
Nokia Inc., Attn: Repair Department 795 West Nasa Blvd. Melbourne, FL 32901 The Consumer shall include a return address, daytime phone number and/
or fax number, complete description of the problem, proof of purchase and service agreement (if applicable). Expenses related to removing the Product from an installation are not covered under this limited warranty. The Consumer will be billed for any parts or labor charges not covered by this limited warranty. The Consumer will be responsible for any expenses related to reinstallation of the Product. b) c) d) e) Nokia will repair the Product under the limited warranty within 30 days after receipt of the Product. If Nokia cannot perform repairs covered under this limited warranty within 30 days, or after a reasonable number of attempts to repair the same defect, Nokia at its option, will provide a replacement Product or refund the purchase price of the Product less a reasonable amount for usage. In some states the Consumer may have the right to a loaner if the repair of the Product takes more than ten (10) days. 64 Copyright Nokia 2003 Reference information f) Please contact the Customer Service Center at Nokia at the telephone number listed at the end of this warranty if you need a loaner and the repair of the Product has taken or is estimated to take more than ten
(10) days. If the Product is returned during the limited warranty period, but the problem with the Product is not covered under the terms and conditions of this limited warranty, the Consumer will be notified and given an estimate of the charges the Consumer must pay to have the Product repaired, with all shipping charges billed to the Consumer. If the estimate is refused, the Product will be returned freight collect. If the Product is returned after the expiration of the limited warranty period, Nokias normal service policies shall apply and the Consumer will be responsible for all shipping charges. 9 You (the Consumer) understand that the product may consist of refurbished equipment that contains used components, some of which have been reprocessed. The used components comply with Product performance and reliability specifications. 10 ANY IMPLIED WARRANTY OF MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE OR USE, SHALL BE LIMITED TO THE DURATION OF THE FOREGOING LIMITED WRITTEN WARRANTY. OTHERWISE, THE FOREGOING LIMITED WARRANTY IS THE CONSUMERS SOLE AND EXCLUSIVE REMEDY AND IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESS OR IMPLIED. NOKIA SHALL NOT BE LIABLE FOR SPECIAL, INCIDENTAL, PUNITIVE OR CONSEQUENTIAL DAMAGES, INCLUDING BUT NOT LIMITED TO LOSS OF ANTICIPATED BENEFITS OR PROFITS, LOSS OF SAVINGS OR REVENUE, LOSS OF DATA, PUNITIVE DAMAGES, LOSS OF USE OF THE PRODUCT OR ANY ASSOCIATED EQUIPMENT, COST OF CAPITAL, COST OF ANY SUBSTITUTE EQUIPMENT OR FACILITIES, DOWNTIME, THE CLAIMS OF ANY THIRD PARTIES, INCLUDING CUSTOMERS, AND INJURY TO PROPERTY, RESULTING FROM THE PURCHASE OR USE OF THE PRODUCT OR ARISING FROM BREACH OF THE WARRANTY, BREACH OF CONTRACT, NEGLIGENCE, STRICT TORT, OR ANY OTHER LEGAL OR EQUITABLE THEORY, EVEN IF NOKIA KNEW OF THE LIKELIHOOD OF SUCH DAMAGES. NOKIA SHALL NOT BE LIABLE FOR DELAY IN RENDERING SERVICE UNDER THE LIMITED WARRANTY, OR LOSS OF USE DURING THE PERIOD THAT THE PRODUCT IS BEING REPAIRED. 11 Some states do not allow limitation of how long an implied warranty lasts, so the one year warranty limitation may not apply to you (the Consumer). Some states do not allow the exclusion or limitation of incidental and consequential damages, so certain of the above limitations or exclusions may not apply to you
(the Consumer). This limited warranty gives the Consumer specific legal rights and the Consumer may also have other rights which vary from state to state. Nokia 2220 User Guide
Copyright Nokia 2003 12 Nokia neither assumes nor authorizes any authorized service center or any other person or entity to assume for it any other obligation or liability beyond that which is expressly provided for in this limited warranty including the provider or seller of any extended warranty or service agreement. 13 This is the entire warranty between the Nokia and the Consumer, and supersedes all prior and contemporaneous agreements or understandings, oral or written, relating to the Product, and no representation, promise or condition not contained herein shall modify these terms. 14 This limited warranty allocates the risk of failure of the Product between the Consumer and Nokia. The allocation is recognized by the Consumer and is reflected in the purchase price. 15 Any action or lawsuit for breach of warranty must be commenced within eighteen (18) months following purchase of the Product. 16 Questions concerning this limited warranty may be directed to:
Nokia Inc. Attn: Customer Service 7725 Woodland Center Blvd., Ste. 150 Tampa, FL 33614 Telephone: 1-888-NOKIA-2U (1-888-665-4228) Facsimile: (813) 287-6612 TTY/TDD Users Only: 1-800-24-NOKIA (1-800-246-6542) 17 The limited warranty period for Nokia supplied attachments and accessories is specifically defined within their own warranty cards and packaging. Manufactured or sold under one or more of the following US patents:
5001372 5045973 5101175 5124672 5212834 5230091 5233634 5241284 5241583 5266782 5317283 5335362 Pending:
5371481 5390223 5400949 5416435 5430740 5442521 5446364 5471655 5479476 5487084 5493255 5551067 29158527 5553125 5594797 5604921 5606548 5613235 5625274 5677620 5692032 5697074 5734683 5760568 5794142 29158526 5805084 5819165 5822366 5835858 5839101 5842141 5844884 5845219 5857151 5870683 5887262 5892475 29158528 5893060 5903839 5907823 5914796 5920826 5924026 5924038 5953665 5956625 5987406 5987639 5999523 29158485 6006114 6026161 6035194 6043760 6049796 6055439 6060193 6084962 6094587 6097961 6097964 6115617 29158529 6119002 6119003 6128509 6144243 6151485 6151507 6154457 6163609 6164547 6185295 6188909 6219560 29158524 6229996 6269331 6282373 6285888 6286122 6292668 6308084 6310609 6311054 6314166 6324412 66 Copyright Nokia 2003 Appendix A Message from the CTIA Appendix A Message from the CTIA
(Cellular Telecommunications
& Internet Association) to all users of mobile phones.
&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ$OO5LJKWV
5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
Nokia 2220 User Guide
Copyright 2003 Nokia 6DIHW\LVWKHPRVWLPSRUWDQWFDOO\RXZLOOHYHUPDNH
A Guide to Safe and Responsible Wireless Phone Use 7HQVRIPLOOLRQVRISHRSOHLQWKH86WRGD\WDNHDGYDQWDJHRIWKHXQLTXHFRPELQDWLRQ
RIFRQYHQLHQFHVDIHW\DQGYDOXHGHOLYHUHGE\WKHZLUHOHVVWHOHSKRQH4XLWHVLPSO\
WKHZLUHOHVVSKRQHJLYHVSHRSOHWKHSRZHUIXODELOLW\WRFRPPXQLFDWHE\YRLFHDOPRVW
DQ\ZKHUHDQ\WLPHZLWKWKHERVVZLWKDFOLHQWZLWKWKHNLGVZLWKHPHUJHQF\
SHUVRQQHORUHYHQZLWKWKHSROLFH(DFK\HDU$PHULFDQVPDNHELOOLRQVRIFDOOVIURP
WKHLUZLUHOHVVSKRQHVDQGWKHQXPEHUVDUHUDSLGO\JURZLQJ
%XWDQLPSRUWDQWUHVSRQVLELOLW\DFFRPSDQLHVWKRVHEHQHILWVRQHWKDWHYHU\ZLUHOHVV
SKRQHXVHUPXVWXSKROG:KHQGULYLQJDFDUGULYLQJLV\RXUILUVWUHVSRQVLELOLW\$
ZLUHOHVVSKRQHFDQEHDQLQYDOXDEOHWRROEXWJRRGMXGJPHQWPXVWEHH[HUFLVHGDW
DOOWLPHVZKLOHGULYLQJDPRWRUYHKLFOHZKHWKHURQWKHSKRQHRUQRW
7KHEDVLFOHVVRQVDUHRQHVZHDOOOHDUQHGDVWHHQDJHUV'ULYLQJUHTXLUHVDOHUWQHVV
FDXWLRQDQGFRXUWHV\,WUHTXLUHVDKHDY\GRVHRIEDVLFFRPPRQVHQVHNHHS\RXU
KHDGXSNHHS\RXUH\HVRQWKHURDGFKHFN\RXUPLUURUVIUHTXHQWO\DQGZDWFKRXW
IRURWKHUGULYHUV,WUHTXLUHVREH\LQJDOOWUDIILFVLJQVDQGVLJQDOVDQGVWD\LQJZLWKLQ
WKHVSHHGOLPLW,WPHDQVXVLQJVHDWEHOWVDQGUHTXLULQJRWKHUSDVVHQJHUVWRGRWKHVDPH
%XWZLWKZLUHOHVVSKRQHXVHGULYLQJVDIHO\PHDQVDOLWWOHPRUH7KLVEURFKXUHLVD
FDOOWRZLUHOHVVSKRQHXVHUVHYHU\ZKHUHWRPDNHVDIHW\WKHLUILUVWSULRULW\ZKHQEHKLQG
WKHZKHHORIDFDU:LUHOHVVWHOHFRPPXQLFDWLRQVLVNHHSLQJXVLQWRXFKVLPSOLI\LQJRXU
OLYHVSURWHFWLQJXVLQHPHUJHQFLHVDQGSURYLGLQJRSSRUWXQLWLHVWRKHOSRWKHUVLQQHHG
:KHQLWFRPHVWRWKHXVHRIZLUHOHVVSKRQHVVDIHW\LV\RXUPRVWLPSRUWDQWFDOO
Wireless Phone "Safety Tips"
%HORZDUHVDIHW\WLSVWRIROORZZKLOHGULYLQJDQGXVLQJDZLUHOHVVSKRQHZKLFK
VKRXOGEHHDV\WRUHPHPEHU
*HWWRNQRZ\RXUZLUHOHVVSKRQHDQGLWVIHDWXUHVVXFKDVVSHHGGLDODQGUHGLDO
&DUHIXOO\UHDG\RXULQVWUXFWLRQPDQXDODQGOHDUQWRWDNHDGYDQWDJHRIYDOXDEOH
IHDWXUHVPRVWSKRQHVRIIHULQFOXGLQJDXWRPDWLFUHGLDODQGPHPRU\$OVRZRUN
WRPHPRUL]HWKHSKRQHNH\SDGVR\RXFDQXVHWKHVSHHGGLDOIXQFWLRQZLWKRXW
WDNLQJ\RXUDWWHQWLRQRIIWKHURDG
:KHQDYDLODEOHXVHDKDQGVIUHHGHYLFH$QXPEHURIKDQGVIUHHZLUHOHVVSKRQH
DFFHVVRULHVDUHUHDGLO\DYDLODEOHWRGD\:KHWKHU\RXFKRRVHDQLQVWDOOHGPRXQWHG
GHYLFHIRU\RXUZLUHOHVVSKRQHRUDVSHDNHUSKRQHDFFHVVRU\WDNHDGYDQWDJHRI
WKHVHGHYLFHVLIDYDLODEOHWR\RX
3RVLWLRQ\RXUZLUHOHVVSKRQHZLWKLQHDV\UHDFK0DNHVXUH\RXSODFH\RXU
ZLUHOHVVSKRQHZLWKLQHDV\UHDFKDQGZKHUH\RXFDQJUDELWZLWKRXWUHPRYLQJ
\RXUH\HVIURPWKHURDG,I\RXJHWDQLQFRPLQJFDOODWDQLQFRQYHQLHQWWLPHLI
SRVVLEOHOHW\RXUYRLFHPDLODQVZHULWIRU\RX
68 Copyright 2003 Nokia Appendix A Message from the CTIA
6XVSHQGFRQYHUVDWLRQVGXULQJKD]DUGRXVGULYLQJFRQGLWLRQVRUVLWXDWLRQV/HW
WKHSHUVRQ\RXDUHVSHDNLQJZLWKNQRZ\RXDUHGULYLQJLIQHFHVVDU\VXVSHQGWKH
FDOOLQKHDY\WUDIILFRUKD]DUGRXVZHDWKHUFRQGLWLRQV5DLQVOHHWVQRZDQGLFH
FDQEHKD]DUGRXVEXWVRLVKHDY\WUDIILF$VDGULYHU\RXUILUVWUHVSRQVLELOLW\LV
WRSD\DWWHQWLRQWRWKHURDG
'RQRWWDNHQRWHVRUORRNXSSKRQHQXPEHUVZKLOHGULYLQJ,I\RXDUHUHDGLQJDQ
DGGUHVVERRNRUEXVLQHVVFDUGRUZULWLQJDWRGROLVWZKLOHGULYLQJDFDU\RX
DUHQRWZDWFKLQJZKHUH\RXDUHJRLQJ,WVFRPPRQVHQVH'RQWJHWFDXJKWLQD
GDQJHURXVVLWXDWLRQEHFDXVH\RXDUHUHDGLQJRUZULWLQJDQGQRWSD\LQJDWWHQWLRQ
WRWKHURDGRUQHDUE\YHKLFOHV
'LDOVHQVLEO\DQGDVVHVVWKHWUDIILFLISRVVLEOHSODFHFDOOVZKHQ\RXDUHQRWPRYLQJ
RUEHIRUHSXOOLQJLQWRWUDIILF7U\WRSODQ\RXUFDOOVEHIRUH\RXEHJLQ\RXUWULSRU
DWWHPSWWRFRLQFLGH\RXUFDOOVZLWKWLPHV\RXPD\EHVWRSSHGDWDVWRSVLJQUHG
OLJKWRURWKHUZLVHVWDWLRQDU\%XWLI\RXQHHGWRGLDOZKLOHGULYLQJIROORZWKLVVLPSOH
WLSGLDORQO\DIHZQXPEHUVFKHFNWKHURDGDQG\RXUPLUURUVWKHQFRQWLQXH
'RQRWHQJDJHLQVWUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVWKDWPD\EHGLVWUDFWLQJ
6WUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVDQGGULYLQJGRQRWPL[WKH\DUHGLVWUDFWLQJ
DQGHYHQGDQJHURXVZKHQ\RXDUHEHKLQGWKHZKHHORIDFDU0DNHSHRSOH\RX
DUHWDONLQJZLWKDZDUH\RXDUHGULYLQJDQGLIQHFHVVDU\VXVSHQGFRQYHUVDWLRQV
ZKLFKKDYHWKHSRWHQWLDOWRGLYHUW\RXUDWWHQWLRQIURPWKHURDG
8VH\RXUZLUHOHVVSKRQHWRFDOOIRUKHOS<RXUZLUHOHVVSKRQHLVRQHRIWKHJUHDWHVW
WRROV\RXFDQRZQWRSURWHFW\RXUVHOIDQG\RXUIDPLO\LQGDQJHURXVVLWXDWLRQV
ZLWK\RXUSKRQHDW\RXUVLGHKHOSLVRQO\WKUHHQXPEHUVDZD\'LDORURWKHU
ORFDOHPHUJHQF\QXPEHULQWKHFDVHRIILUHWUDIILFDFFLGHQWURDGKD]DUGRUPHGLFDO
HPHUJHQF\5HPHPEHULWLVDIUHHFDOORQ\RXUZLUHOHVVSKRQH
8VH\RXUZLUHOHVVSKRQHWRKHOSRWKHUVLQHPHUJHQFLHV<RXUZLUHOHVVSKRQHSURYLGHV
\RXDSHUIHFWRSSRUWXQLW\WREHD*RRG6DPDULWDQLQ\RXUFRPPXQLW\,I\RX
VHHDQDXWRDFFLGHQWFULPHLQSURJUHVVRURWKHUVHULRXVHPHUJHQF\ZKHUHOLYHV
DUHLQGDQJHUFDOORURWKHUORFDOHPHUJHQF\QXPEHUDV\RXZRXOGZDQW
RWKHUVWRGRIRU\RX
&DOOURDGVLGHDVVLVWDQFHRUDVSHFLDOZLUHOHVVQRQHPHUJHQF\DVVLVWDQFHQXPEHU
ZKHQQHFHVVDU\&HUWDLQVLWXDWLRQV\RXHQFRXQWHUZKLOHGULYLQJPD\UHTXLUH
DWWHQWLRQEXWDUHQRWXUJHQWHQRXJKWRPHULWDFDOOIRUHPHUJHQF\VHUYLFHV%XW
\RXVWLOOFDQXVH\RXUZLUHOHVVSKRQHWROHQGDKDQG,I\RXVHHDEURNHQGRZQ
YHKLFOHSRVLQJQRVHULRXVKD]DUGDEURNHQWUDIILFVLJQDODPLQRUWUDIILFDFFLGHQW
ZKHUHQRRQHDSSHDUVLQMXUHGRUDYHKLFOH\RXNQRZWREHVWROHQFDOOURDGVLGH
DVVLVWDQFHRURWKHUVSHFLDOQRQHPHUJHQF\ZLUHOHVVQXPEHU
&DUHOHVVGLVWUDFWHGLQGLYLGXDOVDQGSHRSOHGULYLQJLUUHVSRQVLEO\UHSUHVHQWDKD]DUG
WRHYHU\RQHRQWKHURDG6LQFHWKH&HOOXODU7HOHFRPPXQLFDWLRQV,QGXVWU\
$VVRFLDWLRQDQGWKHZLUHOHVVLQGXVWU\KDYHFRQGXFWHGHGXFDWLRQDORXWUHDFKWRLQIRUP
ZLUHOHVVSKRQHXVHUVRIWKHLUUHVSRQVLELOLWLHVDVVDIHGULYHUVDQGJRRGFLWL]HQV$VZH
DSSURDFKDQHZFHQWXU\PRUHDQGPRUHRIXVZLOOWDNHDGYDQWDJHRIWKHEHQHILWVRI
ZLUHOHVVWHOHSKRQHV$QGDVZHWDNHWRWKHURDGVZHDOOKDYHDUHVSRQVLELOLW\WR
GULYHVDIHO\
Nokia 2220 User Guide
Copyright 2003 Nokia 7KHZLUHOHVVLQGXVWU\UHPLQGV\RXWRXVH\RXUSKRQHVDIHO\ZKHQGULYLQJ
)RUPRUHLQIRUPDWLRQSOHDVHFDOO6$)(
)RUXSGDWHVKWWSZZZZRZFRPFRPFRQVXPHULVVXHVGULYLQJ
DUWLFOHVFIP",'
&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ$OO5LJKWV5HVHUYHG
&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
70 Copyright 2003 Nokia Appendix B Message from the FDA Appendix B Message from the FDA
(U.S. Food and Drug Administration) to all users of mobile phones.
-XO\
)RUXSGDWHVKWWSZZZIGDJRYFGUKSKRQHV Nokia 2220 User Guide
Copyright 2003 Nokia Consumer Update on Wireless Phones U.S. Food and Drug Administration 1. Do wireless phones pose a health hazard?
7KHDYDLODEOHVFLHQWLILFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPVDUH
DVVRFLDWHGZLWKXVLQJZLUHOHVVSKRQHV7KHUHLVQRSURRIKRZHYHUWKDWZLUHOHVV
SKRQHVDUHDEVROXWHO\VDIH:LUHOHVVSKRQHVHPLWORZOHYHOVRIUDGLRIUHTXHQF\
HQHUJ\5)LQWKHPLFURZDYHUDQJHZKLOHEHLQJXVHG7KH\DOVRHPLWYHU\ORZOHYHOV
RI5)ZKHQLQWKHVWDQGE\PRGH:KHUHDVKLJKOHYHOVRI5)FDQSURGXFHKHDOWK
HIIHFWVE\KHDWLQJWLVVXHH[SRVXUHWRORZOHYHO5)WKDWGRHVQRWSURGXFHKHDWLQJ
HIIHFWVFDXVHVQRNQRZQDGYHUVHKHDOWKHIIHFWV0DQ\VWXGLHVRIORZOHYHO5)
H[SRVXUHVKDYHQRWIRXQGDQ\ELRORJLFDOHIIHFWV6RPHVWXGLHVKDYHVXJJHVWHGWKDW
VRPHELRORJLFDOHIIHFWVPD\RFFXUEXWVXFKILQGLQJVKDYHQRWEHHQFRQILUPHGE\
DGGLWLRQDOUHVHDUFK,QVRPHFDVHVRWKHUUHVHDUFKHUVKDYHKDGGLIILFXOW\LQ
UHSURGXFLQJWKRVHVWXGLHVRULQGHWHUPLQLQJWKHUHDVRQVIRULQFRQVLVWHQWUHVXOWV
2. What is FDAs role concerning the safety of wireless phones?
8QGHUWKHODZ)'$GRHVQRWUHYLHZWKHVDIHW\RIUDGLDWLRQHPLWWLQJFRQVXPHU
SURGXFWVVXFKDVZLUHOHVVSKRQHVEHIRUHWKH\FDQEHVROGDVLWGRHVZLWKQHZGUXJV
RUPHGLFDOGHYLFHV+RZHYHUWKHDJHQF\KDVDXWKRULW\WRWDNHDFWLRQLIZLUHOHVV
SKRQHVDUHVKRZQWRHPLWUDGLRIUHTXHQF\HQHUJ\5)DWDOHYHOWKDWLVKD]DUGRXVWR
WKHXVHU,QVXFKDFDVH)'$FRXOGUHTXLUHWKHPDQXIDFWXUHUVRIZLUHOHVVSKRQHVWR
QRWLI\XVHUVRIWKHKHDOWKKD]DUGDQGWRUHSDLUUHSODFHRUUHFDOOWKHSKRQHVVRWKDW
WKHKD]DUGQRORQJHUH[LVWV
$OWKRXJKWKHH[LVWLQJVFLHQWLILFGDWDGRQRWMXVWLI\)'$UHJXODWRU\DFWLRQV)'$KDV
XUJHGWKHZLUHOHVVSKRQHLQGXVWU\WRWDNHDQXPEHURIVWHSVLQFOXGLQJWKHIROORZLQJ
6XSSRUWQHHGHGUHVHDUFKLQWRSRVVLEOHELRORJLFDOHIIHFWVRI5)RIWKHW\SH
HPLWWHGE\ZLUHOHVVSKRQHV
'HVLJQZLUHOHVVSKRQHVLQDZD\WKDWPLQLPL]HVDQ\5)H[SRVXUHWRWKHXVHU
WKDWLVQRWQHFHVVDU\IRUGHYLFHIXQFWLRQDQG
&RRSHUDWHLQSURYLGLQJXVHUVRIZLUHOHVVSKRQHVZLWKWKHEHVWSRVVLEOH
LQIRUPDWLRQRQSRVVLEOHHIIHFWVRIZLUHOHVVSKRQHXVHRQKXPDQKHDOWK
)'$EHORQJVWRDQLQWHUDJHQF\ZRUNLQJJURXSRIWKHIHGHUDODJHQFLHVWKDWKDYH
UHVSRQVLELOLW\IRUGLIIHUHQWDVSHFWVRI5)VDIHW\WRHQVXUHFRRUGLQDWHGHIIRUWVDWWKH
IHGHUDOOHYHO7KHIROORZLQJDJHQFLHVEHORQJWRWKLVZRUNLQJJURXS
1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ 1DWLRQDO7HOHFRPPXQLFDWLRQVDQG,QIRUPDWLRQ$GPLQLVWUDWLRQ 7KH1DWLRQDO,QVWLWXWHVRI+HDOWKSDUWLFLSDWHVLQVRPHLQWHUDJHQF\ZRUNLQJJURXS
DFWLYLWLHVDVZHOO
(QYLURQPHQWDO3URWHFWLRQ$JHQF\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ 72 Copyright 2003 Nokia Appendix B Message from the FDA
)'$VKDUHVUHJXODWRU\UHVSRQVLELOLWLHVIRUZLUHOHVVSKRQHVZLWKWKH)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQ)&&$OOSKRQHVWKDWDUHVROGLQWKH8QLWHG6WDWHV
PXVWFRPSO\ZLWK)&&VDIHW\JXLGHOLQHVWKDWOLPLW5)H[SRVXUH)&&UHOLHVRQ)'$
DQGRWKHUKHDOWKDJHQFLHVIRUVDIHW\TXHVWLRQVDERXWZLUHOHVVSKRQHV)&&DOVR
UHJXODWHVWKHEDVHVWDWLRQVWKDWWKHZLUHOHVVSKRQHQHWZRUNVUHO\XSRQ:KLOHWKHVH
EDVHVWDWLRQVRSHUDWHDWKLJKHUSRZHUWKDQGRWKHZLUHOHVVSKRQHVWKHPVHOYHVWKH
5)H[SRVXUHVWKDWSHRSOHJHWIURPWKHVHEDVHVWDWLRQVDUHW\SLFDOO\WKRXVDQGVRI
WLPHVORZHUWKDQWKRVHWKH\FDQJHWIURPZLUHOHVVSKRQHV%DVHVWDWLRQVDUHWKXVQRW
WKHVXEMHFWRIWKHVDIHW\TXHVWLRQVGLVFXVVHGLQWKLVGRFXPHQW
3. What kinds of phones are the subject of this update?
7KHWHUPZLUHOHVVSKRQHUHIHUVKHUHWRKDQGKHOGZLUHOHVVSKRQHVZLWKEXLOWLQ
DQWHQQDVRIWHQFDOOHGFHOOPRELOHRU3&6SKRQHV7KHVHW\SHVRIZLUHOHVVSKRQHV
FDQH[SRVHWKHXVHUWRPHDVXUDEOHUDGLRIUHTXHQF\HQHUJ\5)EHFDXVHRIWKHVKRUW
GLVWDQFHEHWZHHQWKHSKRQHDQGWKHXVHUVKHDG7KHVH5)H[SRVXUHVDUHOLPLWHGE\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQVDIHW\JXLGHOLQHVWKDWZHUHGHYHORSHGZLWK
WKHDGYLFHRI)'$DQGRWKHUIHGHUDOKHDOWKDQGVDIHW\DJHQFLHV:KHQWKHSKRQHLV
ORFDWHGDWJUHDWHUGLVWDQFHVIURPWKHXVHUWKHH[SRVXUHWR5)LVGUDVWLFDOO\ORZHU
EHFDXVHDSHUVRQ V5)H[SRVXUHGHFUHDVHVUDSLGO\ZLWKLQFUHDVLQJGLVWDQFHIURPWKH
VRXUFH7KHVRFDOOHGFRUGOHVVSKRQHVZKLFKKDYHDEDVHXQLWFRQQHFWHGWRWKH
WHOHSKRQHZLULQJLQDKRXVHW\SLFDOO\RSHUDWHDWIDUORZHUSRZHUOHYHOVDQGWKXV
SURGXFH5)H[SRVXUHVIDUEHORZWKH)&&VDIHW\OLPLWV
4. What are the results of the research done already?
7KHUHVHDUFKGRQHWKXVIDUKDVSURGXFHGFRQIOLFWLQJUHVXOWVDQGPDQ\VWXGLHVKDYH
VXIIHUHGIURPIODZVLQWKHLUUHVHDUFKPHWKRGV$QLPDOH[SHULPHQWVLQYHVWLJDWLQJWKH
HIIHFWVRIUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHVFKDUDFWHULVWLFRIZLUHOHVVSKRQHV
KDYH\LHOGHGFRQIOLFWLQJUHVXOWVWKDWRIWHQFDQQRWEHUHSHDWHGLQRWKHUODERUDWRULHV
$IHZDQLPDOVWXGLHVKRZHYHUKDYHVXJJHVWHGWKDWORZOHYHOVRI5)FRXOGDFFHOHUDWH
WKHGHYHORSPHQWRIFDQFHULQODERUDWRU\DQLPDOV+RZHYHUPDQ\RIWKHVWXGLHVWKDW
VKRZHGLQFUHDVHGWXPRUGHYHORSPHQWXVHGDQLPDOVWKDWKDGEHHQJHQHWLFDOO\
HQJLQHHUHGRUWUHDWHGZLWKFDQFHUFDXVLQJFKHPLFDOVVRDVWREHSUHGLVSRVHGWR
GHYHORSFDQFHULQWKHDEVHQFHRI5)H[SRVXUH2WKHUVWXGLHVH[SRVHGWKHDQLPDOVWR
5)IRUXSWRKRXUVSHUGD\7KHVHFRQGLWLRQVDUHQRWVLPLODUWRWKHFRQGLWLRQV
XQGHUZKLFKSHRSOHXVHZLUHOHVVSKRQHVVRZHGRQWNQRZZLWKFHUWDLQW\ZKDWWKH
UHVXOWVRIVXFKVWXGLHVPHDQIRUKXPDQKHDOWK
7KUHHODUJHHSLGHPLRORJ\VWXGLHVKDYHEHHQSXEOLVKHGVLQFH'HFHPEHU
%HWZHHQWKHPWKHVWXGLHVLQYHVWLJDWHGDQ\SRVVLEOHDVVRFLDWLRQEHWZHHQWKHXVH
RIZLUHOHVVSKRQHVDQGSULPDU\EUDLQFDQFHUJOLRPDPHQLQJLRPDRUDFRXVWLF
QHXURPDWXPRUVRIWKHEUDLQRUVDOLYDU\JODQGOHXNHPLDRURWKHUFDQFHUV
1RQHRIWKHVWXGLHVGHPRQVWUDWHGWKHH[LVWHQFHRIDQ\KDUPIXOKHDOWKHIIHFWV
IURPZLUHOHVVSKRQH5)H[SRVXUHV+RZHYHUQRQHRIWKHVWXGLHVFDQDQVZHU
TXHVWLRQVDERXWORQJWHUPH[SRVXUHVVLQFHWKHDYHUDJHSHULRGRISKRQHXVHLQ
WKHVHVWXGLHVZDVDURXQGWKUHH\HDUV
Nokia 2220 User Guide
Copyright 2003 Nokia 5. What research is needed to decide whether RF exposure from wireless phones poses a health risk?
$FRPELQDWLRQRIODERUDWRU\VWXGLHVDQGHSLGHPLRORJLFDOVWXGLHVRISHRSOHDFWXDOO\
XVLQJZLUHOHVVSKRQHVZRXOGSURYLGHVRPHRIWKHGDWDWKDWDUHQHHGHG/LIHWLPH
DQLPDOH[SRVXUHVWXGLHVFRXOGEHFRPSOHWHGLQDIHZ\HDUV+RZHYHUYHU\ODUJH
QXPEHUVRIDQLPDOVZRXOGEHQHHGHGWRSURYLGHUHOLDEOHSURRIRIDFDQFHUSURPRWLQJ
HIIHFWLIRQHH[LVWV(SLGHPLRORJLFDOVWXGLHVFDQSURYLGHGDWDWKDWLVGLUHFWO\DSSOLFDEOH
WRKXPDQSRSXODWLRQVEXWRUPRUH\HDUVIROORZXSPD\EHQHHGHGWRSURYLGH
DQVZHUVDERXWVRPHKHDOWKHIIHFWVVXFKDVFDQFHU7KLVLVEHFDXVHWKHLQWHUYDO
EHWZHHQWKHWLPHRIH[SRVXUHWRDFDQFHUFDXVLQJDJHQWDQGWKHWLPHWXPRUVGHYHORS
LIWKH\GRPD\EHPDQ\PDQ\\HDUV7KHLQWHUSUHWDWLRQRIHSLGHPLRORJLFDOVWXGLHV
LVKDPSHUHGE\GLIILFXOWLHVLQPHDVXULQJDFWXDO5)H[SRVXUHGXULQJGD\WRGD\XVH
RIZLUHOHVVSKRQHV0DQ\IDFWRUVDIIHFWWKLVPHDVXUHPHQWVXFKDVWKHDQJOHDW
ZKLFKWKHSKRQHLVKHOGRUZKLFKPRGHORISKRQHLVXVHG
6. What is FDA doing to find out more about the possible health effects of wireless phone RF?
)'$LVZRUNLQJZLWKWKH861DWLRQDO7R[LFRORJ\3URJUDPDQGZLWKJURXSVRI
LQYHVWLJDWRUVDURXQGWKHZRUOGWRHQVXUHWKDWKLJKSULRULW\DQLPDOVWXGLHVDUH
FRQGXFWHGWRDGGUHVVLPSRUWDQWTXHVWLRQVDERXWWKHHIIHFWVRIH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)
)'$KDVEHHQDOHDGLQJSDUWLFLSDQWLQWKH:RUOG+HDOWK2UJDQL]DWLRQ,QWHUQDWLRQDO
(OHFWURPDJQHWLF)LHOGV(0)3URMHFWVLQFHLWVLQFHSWLRQLQ$QLQIOXHQWLDOUHVXOW
RIWKLVZRUNKDVEHHQWKHGHYHORSPHQWRIDGHWDLOHGDJHQGDRIUHVHDUFKQHHGVWKDWKDV
GULYHQWKHHVWDEOLVKPHQWRIQHZUHVHDUFKSURJUDPVDURXQGWKHZRUOG7KH3URMHFWKDV
DOVRKHOSHGGHYHORSDVHULHVRISXEOLFLQIRUPDWLRQGRFXPHQWVRQ(0)LVVXHV
)'$DQGWKH&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ&7,$KDYHD
IRUPDO&RRSHUDWLYH5HVHDUFKDQG'HYHORSPHQW$JUHHPHQW&5$'$WRGRUHVHDUFK
RQZLUHOHVVSKRQHVDIHW\)'$SURYLGHVWKHVFLHQWLILFRYHUVLJKWREWDLQLQJLQSXWIURP
H[SHUWVLQJRYHUQPHQWLQGXVWU\DQGDFDGHPLFRUJDQL]DWLRQV&7,$IXQGHG
UHVHDUFKLVFRQGXFWHGWKURXJKFRQWUDFWVWRLQGHSHQGHQWLQYHVWLJDWRUV7KHLQLWLDO
UHVHDUFKZLOOLQFOXGHERWKODERUDWRU\VWXGLHVDQGVWXGLHVRIZLUHOHVVSKRQHXVHUV
7KH&5$'$ZLOODOVRLQFOXGHDEURDGDVVHVVPHQWRIDGGLWLRQDOUHVHDUFKQHHGVLQ
WKHFRQWH[WRIWKHODWHVWUHVHDUFKGHYHORSPHQWVDURXQGWKHZRUOG
7. How can I find out how much radiofrequency energy exposure I can get by using my wireless phone?
$OOSKRQHVVROGLQWKH8QLWHG6WDWHVPXVWFRPSO\ZLWK)HGHUDO&RPPXQLFDWLRQV
&RPPLVVLRQ)&&JXLGHOLQHVWKDWOLPLWUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHV
)&&HVWDEOLVKHGWKHVHJXLGHOLQHVLQFRQVXOWDWLRQZLWK)'$DQGWKHRWKHUIHGHUDO
KHDOWKDQGVDIHW\DJHQFLHV7KH)&&OLPLWIRU5)H[SRVXUHIURPZLUHOHVVWHOHSKRQHV
LVVHWDWD6SHFLILF$EVRUSWLRQ5DWH6$5RIZDWWVSHUNLORJUDP:NJ7KH
)&&OLPLWLVFRQVLVWHQWZLWKWKHVDIHW\VWDQGDUGVGHYHORSHGE\WKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLF(QJLQHHULQJ,(((DQGWKH1DWLRQDO&RXQFLORQ5DGLDWLRQ
3URWHFWLRQDQG0HDVXUHPHQW7KHH[SRVXUHOLPLWWDNHVLQWRFRQVLGHUDWLRQWKH
ERG\VDELOLW\WRUHPRYHKHDWIURPWKHWLVVXHVWKDWDEVRUEHQHUJ\IURPWKHZLUHOHVV
SKRQHDQGLVVHWZHOOEHORZOHYHOVNQRZQWRKDYHHIIHFWV
74 Copyright 2003 Nokia Appendix B Message from the FDA 0DQXIDFWXUHUVRIZLUHOHVVSKRQHVPXVWUHSRUWWKH5)H[SRVXUHOHYHOIRUHDFKPRGHO
RISKRQHWRWKH)&&7KH)&&ZHEVLWHKWWSZZZIFFJRYRHWUIVDIHW\JLYHV
GLUHFWLRQVIRUORFDWLQJWKH)&&LGHQWLILFDWLRQQXPEHURQ\RXUSKRQHVR\RXFDQILQG
\RXUSKRQHV5)H[SRVXUHOHYHOLQWKHRQOLQHOLVWLQJ
8. What has FDA done to measure the radiofrequency energy coming from wireless phones?
7KH,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((LVGHYHORSLQJDWHFKQLFDO
VWDQGDUGIRUPHDVXULQJWKHUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHIURPZLUHOHVV
SKRQHVDQGRWKHUZLUHOHVVKDQGVHWVZLWKWKHSDUWLFLSDWLRQDQGOHDGHUVKLSRI)'$
VFLHQWLVWVDQGHQJLQHHUV7KHVWDQGDUG5HFRPPHQGHG3UDFWLFHIRU'HWHUPLQLQJWKH
6SDWLDO3HDN6SHFLILF$EVRUSWLRQ5DWH6$5LQWKH+XPDQ%RG\'XHWR:LUHOHVV
&RPPXQLFDWLRQV'HYLFHV([SHULPHQWDO7HFKQLTXHVVHWVIRUWKWKHILUVWFRQVLVWHQW
WHVWPHWKRGRORJ\IRUPHDVXULQJWKHUDWHDWZKLFK5)LVGHSRVLWHGLQWKHKHDGVRI
ZLUHOHVVSKRQHXVHUV7KHWHVWPHWKRGXVHVDWLVVXHVLPXODWLQJPRGHORIWKHKXPDQ
KHDG6WDQGDUGL]HG6$5WHVWPHWKRGRORJ\LVH[SHFWHGWRJUHDWO\LPSURYHWKH
FRQVLVWHQF\RIPHDVXUHPHQWVPDGHDWGLIIHUHQWODERUDWRULHVRQWKHVDPHSKRQH
6$5LVWKHPHDVXUHPHQWRIWKHDPRXQWRIHQHUJ\DEVRUEHGLQWLVVXHHLWKHUE\WKH
ZKROHERG\RUDVPDOOSDUWRIWKHERG\,WLVPHDVXUHGLQZDWWVNJRUPLOOLZDWWVJ
RIPDWWHU7KLVPHDVXUHPHQWLVXVHGWRGHWHUPLQHZKHWKHUDZLUHOHVVSKRQH
FRPSOLHVZLWKVDIHW\JXLGHOLQHV
9. What steps can I take to reduce my exposure to radiofrequency energy from my wireless phone?
,IWKHUHLVDULVNIURPWKHVHSURGXFWVDQGDWWKLVSRLQWZHGRQRWNQRZWKDWWKHUH
LVLWLVSUREDEO\YHU\VPDOO%XWLI\RXDUHFRQFHUQHGDERXWDYRLGLQJHYHQSRWHQWLDO
ULVNV\RXFDQWDNHDIHZVLPSOHVWHSVWRPLQLPL]H\RXUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\5)6LQFHWLPHLVDNH\IDFWRULQKRZPXFKH[SRVXUHDSHUVRQUHFHLYHV
UHGXFLQJWKHDPRXQWRIWLPHVSHQWXVLQJDZLUHOHVVSKRQHZLOOUHGXFH5)H[SRVXUH
,I\RXPXVWFRQGXFWH[WHQGHGFRQYHUVDWLRQVE\ZLUHOHVVSKRQHHYHU\GD\\RXFRXOG
SODFHPRUHGLVWDQFHEHWZHHQ\RXUERG\DQGWKHVRXUFHRIWKH5)VLQFHWKHH[SRVXUH
OHYHOGURSVRIIGUDPDWLFDOO\ZLWKGLVWDQFH)RUH[DPSOH\RXFRXOGXVHDKHDGVHWDQG
FDUU\WKHZLUHOHVVSKRQHDZD\IURP\RXUERG\RUXVHDZLUHOHVVSKRQHFRQQHFWHGWR
DUHPRWHDQWHQQD
$JDLQWKHVFLHQWLILFGDWDGRQRWGHPRQVWUDWHWKDWZLUHOHVVSKRQHVDUHKDUPIXO
%XWLI\RXDUHFRQFHUQHGDERXWWKH5)H[SRVXUHIURPWKHVHSURGXFWV\RXFDQXVH
PHDVXUHVOLNHWKRVHGHVFULEHGDERYHWRUHGXFH\RXU5)H[SRVXUHIURPZLUHOHVV
SKRQHXVH
10. What about children using wireless phones?
7KHVFLHQWLILFHYLGHQFHGRHVQRWVKRZDGDQJHUWRXVHUVRIZLUHOHVVSKRQHVLQFOXGLQJ
FKLOGUHQDQGWHHQDJHUV,I\RXZDQWWRWDNHVWHSVWRORZHUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\5)WKHPHDVXUHVGHVFULEHGDERYHZRXOGDSSO\WRFKLOGUHQDQGWHHQDJHUV
XVLQJZLUHOHVVSKRQHV5HGXFLQJWKHWLPHRIZLUHOHVVSKRQHXVHDQGLQFUHDVLQJWKH
GLVWDQFHEHWZHHQWKHXVHUDQGWKH5)VRXUFHZLOOUHGXFH5)H[SRVXUH6RPHJURXSV
VSRQVRUHGE\RWKHUQDWLRQDOJRYHUQPHQWVKDYHDGYLVHGWKDWFKLOGUHQEHGLVFRXUDJHG
Nokia 2220 User Guide
Copyright 2003 Nokia IURPXVLQJZLUHOHVVSKRQHVDWDOO)RUH[DPSOHWKHJRYHUQPHQWLQWKH8QLWHG.LQJGRP
GLVWULEXWHGOHDIOHWVFRQWDLQLQJVXFKDUHFRPPHQGDWLRQLQ'HFHPEHU7KH\QRWHG
WKDWQRHYLGHQFHH[LVWVWKDWXVLQJDZLUHOHVVSKRQHFDXVHVEUDLQWXPRUVRURWKHULOO
HIIHFWV7KHLUUHFRPPHQGDWLRQWROLPLWZLUHOHVVSKRQHXVHE\FKLOGUHQZDVVWULFWO\
SUHFDXWLRQDU\LWZDVQRWEDVHGRQVFLHQWLILFHYLGHQFHWKDWDQ\KHDOWKKD]DUGH[LVWV
11. What about wireless phone interference with medical equipment?
5DGLRIUHTXHQF\HQHUJ\5)IURPZLUHOHVVSKRQHVFDQLQWHUDFWZLWKVRPHHOHFWURQLF
GHYLFHV)RUWKLVUHDVRQ)'$KHOSHGGHYHORSDGHWDLOHGWHVWPHWKRGWRPHDVXUH
HOHFWURPDJQHWLFLQWHUIHUHQFH(0,RILPSODQWHGFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUV
IURPZLUHOHVVWHOHSKRQHV7KLVWHVWPHWKRGLVQRZSDUWRIDVWDQGDUGVSRQVRUHGE\
WKH$VVRFLDWLRQIRUWKH$GYDQFHPHQWRI0HGLFDOLQVWUXPHQWDWLRQ$$0,7KH
ILQDOGUDIWDMRLQWHIIRUWE\)'$PHGLFDOGHYLFHPDQXIDFWXUHUVDQGPDQ\RWKHU
JURXSVZDVFRPSOHWHGLQODWH7KLVVWDQGDUGZLOODOORZPDQXIDFWXUHUVWR
HQVXUHWKDWFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVDUHVDIHIURPZLUHOHVVSKRQH(0,
)'$KDVWHVWHGKHDULQJDLGVIRULQWHUIHUHQFHIURPKDQGKHOGZLUHOHVVSKRQHVDQG
KHOSHGGHYHORSDYROXQWDU\VWDQGDUGVSRQVRUHGE\WKH,QVWLWXWHRI(OHFWULFDODQG
(OHFWURQLF(QJLQHHUV,(((7KLVVWDQGDUGVSHFLILHVWHVWPHWKRGVDQGSHUIRUPDQFH
UHTXLUHPHQWVIRUKHDULQJDLGVDQGZLUHOHVVSKRQHVVRWKDWQRLQWHUIHUHQFHRFFXUV
ZKHQDSHUVRQXVHVDFRPSDWLEOHSKRQHDQGDDFFRPSDQLHGKHDULQJDLGDWWKHVDPH
WLPH7KLVVWDQGDUGZDVDSSURYHGE\WKH,(((LQ
)'$FRQWLQXHVWRPRQLWRUWKHXVHRIZLUHOHVVSKRQHVIRUSRVVLEOHLQWHUDFWLRQVZLWK
RWKHUPHGLFDOGHYLFHV6KRXOGKDUPIXOLQWHUIHUHQFHEHIRXQGWRRFFXU)'$ZLOO
FRQGXFWWHVWLQJWRDVVHVVWKHLQWHUIHUHQFHDQGZRUNWRUHVROYHWKHSUREOHP
12. Where can I find additional information?
)RUDGGLWLRQDOLQIRUPDWLRQSOHDVHUHIHUWRWKHIROORZLQJUHVRXUFHV
)'$ZHESDJHRQZLUHOHVVSKRQHV KWWSZZZIGDJRYFGUKSKRQHVLQGH[KWPO
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&5)6DIHW\3URJUDP
KWWSZZZIFFJRYRHWUIVDIHW\
,QWHUQDWLRQDO&RPPLVVLRQRQ1RQ,RQL]LQJ5DGLDWLRQ3URWHFWLRQ KWWSZZZLFQLUSGH
:RUOG+HDOWK2UJDQL]DWLRQ:+2,QWHUQDWLRQDO(0)3URMHFW KWWSZZZZKRLQWHPI 1DWLRQDO5DGLRORJLFDO3URWHFWLRQ%RDUG8. KWWSZZZQUSERUJXN
-XO\)RUXSGDWHVKWWSZZZIGDJRYFGUKSKRQHV 76 Copyright 2003 Nokia Index Numerics 1-touch dialing 37 A accessibility 9 accessories reference information 60 safety information 58 settings 29 active call options 32 alarm clock 43 analog selection 40 antenna 5 archive folder 22 automatic redial 36 B back cover 6 battery charging 7 charging time 59 important information 7 initial charging 7 install 5 prolong life 8 reference information 58 remove 6 standby time 59 talk time 59 business cards 4445 C calculator 43 call answer 10 automatic redial 36 conference 33 duration 19 end 10 forwarding 34 log 18 make 10 redial last 10 silence 10 speed dialing 37 timers 19 touch tones 37 waiting 35 car kit 2930 change 1-touch dialing numbers 37 contact list view 17 earpiece volume 11 message alert tone 28 profile name 29 ringing tone 28 ringing volume 28 security code 41 time format 30 charge the battery 7 charger connect 7 information 58 clear call lists 18 clock 3031 clock, alarm 43 color covers 60 conference calls 33 Nokia 2220 User Guide
Copyright Nokia 2003 contact list 1617 Nokia 9 cover 6 currency conversion 44 customer care 9 D delete business cards 45 call lists 18 contact list entries 17 messages from folders 22 text messages 24 dialing. See call dictionary 14 digital selection 40 display language 30 download ringing tones 45 E e-mail messages 25 emergency calls making 55 with keypad locked 11 enter e-mail addresses 16 names and phone numbers 16 numbers 14 punctuation 15 text 1315 erase. See delete F feature code call forwarding 34 call waiting 35 folders 22 G games 50 H headset 8, 2930 help text 11 I icons 4 inbox 22 in-call options 32 in-phone help 11 K Keyguard 11 L label 9 language setting 30 lock/unlock the keypad 11 loopset 2930 M make a call. See call memory contact list 17 text message 24 menus 12 messages alert tone 28 check voice mail 20 e-mail 25 picture 24 read 23 save 24 text 2224 text entry 1315 write and send 22 78 Copyright Nokia 2003 Minute Manager 48 missed calls 18 N network search 39 Network Service 3 Nokia accessories 60 customer care center 9 warranty 63 O one-touch dialing 37 outbox 22 P personalization 27 phone illustrated iii menus 12 register 3 switch on/off 10 warranty 63 picture messages 24 power 10 predictive text 1415 prepaid services 4647 profiles accessory settings 29 customize 27 select 27 punctuation 15 R receive business cards 45 e-mail 25 picture message 25 ringing tone 45 text message 23 received calls 18 reference information 51 register your phone 3 ringing tones change 28 download 45 options 27 receive 45 save 45 volume 28 S save business cards 45 e-mail addresses 16 names and numbers 16 ringing tones 45 text messages 22 voice mailbox number 20 search for network 39 security code 41 send business cards 44 messages 22 special characters 15 standby time 59 start screen 5 strings, touch tone 38 T talk time 59 text entry 1315 messages 2224 predictive 1415 standard 13 Nokia 2220 User Guide
Copyright Nokia 2003 voice mail 20 volume earpiece 11 keypad tones 28 ringing 28 W warning tones 29 warranty 63 write and send a message 22 time 30 timers, call 19 touch tones 3738 turn the phone on/off 10 U user guide updates 3 V vibrating alert 28 view call duration 19 clock on start screen 31 dialed calls 18 missed calls 18 picture messages 25 received calls 18 received messages 23 Para obtener un manual del usuario en espaol favor de llamar o enviar un fax al telfono 1-888-NOKIA-2U, fax 813-249-9619. 07/03 80 Copyright Nokia 2003
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2004-01-22 | 824.04 ~ 848.97 | TNE - Licensed Non-Broadcast Transmitter Held to Ear | Class II permissive change or modification of presently authorized equipment |
2 | 2003-09-03 | 824.04 ~ 848.97 | TNE - Licensed Non-Broadcast Transmitter Held to Ear | |
3 | 2003-08-28 | 824.04 ~ 848.97 | TNE - Licensed Non-Broadcast Transmitter Held to Ear | Original Equipment |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 3 | Effective |
2004-01-22
|
||||
1 2 3 |
2003-09-03
|
|||||
1 2 3 |
2003-08-28
|
|||||
1 2 3 | Applicant's complete, legal business name |
Microsoft Corporation
|
||||
1 2 3 | FCC Registration Number (FRN) |
0005087978
|
||||
1 2 3 | Physical Address |
1 Microsoft Way
|
||||
1 2 3 |
Redmond, Washington 98052
|
|||||
1 2 3 |
United States
|
|||||
app s | TCB Information | |||||
1 2 3 | TCB Application Email Address |
h******@americanTCB.com
|
||||
1 2 3 |
h******@AmericanTCB.com
|
|||||
1 2 3 |
h******@americantcb.com
|
|||||
1 2 3 | TCB Scope |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
||||
app s | FCC ID | |||||
1 2 3 | Grantee Code |
GML
|
||||
1 2 3 | Equipment Product Code |
RH-42
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 3 | Name |
H****** S******
|
||||
1 2 3 | Title |
Director, EMC, SI and RF Compliance
|
||||
1 2 3 | Telephone Number |
425-7********
|
||||
1 2 3 | Fax Number |
425-7********
|
||||
1 2 3 |
h******@microsoft.com
|
|||||
app s | Technical Contact | |||||
1 2 3 | Firm Name |
Nokia Mobile Phones
|
||||
1 2 3 |
Nokia Corporation
|
|||||
1 2 3 | Name |
N**** W******
|
||||
1 2 3 | Physical Address |
6000 Connection Drive
|
||||
1 2 3 |
6000 Connection Drive, M/S 2:200
|
|||||
1 2 3 |
Irving, Texas 75039
|
|||||
1 2 3 |
United States
|
|||||
1 2 3 | Telephone Number |
972 8********
|
||||
1 2 3 |
972-8********
|
|||||
1 2 3 |
972-6********
|
|||||
1 2 3 | Fax Number |
972 8********
|
||||
1 2 3 |
972-8********
|
|||||
1 2 3 |
972-3********
|
|||||
1 2 3 |
n******@nokia.com
|
|||||
app s | Non Technical Contact | |||||
1 2 3 | Firm Name |
Nokia Mobile Phones
|
||||
1 2 3 | Name |
A**** E******
|
||||
1 2 3 | Physical Address |
6000 connection Drive, M/S 2:200
|
||||
1 2 3 |
Irving, Texas 75039
|
|||||
1 2 3 |
United States
|
|||||
1 2 3 | Telephone Number |
972-8********
|
||||
1 2 3 | Fax Number |
972-8********
|
||||
1 2 3 |
a******@nokia.com
|
|||||
app s | Confidentiality (long or short term) | |||||
1 2 3 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 | No | |||||
1 2 3 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 3 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 3 | Equipment Class | TNE - Licensed Non-Broadcast Transmitter Held to Ear | ||||
1 2 3 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | Nokia 2220 single band cellphone | ||||
1 2 3 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 2 3 | Modular Equipment Type | Does not apply | ||||
1 2 3 | Purpose / Application is for | Class II permissive change or modification of presently authorized equipment | ||||
1 2 3 | Original Equipment | |||||
1 2 3 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | No | ||||
1 2 3 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 3 | Grant Comments | Power Output is ERP. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and must provide at least 1.5cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Head: 1.23W/kg; Body-worn 1.21W/kg | ||||
1 2 3 | Power Output is ERP. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and must provide at least 1.5cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Head: 1.19W/kg; Body-worn 1.21W/kg | |||||
1 2 3 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 3 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 2 3 | Firm Name |
Nokia Mobile Phones
|
||||
1 2 3 | Name |
R******** L******
|
||||
1 2 3 | Telephone Number |
972-8********
|
||||
1 2 3 | Fax Number |
972-8********
|
||||
1 2 3 |
r******@nokia.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 22 | BC | 824.04 | 848.97 | 0.302 | 0.441 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
1 | 2 | 22 | BC | 824.04 | 848.97 | 0.302 | 0.441 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
1 | 3 | 22H | BC | 824.04 | 848.97 | 0.871 | 12 Hz | 30K0DXW | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 22 | BC | 824.04 | 848.97 | 0.302 | 0.441 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
2 | 2 | 22 | BC | 824.04 | 848.97 | 0.302 | 0.441 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
2 | 3 | 22.901(d) | BC | 824.04 | 848.97 | 0.871 | 12 Hz | 30K0DXW | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
3 | 1 | 22 | BC | 824.04 | 848.97 | 0.302 | 0.441 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
3 | 2 | 22 | BC | 824.04 | 848.97 | 0.302 | 0.441 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
3 | 3 | 22.901(d) | BC | 824.04 | 848.97 | 0.871 | 12 Hz | 30K0DXW |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC