| all | frequencies |
|
exhibits | applications |
|---|---|---|---|---|
| manual |
| app s | submitted / available | |||||||
|---|---|---|---|---|---|---|---|---|
| 1 |
|
Users Manual Revised | Users Manual | 3.46 MiB | ||||
| 1 | Attestation Statements | |||||||
| 1 | Internal Photos | |||||||
| 1 | Test Report | |||||||
| 1 | RF Exposure Info | |||||||
| 1 | Cover Letter(s) | |||||||
| 1 | Cover Letter(s) | |||||||
| 1 | Cover Letter(s) | |||||||
| 1 | External Photos | |||||||
| 1 | Operational Description | |||||||
| 1 | Internal Photos | |||||||
| 1 | ID Label/Location Info | |||||||
| 1 | Cover Letter(s) | |||||||
| 1 | Cover Letter(s) | |||||||
| 1 | Cover Letter(s) | |||||||
| 1 | RF Exposure Info | |||||||
| 1 | RF Exposure Info | |||||||
| 1 | ID Label/Location Info | |||||||
| 1 | Test Setup Photos | |||||||
| 1 | Test Setup Photos | |||||||
| 1 | Test Report | |||||||
| 1 | Test Report | |||||||
| 1 | Test Report | |||||||
| 1 | Test Report | |||||||
| 1 | RF Exposure Info |
| 1 | Users Manual Revised | Users Manual | 3.46 MiB |
2220_2260.ENv1_9356390_.book Page i Wednesday, May 28, 2003 4:10 PM User Guide for Nokia 2220/2260 Phone What information is needed?
My number Voice mail number Wireless providers number Providers customer care Model number Phone type Electronic serial number
(ESN) Numbers Where is the number?
Wireless service provider Wireless service provider Wireless service provider Wireless service provider Label on back of phone
(under battery). 2220 2260 RH-40 (for 2220) RH-39 (for 2260) Back of title page. Label on back of phone
(under battery). See Find your phones label on page 14. 2220_2260.ENv1_9356390_.book Page ii Wednesday, May 28, 2003 4:10 PM The wireless phone described in this guide is approved for use in the TDMA and AMPS networks. LEGAL INFORMATION Part No. 9356390, Issue No. 1a Copyright 2003 Nokia. All rights reserved. Nokia, Nokia Connecting People, the Nokia Original Accessories logos, Nokia 2220, Nokia 2260, Xpress-on, Pairs II, Space Impact and Snake II are trademarks or registered trademarks of Nokia. All other product and company names mentioned herein may be trademarks or tradenames of their respective owners Printed in Canada 05/2003, electronic file created 05/28/2003 US Patent No 5818437 and other pending patents. T9 text input software Copyright 1999-2003. Tegic Communications, Inc. All rights reserved. Includes RSA BSAFE cryptographic or security protocol software from RSA Security. The information contained in this user guide was written for the Nokia RH-39 phone and the Nokia RH-40 phone. Nokia operates a policy of continuous development. Nokia reserves the right to make changes and improvements to any of the products described in this document without prior notice. UNDER NO CIRCUMSTANCES SHALL NOKIA BE RESPONSIBLE FOR ANY LOSS OF DATA OR INCOME OR ANY SPECIAL, INCIDENTAL, AND CONSEQUENTIAL OR INDIRECT DAMAGES HOWSOEVER CAUSED. THE CONTENTS OF THIS DOCUMENT ARE PROVIDED AS IS. EXCEPT AS REQUIRED BY APPLICABLE LAW, NO WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE MADE IN RELATION TO THE ACCURACY AND RELIABILITY OR CONTENTS OF THIS DOCUMENT. NOKIA RESERVES THE RIGHT TO REVISE THIS DOCUMENT OR WITHDRAW IT AT ANY TIME WITHOUT PRIOR NOTICE. EXPORT CONTROLS This product contains commodities, technology or software exported from the United States in accordance with the Export Administration regulations. Diversion contrary to U.S. or Canadian law is prohibited. FCC/INDUSTRY CANADA NOTICE Your phone may cause TV or radio interference (for example, when using a telephone in close proximity to receiving equipment). The FCC or Industry Canada can require you to stop using your telephone if such interference cannot be eliminated. If you require assistance, contact your local service facility. This device complies with part 15 of the FCC rules. Operation is subject to the condition that this device does not cause harmful interference. 2220_2260.ENv1_9356390_.book Page iii Wednesday, May 28, 2003 4:10 PM Contents 1 For your safety . 1 2 Welcome and quick guide . 5 Get the most out of this guide . 5 Get started with the quick guide . 7 Understand wireless network services . 9 Register your phone . 9 E-newsletters . 9 The antenna . 10 The battery . 10 Set up your headset . 13 Get help . 14 3 Basic operations . 17 Switch your phone on or off . 17 Make and answer calls . 17 Check the start screen . 19 Check in-phone help . 20 Browse phone menus . 21 Contact list menu . 25 4 Text entry . 26 Standard text entry . 26 Spaces, punctuation, and special characters entry . 27 Predictive text . 29 5 Contact list . 31 Use contact list menus . 31 Save names, numbers, and e-mail addresses . 31 Recall names and numbers . 32 Edit a name or number . 33 Delete names and numbers . 33 Nokia 2220/2260 User Guide
LLL Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page iv Wednesday, May 28, 2003 4:10 PM Customize your contacts view . 34 Check memory status . 34 6 Call log . 35 Call log options . 35 Check missed calls . 36 Check received calls . 36 Check dialed calls . 36 Use call timers . 37 7 Messages . 38 Voice mail . 38 Text, e-mail, and picture messages . 39 Text messages . 42 Picture messages . 44 E-mail messages . 45 8 Personalization . 47 Profiles . 47 9 Advanced calling features . 54 Understand active-call options . 54 Use voice privacy . 56 Use call forwarding . 57 Use call waiting . 58 Use send own caller ID . 59 Select a phone number . 60 Use automatic redial . 60 Use 1-touch dialing . 61 Set touch tone strings . 61 Link contact list entries . 63 Select a system . 64 10 Security . 66 Use Keyguard . 66 iv Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page v Wednesday, May 28, 2003 4:10 PM Understand the security code . 67 Restrict calls . 67 11 Special features . 69 Use the alarm clock . 69 Use the calculator . 70 Business cards . 71 Download a ringing tone . 72 12 Prepaid services . 73 Manage prepaid service . 73 Check your prepaid balance . 73 Add money to your account . 74 Call customer service . 74 Save your access numbers . 74 Expiration date . 75 13 Games . 76 Start a new game . 76 Snake II . 77 Space impact . 77 Pairs II . 77 14 Minute Manager . 78 Check your call information . 78 Check your account information . 79 Customer care . 80 15 Reference information . 81 Battery statements . 81 Proper care and maintenance . 82 Important safety information . 83 Make emergency calls . 85 Accessory safety . 88 Accessories . 90 Nokia 2220/2260 User Guide
Y Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page vi Wednesday, May 28, 2003 4:10 PM Technical information . 97 Troubleshooting . 99 Nokia One-Year Limited Warranty . 100 Appendix A Message from the CTIA . 105 Appendix B Message from the FDA . 109 Index . 115 vi Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 1 Wednesday, May 28, 2003 4:10 PM 1 For your safety Read these simple guidelines. Breaking the rules may be dangerous or illegal. Further detailed information is given in this manual.. Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger. ROAD SAFETY COMES FIRST Dont use a hand-held phone while driving. INTERFERENCE All wireless phones may get interference, which could affect performance. SWITCH OFF IN HOSPITALS Follow any regulations or rules. Switch the phone off near medical equipment. SWITCH OFF IN AIRCRAFT Wireless devices can cause interference in aircraft. SWITCH OFF WHEN REFUELING Dont use the phone at a refueling point. Dont use near fuel or chemicals. SWITCH OFF NEAR BLASTING Dont use the phone where blasting is in progress. Observe restrictions, and follow any regulations or rules. USE SENSIBLY Use only in the normal position. Dont touch the antenna unnecessarily. QUALIFIED SERVICE Only qualified personnel may install or repair phone equipment. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 2 Wednesday, May 28, 2003 4:10 PM For your safety ACCESSORIES AND BATTERIES Use only approved accessories and batteries. Do not connect incompatible products. WATER-RESISTANCE Your wireless phone is not water-resistant. Keep it dry. CALLING Ensure the phone is switched on and in service. Enter the phone number, including the area code, then press the Talk key. To end a call, press the End key. To answer a call, press the Talk key. EMERGENCY CALLS Ensure the phone is switched on and in service. Press the End key as many times as needed (for example, to exit a call, to exit a menu) to clear the display. Enter the emergency number, then press the Talk key. Give your location. Do not end the call until told to do so. 2 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 3 Wednesday, May 28, 2003 4:10 PM NOTES Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 4 Wednesday, May 28, 2003 4:10 PM For your safety Nokia 2220/2260 phone at a glance Power key Earpiece Right selection key End key Number keys Pound key Display screen Scroll up key Left selection key Talk key Scroll down key Star key Connection port Microphone 4 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 5 Wednesday, May 28, 2003 4:10 PM 2 Welcome and quick guide Congratulations on your purchase of a Nokia mobile phone, a new tool for the mobile information society.
GET THE MOST OUT OF THIS GUIDE The diagram to the left illustrates the various components of your phone. Familiarize yourself with the diagram to help you better understand the instructions that follow. Understand the terms This guide uses certain terms for the steps that you are asked to perform.
Press means to briefly press, then release a key. For example, press 7 means press the key on the keypad that is labeled with the number 7 and the letters, p,q,r,s. Press and hold means to press and hold a key for two to three seconds
(depending on the feature being used), then release the key. Highlighted options on the screen are enclosed within a dark bar. The selection keys are used to act on the highlighted option. Selection keys are used to select a menu option, press the selection key below the menu item on the phones screen. In the example to the right, to select Menu, you would press the left selection key. To access the contact list, press Contacts
(the right selection key). Scroll keys are used to move up and down in the menus. For example, if instructed to scroll to another contact list entry, this means to press Scroll up or Scroll down key. The Talk key is used to place a call or to answer an incoming call. The End key is used to end a call or press and hold to return to the idle screen. Left Selection Right Selection Scroll down Scroll up Talk End
Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 6 Wednesday, May 28, 2003 4:10 PM Welcome and quick guide Notice text clues This user guide provides text clues to make instructions clear and easy to follow. Clue What it means bold Indicates one of the following items:
The word or phrase appears on the phones screen.
Special text, such as Notes and Warnings.
The name of one of the phone keys. bold and blue Indicates the text is an address on the World Wide Web. italic Italics indicate emphasis. Pay close attention to any information in italics. Follow graphic clues This guide uses icons (graphic clues) to alert you to important information. Tip: Information about a shortcut or an alternate method of doing something. Note: Explanation about a feature or an important concept. Important: Critical information about a feature. Caution: Help to avoid information loss. Warning: Help to avoid personal injury, damage to the phone, or property damage. Look for updates From time to time, Nokia updates this user guide to reflect changes or corrections. The latest version may be available at www.nokia.com/us. Also, an interactive tutorial may be available at www.nokiahowto.com. 6 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 7 Wednesday, May 28, 2003 4:10 PM
GET STARTED WITH THE QUICK GUIDE Make a call Enter phone number, press the Talk key. Answer a call Press the Talk key or Answer. Answer with call waiting Press the Talk key. End a call Silence a call Redial Adjust call volume Press the End key. Press the End key. Press the Talk key twice. During a call, press the Scroll up key to increase the volume or the Scroll down key to decrease the volume. Use the in-call menu In a call, press Options. Use 1-touch dialing Press and hold one of keys 2-9. Save a name and number Enter a number, press Save, enter a name, and press OK. Retrieve a name/number Press Contacts, select Find. Retrieve a name/number during a call Press Options, scroll New call, press Select, press Find, enter first letter of the name. Check voice mail Send a text message Send a business card Press and hold 1 or call your voice mailbox number. Press Menu 1-1. Write the message. Press Options (Send will be the first option), press Select, enter the recipients number, then press Send. Retrieve a name from the contact list, press Options, select Send bus. card, enter the recipients number, then press Send. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 8 Wednesday, May 28, 2003 4:10 PM Welcome and quick guide Send an e-mail message Read new message Press Menu 1-2. Enter the recipients address, press OK, enter the subject, press OK, write the message, press Options, scroll to Send, then press Select. (You may need to enter the gateway number your service provider gave you.) Press Read. If you have more than one message, scroll to the one you want, then press Read again. Reply to a message Press Options, scroll to Reply, then press Select. Reply to an E-mail message When reading the message, press Options, scroll to Reply, then press Select. 8 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 9 Wednesday, May 28, 2003 4:10 PM
UNDERSTAND WIRELESS NETWORK SERVICES The wireless phone described in this guide is approved for use on the TDMA and AMPS networks. A number of features included in this guide are called Network Services. These are special services you arrange through your wireless service provider. Before you can take advantage of any of these Network Services, you must subscribe to them through your service provider and obtain instructions for their use from your service provider. Note: Some networks may not support all language-dependent characters and/or services. Voice mail and voice privacy Call waiting, call forwarding, and caller ID Text, e-mail, and picture messages Ability to send your own number Network services for your Nokia phone include:
Sign up with a service provider Before you can use any network services, you must sign up with a wireless service provider. Your service provider will supply descriptions of special features and instructions for using their services.
REGISTER YOUR PHONE Make sure to register your phone at www.warranty.nokiausa.com or 1-888-NOKIA-2U
(1-888-665-4228) so that we can better serve you, if you should need to call the center or have your phone repaired.
E-NEWSLETTERS When you register your phone, you can sign up for Nokia's e-newsletter Nokia Connections if you would like. You will receive tips and tricks on using your phone, accessory information, and special offers. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 10 Wednesday, May 28, 2003 4:10 PM Welcome and quick guide
THE ANTENNA Tip: Your phone has a built-in antenna. As with any other radio transmitting device, do not touch the antenna unnecessarily when the phone is switched on. Contact with the antenna affects call quality and may cause the phone to operate at a higher power level than otherwise needed. Not touching the antenna area during a phone call optimizes the antenna performance and the talk-time of your phone. Normal position: Hold the phone as you would any other telephone with the antenna pointed up and over your shoulder.
THE BATTERY This section tells you how to install and remove the battery. You will need to remove the battery when replacing it, or to view the phones label (located under the battery). For important safety information on using batteries and chargers, see Accessory safety on page 88. Install the battery 1 Place the battery in the compartment with the label side facing up and the golden contact area of the battery aligned with the contact prongs inside the phone. Press down on the battery until it snaps into place. 2 1 2 10 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 11 Wednesday, May 28, 2003 4:10 PM 3 4 Align the cover over the back of the phone, placing the end of the cover approximately 1/4 inch past the end of the phone. Lower the back cover onto the phone. 1/4 inch Press down slightly and slide the cover until it locks into place. Remove the battery If you purchase a new battery or need to access information on the phones label, you may need to remove the battery. Make sure the phone has been turned off for at least 10 seconds. Important: Dispose of batteries according to applicable local regulations
(for example, recycling). Do not dispose as household waste. 1 2 Hold the phone with the back facing you. At the bottom corners of the phone, press the battery cover with your thumb and forefinger. Place the thumb of your other hand in the groove, approximately 1 inch from the top of the phone. Apply pressure with the thumb, slide the back cover toward you to release it, then remove it. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 12 Wednesday, May 28, 2003 4:10 PM Welcome and quick guide 3 4 5 Look for the battery latch that runs along the end of the battery nearest the top of the phone. Place your thumbs on the corners of the latch and press away from the battery. Once the battery is released from the latch, it will lift slightly so that it can be removed from the phone. Warning: Use only your hands to remove the battery. Do not use any objects that may damage the phone or the battery. Charge the battery Before you begin using your phone, you need to prepare your phone by charging the battery. 1 Plug the charger into a standard wall outlet, then connect the lead from the charger to the bottom of the phone. The battery power indicator (or battery bar) appears on the screen and starts scrolling. Charging appears if the phone is on. 2 3 When the battery bar stops scrolling, the battery charge is complete. Battery full appears if the phone is on. 4 Disconnect the charger from the phone. IMPORTANT BATTERY INFORMATION Use the following guidelines to obtain the best performance from your battery:
With your phone turned off, charge your new battery for three hours before its first use. Use the battery until it is fully discharged. Repeat this procedure twice for a total of three charging cycles. Battery operation time may be less than the estimated times during the first charges. This condition is normal. If the battery is fully discharged, the scrolling bars may not appear immediately when charging. After the first charge, you can make and receive calls during the charging cycle, but the calls interrupt the charge. When the phone call ends, the charge will resume.
12 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 13 Wednesday, May 28, 2003 4:10 PM
The bars on the screen stop scrolling and remain constant when the phone is charged. If you leave the phone connected to the charger, the battery receives an additional charge. Note: The battery will accept a trickle charge for an additional two hours. See Reference information on page 81 for more information on batteries. Charging time depends on the charger and battery used. See Batteries on page 89 for charging, talk, and standby times. PROLONG BATTERY LIFE For good operation times with NiMH batteries, discharge the battery from time to time by leaving your phone switched on until it turns itself off. Ignore any messages to recharge your battery and let the battery completely discharge. Important: Do not attempt to discharge the battery by any other means.
SET UP YOUR HEADSET Your phone is compatible with the HDC-5, HDC-10, HDE-2, and HDB-5 headsets. The headset provides convenient, hands-free use of the phone. Connect the headset 1 2 Plug the headset plug into the bottom of your phone. Put the round ear plug into one ear. Use the headset With the headset connected, you can make and answer calls as usual. The microphone for the headset hangs at the side of your head. Although the microphone may seem far from your mouth, you can speak at a normal volume. Note: You can set your phone to answer automatically when the headset is connected. See Automatic answer on page 51 for more information. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 14 Wednesday, May 28, 2003 4:10 PM Welcome and quick guide
GET HELP Find your phones label When you call the Nokia Customer Care Center or your service provider, you will need to provide specific information about your phone. This information is recorded on the phones type label. The type label is located under the battery inside the phones back cover. It contains the model and serial numbers as well as other important information about your phone. Please do not remove or deface the label. Contact Nokia If you have a question and have already checked the Troubleshooting section
(see page 99), we recommend that you have the following information available before contacting the Nokia Customer Care Center or your service provider:
Nokia 2220 phone (single band) Nokia 2260 phone (dual band) Your phones model number
ESN (Electronic serial number located on the label under the battery) Your billing address ZIP code The phone or accessory in question
Nokia Customer Care Center, USA Customer Care Centre, Canada Nokia Mobile Phones 7725 Woodland Center Blvd. Suite #150 Tampa, Florida 33614 Nokia Products Ltd. 601 Westney Road South Ajax, Ontario L1S 4N7 Tel: 1-888-NOKIA-2U
(1-888-665-4228) Fax: 1-813-249-9619 For TTY/TDD users: 1-800-24-NOKIA
(1-800-246-6542) Tel: 1-888-22-NOKIA
(1-888-226-6542) Fax: 1-905-427-1070 Web site: www.nokia.ca Contact your service provider You may want to save your service providers customer support telephone number into your phone. This will let you easily contact your provider if you have questions or issues with your phone service. 14 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 15 Wednesday, May 28, 2003 4:10 PM Receive accessibility information Nokia is committed to making mobile phones easy to use for all individuals, including those with disabilities. Nokia maintains an internet site that is dedicated to accessibility solutions. For more information about phone features, accessories and other Nokia products designed with your needs in mind, visit the web site at:
www.nokiaaccessibility.com LPS-3 MOBILE INDUCTIVE LOOPSET The LPS-3 Loopset is a Nokia accessory designed to make the phone more accessible to hearing-aid users. The loopset gives hearing-aid users clear access to digital telephony for the first time. It allows people with T-coil equipped hearing aids to make and receive calls without noise interference. To activate the Loopset, see Accessory settings on page 50. Note: The loopset is sold separately as an accessory to the phone. HOW THE LOOPSET WORKS The LPS-3 Loopset uses inductive technology to transmit sound to a hearing aid equipped with a T-coil. The sound from the phone is amplified more efficiently and background noise is eliminated. The loopset is easy to use. Wear the loopset around your neck, connect it to your phone, and speak directly toward the microphone. For detailed instructions on using the loopset, refer to the booklet that comes with the LPS-3. Set up the TTY/TDD profile You can connect your phone to a TTY/TDD using the Nokia TTY/TDD Adapter (HDA-9). In order for your phone to recognize the TTY/TDD, you will need to connect the adapter to your phone. Important: Some manufacturers of TTY/TDD devices suggest that the phone be least 18 inches from the TTY/TDD device. When connecting to any other device, read its user guide or contact its manufacturer for detailed instructions and safety information. 1 Connect the TTY/TDD with a cable to the HDA-9 adapter. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 16 Wednesday, May 28, 2003 4:10 PM Welcome and quick guide Plug the HDA-9 adapter into the connector on the bottom of your phone, as shown in the illustration. 2
. 18 Press Menu 4-4-4-1 (Settings > Accessory settings > TTY/TDD > Use TTY). 3 4 Scroll to Yes, then press Select. NOTES ABOUT TTY/TDD CALLS
The Nokia TTY/TDD Adapter (HDA-9) is for use with compatible TTY/TDD devices only. Check with the manufacturer of the TTY/TDD device to ensure that the connection is compatible. Check with the manufacturer of the TTY/TDD device for the appropriate connecting cable. TTY/TDD communications depend on network availability. Check with your service provider for availability and description of services.
MAKE A TTY/TDD CALL Tip: Before making a TTY/TDD call with your phone, check the signal strength. See Understand indicators and icons on page 19 for details. From the start screen, enter the number, and press the Talk key. 1 2 When the receiving party answers, begin typing your conversation on the TTY/TDD. RECEIVE A TTY/TDD CALL 1 Make sure the TTY/TDD device is connected to your phone. 2 END A TTY/TDD CALL Press the End key. Press the Talk key to answer the call, then type your responses on the TTY\TDD. 16 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 17 Wednesday, May 28, 2003 4:10 PM 3 Basic operations This section gives a brief introduction to the phone and shows quick steps for:
Making and answering calls
You will also find information about the phones icons and how to use in-phone help. The rest of this guide provides complete details on phone use. Adjusting the earpiece volume Navigating through menus Using menu shortcuts
SWITCH YOUR PHONE ON OR OFF Warning: Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger. To switch on your phone, press and hold the power key for 2 seconds. To switch off your phone.
OR
Press the power key quickly. When Switch off! is highlighted on the screen, press Select. Press and hold the power key.
MAKE AND ANSWER CALLS Power key There are several ways to make and answer calls on your phone. Once learning about the basic methods, you will discover other tips throughout this guide when reading about the phones features. Use the keypad 1 Enter the phone number, including the area code if needed. Press the Talk key. 2 Important: Do not touch the antenna when the phone is switched on. Contact with the antenna affects call quality and may cause the phone to operate at a higher power level than otherwise needed. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 18 Wednesday, May 28, 2003 4:10 PM Basic operations Use the contact list 1 From the start screen, press the Scroll up or Scroll down key and scroll to the number you want. Press the Talk key to make the call. 2 Tip: To skip ahead quickly in the list, press the number key that has the first letter of the name. You may have to press the key more than once to get to the correct letter. Make a 1-touch dial call Press and hold the key assigned to the number you wish to call. To learn how to store a number for use with 1-touch dialing see Assign a key to 1-touch dialing on page 61. End a call Press the End key to end the call or to cancel the call attempt. Answer a call When your phone rings, press the Talk key. You can press any key to answer a call except the power key, end key, or the scroll keys. Note: If Keyguard is active, the keypad will unlock when you have an incoming call. Silence an incoming call Press the End key or Silent to mute the ringing of an incoming call. Redial the last-dialed number Press the Talk key twice. Adjust the earpiece volume Adjust the earpiece volume during a call by pressing the scroll keys located just below the screen.
Press the Scroll up key to increase the volume. Press the Scroll down key to decrease the volume. 18 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 19 Wednesday, May 28, 2003 4:10 PM
CHECK THE START SCREEN When you switch on your phone, a welcome appears, then you see the start screen. The start screen appears when the phone is idling or standing by. Understand the Scroll Bar When you press Menu, a vertical scroll bar appears on the right side of the screen. This scroll bar has a tab which moves up or down to indicate your location in the menu. Start screen Scroll bar Understand indicators and icons You have two types of identifiers on your phone:
Indicators show the status of something. The phone uses three types of indicators:
signal strength, battery power and handset volume. Icons are graphical representations of a specific item or situation. For example, an icon appears when you have a voice message in your mailbox. Indicators Signal strength indicator Battery power indicator
Signal strength shows the signal strength of the wireless network at your current location. The higher the bar, the stronger the signal. Battery power shows the battery charge level. The higher the bar, the more power in the battery. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 20 Wednesday, May 28, 2003 4:10 PM Basic operations Icons Screen Icon What it means Active call in progress. Silent has been selected as the current profile. The phones keypad is locked to prevent any accidental key presses. One (or more) new voice messages waiting. One or more new text messages waiting. (If blinking, the text message memory is full.) Digital service is available. Standard text input mode for entering alpha characters. Press to switch between uppercase and lowercase input. Predictive text mode for quickly entering text messages. Press # to switch between uppercase and lowercase input. 123 mode. This icon appears when you press and hold # while entering text. You can now enter only numbers (not alpha characters). Press and hold # again to return to text entry mode. Special character mode. This appears when you press * while entering text. Once the characters appear, you can select a special character by selecting Insert. Alarm clock is set.
CHECK IN-PHONE HELP Many menu items have brief help text. To view the help text, scroll to the menu item and wait for about 15 seconds. Press More or the Scroll down key to continue reading the text. Press Back to exit or wait a few seconds to return to the current menu. 20 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 21 Wednesday, May 28, 2003 4:10 PM
BROWSE PHONE MENUS A menu is a list of choices you can make to change settings on your phone or use various phone features. Each menu can contain several levels of submenus. You can use menus and submenus two ways: by scrolling or by using a shortcut. This guide uses the shortcut method when describing how to use the phones features. Scroll through menus 1 At the start screen, press Menu, then scroll through the menus using the Scroll up and Scroll down keys. Use the scroll and selection keys to navigate the submenus; press the End key to return to the start screen. For example, when you see (Profiles > Silent) the scrolling method is: press Menu, scroll to Profiles and press Select, scroll to Silent and press Options. 2 Return to the previous menu level You can return to the previous menu level by pressing the selection key labeled Exit or Back. Return to the start screen from any menu level by pressing the End key. Use shortcuts Menus and options are numbered so that you can quickly find your way to an option. The numbers appear in the top right corner of the screen and show your location in the menu. 1 2 Within 3 seconds, enter the first number of the menu function you want Press Menu. 3 to access. Repeat until you have entered all the numbers. For example, to select the Silent profile, press Menu 3-2-1. MENU TIPS
You can scroll upward to quickly access the last option in a menu list.
You can return to the previous menu level by pressing Back.
To exit a menu and return to the start screen, press the End key. If you leave a menu by pressing the End key, you cancel any changes you made.
Some menus may not appear. Ask your service provider for details. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 22 Wednesday, May 28, 2003 4:10 PM Basic operations Menu shortcuts 1 MESSAGES 3 PROFILES 1 Write message . 1-1 2 Write e-mail . 1-2 3 Inbox . 1-3 4 Outbox . 1-4 5 Archive . 1-5 6 Delete all. 1-6 7 Picture messages . 1-7 8 Voice messages. 1-8 1 Listen to voice messages . 1-8-1 2 Voice mailbox number . 1-8-2 2 CALL LOG 1 Missed calls . 2-1 2 Received calls . 2-2 3 Dialed calls . 2-3 4 Clear call lists . 2-4 1 All . 2-4-1 2 Missed. 2-4-2 3 Received . 2-4-3 4 Dialed . 2-4-4 5 Call timers. 2-5 1 Duration of last call. 2-5-1 2 Duration of all calls . 2-5-2 3 Clear timers . 2-5-3 1 Normal. 3-1 1 Select . 3-1-1 2 Customize . 3-1-2 1 Ringing options . 3-1-2-1 2 Ringing tone. 3-1-2-2 3 Ringing volume . 3-1-2-3 4 Vibrating alert . 3-1-2-4 5 Message alert tone. 3-1-2-5 6 Keypad tones . 3-1-2-6 7 Warning tones . 3-1-2-7 8 Profile name1 2 Silent . 3-2 1 Select . 3-2-1 2 Customize . 3-2-2 3 Meeting . 3-3 1 Select . 3-3-1 2 Customize . 3-3-2 4 Outdoor . 3-4 1 Select . 3-4-1 2 Customize . 3-4-2 5 Pager . 3-5 1 Select . 3-5-1 2 Customize . 3-5-2 1 The Profile name option is available for Silent, Meeting, Outdoor and Pager. The Normal profile cannot be renamed. 22 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 23 Wednesday, May 28, 2003 4:10 PM 6 Network services . 4-6 1 Voice privacy . 4-6-1 2 Call forwarding 2 . 4-6-2 3 Call waiting 2 . 4-6-3 4 Send own caller ID 2. 4-6-4 5 Network feature setting . 4-6-5 6 Own number selection 4-6-6 2 Call forwarding, call waiting and send own caller ID are network-dependent features. In some networks, the codes for these features must be activated and these sub menus will not appear until they are activated. 5 SYSTEM 1 Automatic . 5-1 2 Manual . 5-2 3 New search . 5-3 6 GAMES 1 Snake II. 6-1 2 Space Impact . 6-2 3 Pairs II. 6-3 4 Settings . 6-4 7 CALCULATOR 4 SETTINGS 1 Time settings . 4-1 1 Alarm clock . 4-1-1 1 On . 4-1-1-1 2 Off . 4-1-1-2 2 Clock . 4-1-2 1 Show/Hide clock. 4-1-2-1 2 Set the time . 4-1-2-2 3 Time format . 4-1-2-3 3 Auto-update of time. 4-1-3 2 Call settings . 4-2 1 Automatic redial . 4-2-1 2 Current call timer . 4-2-2 3 Phone settings . 4-3 1 Language . 4-3-1 2 Touch tones . 4-3-2 1 Manual touch tones . 4-3-2-1 2 Touch tone length 4-3-2-2 3 Welcome note . 4-3-3 4 Restore factory settings . 4-3-4 4 Accessory settings1 . 4-4 1 Headset . 4-4-1 2 Handsfree . 4-4-2 3 Loopset . 4-4-3 4 TTY/TDD . 4-4-4 5 Security settings . 4-5 1 Call restrictions. 4-5-1 2 Change security code . 4-5-2 1 The Accessory settings menu will not appear until after an accessory has been connected to the phone. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 24 Wednesday, May 28, 2003 4:10 PM 9 MINUTE MGR. 2 1 My calls. 9-1 2 My account . 9-2 3 Customer care. 9-3 2 The Minute Manager menu is visible only when Minute Manager service is activated on your account. Please contact your service provider for more information. Basic operations 8 PREPAID 1 1 Check account balance . 8-1 2 Add money to account. 8-2 3 Call customer service. 8-3 4 Save access phone numbers . 8-4 1 Balance phone number . 8-4-1 2 Replenish phone number . 8-4-2 3 Customer service phone number . 8-4-3 5 Expiration date . 8-5 1 The Prepaid menu is visible only when prepaid service is available in your network and/or activated on your account. Please contact your service provider for more information on Prepaid services. 24 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 25 Wednesday, May 28, 2003 4:10 PM
CONTACT LIST MENU Switch back to the start screen. Press Contacts. For access to the contact list and its menus:
1 2 These options are available:
1 Find 2 Add new 3 Delete all 4 Options 1 Contacts view 2 Memory status 5 1-touch dialing Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 26 Wednesday, May 28, 2003 4:10 PM Text entry 4 Text entry Current entry method There are two ways to enter letters and numbers into your phone:
Standard text input - for making entries in the contact list. Predictive text input - for writing text messages, picture messages, and e-mails. For more detail, see Predictive text on page 29.
STANDARD TEXT ENTRY Standard text input is used when entering text into information prompts. You can use this method for all text entry, but predictive text input is the faster method for writing messages. Enter letters (ABC mode) When you add new names to the contact list, your phone automatically switches to the ABC mode and displays the 1 icon. Find the key that has the letter you want to enter. Press the key as many times as needed for the letter to appear on the screen. 2 Enter numbers (123 mode) To enter numbers:
1 Press and hold # to switch to 123 mode. Press the appropriate number key to enter a number. OR While in ABC mode, press and hold the corresponding number key until the number appears. If you make a mistake, press Clear to delete that character. To return to the ABC mode, press and hold # again for two seconds. 2 DELETE MISTAKES If you make a mistake, press Clear as needed to delete one or more characters. Press and hold Clear to delete the entire field of characters. 26 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 27 Wednesday, May 28, 2003 4:10 PM CHANGE FROM CAPITAL (UPPERCASE) LETTERS To switch between capital (uppercase) and lowercase letters, press #. The icon in the upper left corner of the screen switches to indicating that you can now enter lowercase letters. To switch back to uppercase letters again, press #.
SPACES, PUNCTUATION, AND SPECIAL CHARACTERS ENTRY Depending on the selected display language, the following characters may be available when entering characters from the keypad:
Key Characters Key Characters 1 2 3 4 5 6 7
. , ? ! @ ~ / - 1 A B C 2 D E F 3 G H I 4 J K L 5 M N O 6 P Q R S 7 8 9 0
T U V 8 W X Y Z 9 Enters an empty space or 0. Special characters Changes letter case; long press toggles between text input mode and number input mode. Scroll up key Moves cursor to the left of character. Scroll down key Moves cursor to the right of character. Note: Some networks may not support all language-dependent characters and/or services.
To enter a space, press 0 once. To enter punctuation, press 1 repeatedly until the character you want appears. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 28 Wednesday, May 28, 2003 4:10 PM Text entry Use special characters While entering text, press * (or press and hold *, if predictive text is on) to display special characters. Press * again to cycle through all characters:
Use scroll keys to select the character you want, then press Insert. Note: The order and availability of special characters may vary depending on your service provider. Use four-way scrolling Navigate special characters, using the 2, 4, 6, and 8 keys much as you would a joystick. Once a character is highlighted press 5 to insert the character into your message. Scroll left Scroll up Scroll right Scroll down Insert character Use symbols in names and numbers
To enter a symbol while adding a name to the contact list, press *. To add a special character for creating a number string in the number box, press *. See Set touch tone strings on page 61. 28 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 29 Wednesday, May 28, 2003 4:10 PM
PREDICTIVE TEXT Predictive text input allows you to write messages much faster than the standard text method. With predictive text input, you only need to press each number key once for each letter. Your phone uses a built-in dictionary to predict or guess what you are writing. You can also add new words to the dictionary. Turn on predictive text Press Menu, then press Select. 1 2 Scroll to Write message, then press Select. Press Options, scroll to Predictive text, then press Select. 3 Scroll to the language you want, then press Select. 4 T9 prediction on appears. Enter predictive text To write Steve with the English dictionary selected, press:
7 (for S) 8 (for t) 3 (for e) 8 (for v) 3 (for e) The display shows the above words for each key pressed. Since the displayed word changes after each key stroke, disregard the word until you have keyed in all the characters. If the finished word is not the one you wanted, press * until your word appears. If it does not appear you will have an option to spell your word using standard text input. Note: Predictive text input may not be available for all languages. Turn off predictive text 1 While writing a text message, press Options. Scroll to Predictive text, then press Select. 2 Scroll to Prediction off, then press Select. 3 T9 prediction off appears. Save a word in the dictionary If the word Options changes to Spell, the word you intended to write is not in the dictionary. You can add the word to predictive text. Press Spell, enter the word using standard text entry and press OK to save the word. See Standard text entry on page 26 for more information. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 30 Wednesday, May 28, 2003 4:10 PM Text entry Enter numbers 1 2 To add a number to the message, press and hold # until the screen. Enter the numbers you want, then press and hold # to return to the ABC mode. Note: You can also enter numbers from the Options menu (Insert number), or by a long press of the number key. appears on Enter punctuation and special characters There are two ways to enter punctuation when using predictive text. Press and hold * to access the special characters list. See Use special characters on page 28 for more information. You can also enter symbols from the Options menu:
1 2 3 Change the case Predictive text uses sentence case, but you can manually change between upper and lower case by pressing #. From the Messages screen, press Options. Scroll to Insert symbol and press Select. Scroll to the symbol you want and press Insert. Tip: You can switch between uppercase and lowercase standard text input and uppercase and lowercase predictive text input by repeatedly pressing #. Write compound words 1 Write the first part of the word and press the Scroll down key to accept it. 2 Write the last part of the compound word and press 0 to enter the word and a space. Clear the screen To clear the text screen, press and hold Clear. You can also use the Options menu by selecting the Clear text option. Delete information To delete information when using predictive text, press Clear. Press and hold the clear key to delete text more quickly. 30 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 31 Wednesday, May 28, 2003 4:10 PM 5 Contact list Your phone includes a contact list that can store up to 200 entries (names and associated phone numbers). In addition, the contact list can store an e-mail address for a name.
An entry in the contact list can consist of a number only or a name and a number. You cannot enter the same name twice. If you try to save a name that is already in the contact list, the phone asks if you want to replace the existing name.
Contact list
USE CONTACT LIST MENUS The contact list has several menus from which you can choose. These menus appear when you press Contacts. Use the scroll keys to move to the menu you want to use. Menu Find Add new Delete all Options Function Allows you to search for a specific entry. Allows you to add a new contact to your contact list. Allows you to delete names and numbers one by one or all at once. Takes you to a new menu list which includes the contact lists memory status and scrolling view. 1-touch dialing Allows you to assign up to eight keys for speed dialing.
SAVE NAMES, NUMBERS, AND E-MAIL ADDRESSES For information on entering text, see Standard text entry on page 26. Quickly save a name and number This method is called quick save. 1 2 Enter the phone number using the keypad, then press Save. Enter a name and press OK. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 32 Wednesday, May 28, 2003 4:10 PM Contact list Save an entry using the contact list menu 1 Press Contacts to enter the contact list. 2 Scroll to Add new, then press Select. 3 Enter a name, then press OK. 4 Enter a number, then press OK. Save an e-mail address Once you have added a contact to your contact list, you can add an e-mail address to that contact. Note: E-mail addresses can only be added to existing contacts. For example, you cannot enter an e-mail address until you have selected a name or number. 1 2 3 4 Find the name to which you want to add an e-mail address. Press Details, then press Options. Scroll to E-mail address, then press Select. Enter the e-mail address, and press OK. Important: If you have selected the Name+number contacts view, you will not need to press Details.
RECALL NAMES AND NUMBERS 1 2 3 At the start screen, press Contacts. Select Find, then enter one or two letters of the name you want to recall. Press Find, then press the Talk key to dial the number. You may have to scroll to the appropriate entry in a list if you have stored names that are similar to each other. Recall information with shortcuts You may want to use some of these shortcuts or alternate methods for recalling a number.
Press Contacts, enter the first letter of the name, scroll to the name, and press the Talk key to dial the number. At the start screen, press the scroll keys to enter your list of names, scroll to the name you want to dial, and press the Talk key. Press the Talk key to access a list of your last ten dialed calls, scroll to the one you want to dial, then press the Talk key again.
32 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 33 Wednesday, May 28, 2003 4:10 PM
EDIT A NAME OR NUMBER You can edit a name, a number, or both. 1 2 3 4 Recall the name or number you want to edit. Press Details, then press Options. Edit appears, then press Select. Edit the name or number and press OK. Important: If you have selected the Name+number contacts view, you do not need to press Details.
DELETE NAMES AND NUMBERS Erasing stored names and numbers removes them from your phone. Once you delete an item, you can restore it only by re-entering it. Individual entries 1 2 3 Recall the contact list entry you want to delete. Press Details, then press Options. Scroll to Delete, and press Select. The message Delete? appears. Press OK. 4 Important: If you have selected the Name+number contacts view, you do not need to press Details. Press Names, scroll to Delete all, and press Select. Scroll to Delete all and press Select. Entire contents 1 2 3 When you see the message Are you sure?, press OK. 4 Enter your security code and press OK. Note: For information on your security code, see Understand the security code on page 67. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 34 Wednesday, May 28, 2003 4:10 PM Contact list
CUSTOMIZE YOUR CONTACTS VIEW You can change how the information in your contact list looks on your screen. There are three different ways to view your contact list. In all views, you can use the scroll keys to move up and down through the list of names. Choice What it does Name list Displays three names on the screen at a time. Name+number Only one name and its corresponding number appears on the screen at a time. Name only Displays individual names only. You can view the corresponding phone number by pressing Details and then scrolling up or down. Select your scrolling view To change the way you view names and numbers in your contact list. 1 2 3 Press Contacts, scroll to Options, and press Select. At Contacts view, press Select. Scroll to the view you want and press Select. Important: If you have selected the Name+number contacts view, you will not need to press Details when working with contact list options.
CHECK MEMORY STATUS You can check how much contact list memory is free and how much has been used. 1 2 Press Contacts and scroll to Options. Press Select, scroll to Memory status, and press Select. 34 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 35 Wednesday, May 28, 2003 4:10 PM 6 Call log Your phone provides a call log that registers information about calls you make and receive. The call log keeps track of the following:
Missed calls
Received calls Dialed calls Note: This function only works in digital networks and only when caller ID is enabled.
CALL LOG OPTIONS When you view the missed calls, received calls, or dialed calls list, and press Options, the following choices may appear. Note: Not all options will appear each time. Also, the order of options may vary. Choice Call time What it does Shows the time when the call was connected. (You must first set the phones clock) Send message Allows you to write a short text message to the person who called you or to whom you called. Edit number Allows you to edit the displayed number and save it with a name to your contact list. Save Delete Allows you to enter a name for the number and save both to your contact list. Allows you to delete the number from the call list. View number Allows you to view the callers phone number. In order to see this option, the callers name and number must be stored in the contact list. Call Dials the number from the call log. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 36 Wednesday, May 28, 2003 4:10 PM Call log
CHECK MISSED CALLS If you do not answer a call, the message Missed calls appears on your phones screen, along with the number of calls missed. Your phone stores the last ten numbers associated with calls you have missed. Check missed calls 1 Press Menu 2-1 (Call log > Missed calls). The phone displays a list of the numbers of the calls you missed. Press the Scroll up or Scroll down key to scroll through the list. Press the Talk key if you want to dial the number. 2 3
CHECK RECEIVED CALLS Your phone stores the last ten numbers associated with calls that you have answered. To check this list of numbers:
1 2 3 Press Menu 2-2 (Call log > Received calls). Scroll through the list of received numbers and highlight your selection. Press the Talk key if you want to dial the number.
CHECK DIALED CALLS Press Menu 2-3 (Call log > Dialed calls). Scroll through the list of dialed numbers and highlight your selection. Press the Talk key if you want to dial the number. Your phone stores the last ten numbers associated with calls that you have dialed. To check this list of numbers:
1 2 3 Clear call lists Your phone uses call lists to track numbers for incoming, outgoing, and missed calls. You can delete some or all of the numbers that appear in the call log. Caution: You cannot undo this operation. 1 2 3 Press Menu 2-4 (Call log > Clear call lists). Use the Scroll up or Scroll down key to scroll through the options list. The list includes All, Missed, Received, and Dialed. Stop at the appropriate option and press Select. The All option clears every number in every list, whereas the other options clear only the numbers associated with that option. For example, the Dialed option clears only the numbers associated with calls you previously dialed. 36 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 37 Wednesday, May 28, 2003 4:10 PM
USE CALL TIMERS Your phone tracks the amount of time you spend on each call. To obtain information about time spent on phone calls:
Press Menu 2-5 (Call log > Call timers). 1 Scroll through the following options:
2 Option What it does Duration of last call Shows the call duration of the last call. Duration of all calls Shows the call duration of all calls that have been made and received since you reset the timers. Clear timers Clears all call timers for the currently selected phone number. Your phone includes separate timers for each number used. Note: The actual time invoiced for calls by your service provider may vary, depending upon network features, rounding-off for billing, and so forth. Caution: If you select the Clear timers option, the action cannot be undone. If you use the call timers to log the amount of time spent on calls, you may want to record the call timer information before you clear it. Clear call timers 1 2 Press Menu 2-5-3 (Call log > Call timers > Clear timers). Enter your security code and press OK. Note: For information on your security code, see Understand the security code on page 67. Turn on a current call timer You can set your phone to show the running elapsed time while a call is active. 1 2 Press Menu 4-2-2 (Settings > Call settings > Current call timer). Scroll to On and press Select. From this point on, the timer is active during each call you make or receive. The time appears on the phones screen. After a call has ended, press any key on the phones keypad to clear the current call time from the screen. 3 Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 38 Wednesday, May 28, 2003 4:10 PM Messages 7 Messages Use mobile messages to keep in touch with friends, family and business associates. Your phone allows you to do the following:
Not all messaging features are available in all wireless networks. Contact your service provider for availability and subscription information. Voice mail Send and receive text messages Send and receive picture messages Communicate with e-mail
VOICE MAIL Voice mail provides a way for callers who miss you to leave a message that you can retrieve later. Check for messages Your phone beeps when you receive a voice message. Also, the message New voice message appears on your phones screen, along with the If you receive more than one voice mail message, your phone may show the number of messages that you have received. The wireless network provider determines the type of indication you will receive. icon. Note: To use voice mail, you need to learn the voice mail systems various greetings, passwords, and prompts. Your service provider can provide instructions. Save the voice mailbox number As part of your networks voice mail feature, your service provider gives you a voice mailbox phone number. 1 2 Your voice mailbox number can be up to 32 digits long and is used until you change it. Therefore, if your phone number changes, the voice mail number will probably change also. For further information, contact your service provider. Press Menu 1-8-2 (Messages > Voice messages > Voice mailbox number). Enter your voice mailbox phone number, then press OK. 38 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 39 Wednesday, May 28, 2003 4:10 PM Listen to your voice messages The way you listen to your voice messages depends on your service provider. Call your service provider if you have any questions. 1 When your phone alerts you to new voice messages, press Listen and follow 2 3 the instructions given on the phone. If you want to listen to your messages later, press Exit. To listen to your voice messages:
Press and hold 1. OR Press Menu 1-8-1 (Messages > Voice messages > Listen to voice messages). Follow the prompts to review your messages.
TEXT, E-MAIL, AND PICTURE MESSAGES Your phone is capable of a variety of messaging services including text messages
(SMS or Short Message Service), picture messages, and e-mail messages. Messaging services are Network Services. Consult your service provider for information on availability, subscribing to and using messaging services. Understand messaging Message recipients: The phone to which you send a message must support messages. The recipient may not receive the SMS message you send if the recipients account is with a different service provider or uses a different protocol. Message length: The maximum length of a sent or received message is 160 characters. Your phone has space for several messages, depending on the length of each message. The maximum length of a message also may depend on the capabilities of the network from which the message originated. Options when working with messages There are several options available when working with text, picture, and e-mail messages. The order and availability of options may vary depending on the messaging function and your service provider. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 40 Wednesday, May 28, 2003 4:10 PM Messages Option Send Settings Save Clear text Exit editor Description Attempts to send the text message to the recipient. Allows you to set Urgent, Read receipt, Reply req., and Callback no. options for the message. Saves the message in the archive folder. Clears the text in the message editor. Takes you back to the Write message menu. Predictive text Allows you to turn predictive text on and off. Insert word If predictive text (T9) is activated, you can manually spell a word and insert it into your message. Insert number Allows you to insert numbers into the message. Insert symbol Allows you to access the list of special characters. Save picture Allows you to save a picture to the template folder. Matches Details Preview Edit text Delete Forward Lists alternative word choices while using predictive text. Available when viewing a picture message. This option allows you to view the name and number of the sender. Previews your picture message before sending. Allows you to add text to a picture message. Allows you to delete a message. Allows you to forward a message. Use number Allows you to use the number associated with a message. Replay Allows you to replay messages you receive. Edit recipient Allows you to edit the e-mail address. Edit subject Allows you to edit the subject of an e-mail message. Tip: When writing messages, you can switch between uppercase and lowercase standard text input and uppercase and lowercase predictive text input by repeatedly pressing #. 40 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 41 Wednesday, May 28, 2003 4:10 PM Organize messages using folders Your phone has folders for managing text messages. Text message folders are located under the Messages menu. THE INBOX FOLDER The inbox stores messages you receive. Messages remain in the inbox until you delete them or save them in the archive folder. You can forward or reply to messages in your inbox. THE OUTBOX FOLDER The outbox stores messages you have written, sent, edited, and forwarded. Messages in the outbox are not saved messages. As you send new messages, old messages will automatically be removed from the outbox. When message memory is full, one or more messages of the lowest priority are automatically deleted from the outbox. If you want to save a message you have sent, read the message while it is in the outbox and use the options menu to save it to the archive folder. THE ARCHIVE FOLDER The archive folder stores messages you have saved. You can save messages to the archive folder from the inbox and the outbox. You can reply to or forward saved messages. DELETE MESSAGES FROM FOLDERS You can delete all messages located within a specific folder. 1 2 Press Menu 1-6 (Messages > Delete all). Scroll to one of the following options, then press Select. All read Inbox Archive Outbox Enter your security code, then press OK. 3 Note: For information on your security code, see Understand the security code on page 67. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 42 Wednesday, May 28, 2003 4:10 PM Messages
TEXT MESSAGES Use your phone to send and receive short text messages. Write and send a text message When writing text messages, use the predictive text method for faster text entry. For details, see Predictive text on page 29. 1 Press Menu, select Messages, then select Write message. The message screen appears. Enter a message of up to 160 characters. A counter in the upper right corner of the screen shows the number of characters remaining. 2 3 When you have finished writing the message, press Options, scroll to Send, 4 then press Select. Enter or recall the recipients phone number, then press Send. Sending message appears. Note: When sending messages via the SMS network service, your phone may display the words, Message Sent. This is an indication that the message has been sent by your phone to the message center number programmed into your phone. This is not an indication that the message has been received at the intended destination. For more details about SMS services, check with your service provider. Read a text message When you receive a text message, the phone beeps and displays Message received and the 1 2 3 Press Read to view the message. Use the scroll keys to view the whole message, if necessary. Once youve finished, press the End key to return to the start screen, or press Options for other choices, such as Reply or Forward. indicator in the upper left corner of the screen. When the phone displays Message received, pressing Exit moves the new message to the inbox and returns you to the start screen. To read the message later, press Menu 1-3 (Messages > Inbox). If you have more than one new message, scroll to the message you want to view. Messages in the inbox are listed in the order they are received, with the most recent message listed first. Unread messages are indicated by
. 42 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 43 Wednesday, May 28, 2003 4:10 PM Respond to a text message There are many options available for working with text messages. For a list of options and their descriptions, see Options when working with messages on page 39. REPLY TO THE MESSAGE 1 When reading the message, press Options. 2 3 Scroll to Reply, then press Select. Choose to reply As message or As e-mail, then press Select. When replying as e-mail, see Send an e-mail message on page 45. When replying as message, see Write and send a text message on page 42. FORWARD THE MESSAGE 1 When reading the message, press Options. 2 3 Scroll to Forward, then press Select. Choose to forward As message or As e-mail, then press Select. When forwarding as e-mail, see Send an e-mail message on page 45. When forwarding as message, see Write and send a text message on page 42. SAVE A MESSAGE 1 When reading the message, press Options. 2 Scroll to Save, then press Select. The message will be moved to the archive folder. DELETE A MESSAGE 1 When reading the message, press Options. 2 Scroll to Delete, then press Select. Delete message? appears. Press OK. 3 WHEN MEMORY IS FULL When message memory is full, one or more messages of the lowest priority are automatically deleted. When you receive an emergency message, messages may be deleted from any of your message folders. If you have more messages waiting at the network, You can delete old messages to create space for new messages. blinks on the start screen. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 44 Wednesday, May 28, 2003 4:10 PM Messages
PICTURE MESSAGES Your phone offers five picture messages that you can use to send pictures and text to your friends and family. You can also save a new picture by replacing an existing picture. For possible message options, see Options when working with messages on page 39. Each picture message is made up of several text messages. Therefore, sending one picture message may cost more than sending one text message. Contact your service provider for pricing information. Note: This function can be used only if it is supported by your network operator or service provider. Only phones that offer picture message features can receive and display picture messages. Send a picture message 1 2 Press Menu 1-7 (Messages > Picture Messages). Scroll to the picture you want to send, then press Show. The picture appears. To choose a different picture, press Back and scroll to another picture. Press Options. Edit text appears. Press Select, then add a text message to send with the picture. After you enter the text, you have several options. To view a list of possible options, see Options when working with messages on page 39. To send the picture and message, press Options. Scroll to Send, then press Select. Enter or recall the recipients phone number, then press Send. Sending message appears. 3 4 5 6 7 PREVIEW A PICTURE MESSAGE BEFORE SENDING After writing text for your picture message, you can preview the message before sending it. 1 2 3 Press Options. Scroll to Preview, then press Select. After viewing the message, press Back. 44 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 45 Wednesday, May 28, 2003 4:10 PM 2 2
Receive a picture message 1 When your phone displays Picture message received, press Show and the message appears. If the picture has a text message with it, scroll up or down to see the entire message. Save a picture message 1 Press Show to view the message, then press Save. You have the option to replace a current message. Scroll to the picture you want to delete, then press Replace.
E-MAIL MESSAGES You can send e-mail up to 160 characters in length to anyone with an e-mail address. This is a Network Service.
Messages sent to you by e-mail arrive as regular text messages. You can use all the options described earlier to save, reply to, or forward a message. Contact your service provider to get the e-mail address and gateway number for your phone, and for more information on using e-mail. Send an e-mail message 1 Press Menu 1-2 (Messages > Write e-mail). Note: If you get a prompt asking you to enter your e-mail gateway number, you must obtain this number from your service provider. At the prompt, enter your recipients e-mail address or press Find to look through and select a saved e-mail address from your phone list. Press OK. At the prompt, enter a subject for your e-mail message. (You are not required to enter a subject.) Press OK when you are finished. Note: Predictive text is not available when entering an e-mail address or a subject line for your e-mail. A screen will appear allowing you to enter the text of your message. Your total message, including the address and subject line, can be up to 160 characters. There is a running total of remaining characters in the top right corner of the screen. After you finish entering the text of your e-mail, press Options, scroll to Send, then press Select. 2 3 4 5 6 Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 46 Wednesday, May 28, 2003 4:10 PM Messages indicator in the upper left corner of the screen. Receive an e-mail message When you receive an e-mail message, the phone makes a sound and displays Message received and the To read the message, press Read. When reading a received e-mail message, you can choose other options, such as Reply and Forward. See Options when working with messages on page 39. Edit an existing e-mail message Edit an e-mail message by replying to the message or forwarding it. You can edit messages from any folder. Reply to an e-mail message 1 When reading the message, press Options. 2 3 Scroll to Reply, then press Select. Choose to reply As message or As e-mail, then press Select. When replying as e-mail, see Send an e-mail message on page 45. When replying as message, see Write and send a text message on page 42. Forward an e-mail message 1 When reading the message, press Options. 2 3 Scroll to Forward, then press Select. Choose to forward As message or As e-mail, then press Select. When forwarding as e-mail, see Send an e-mail message on page 45. When forwarding as a message, see Write and send a text message on page 42. 46 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 47 Wednesday, May 28, 2003 4:10 PM 8 Personalization The Nokia 2200 series can be easily customized to fit your lifestyle. The display language, ringing tones, audio, and accessory settings (among others) can all be modified to suit your needs. Your phone has various profiles which allow you to customize ringing and alert tones for different environments. Once you modify the profiles, you can activate the profile that is appropriate for your surroundings. For example, you can select the Silent profile while at the movies or the Outdoor profile when at a sporting event.
PROFILES Profiles let you set sound settings to match your environment, whether it is a meeting or a soccer game. Just pick the profile that suits your current environment: Normal, Silent, Meeting, Outdoor or Pager. You can customize any of the profiles and set your own preferences for the following settings:
Message alert tone Vibrating alert
Keypad tones
Warning tones
Ringing options Ringing tone Ringing volume Profile name (except for the Normal profile) Important: You can select a default profile for each of these accessories:
Headset, Handsfree, and Loopset. To learn more about accessories, see Accessory settings on page 50. Select a profile 1 2 Quickly press and release the Power key. Use the Scroll up or Scroll down key to move to the profile you want to use. Profile names are highlighted as you scroll through them. Press Select to activate a profile. 3 Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 48 Wednesday, May 28, 2003 4:10 PM Personalization Customize a profile Press Menu 3 (Profiles). 1 2 Scroll to the profile you want to customize, then press Options. Scroll to Customize, then press Select. 3 4 Use the scroll keys to display each of the profile options. Once you find the option youd like to customize, press Select. 2 3 4 5 SET THE RINGING OPTIONS You can choose the type of ring your phone uses to notify you of an incoming call. This setting does not affect any incoming text message alert tones. 1 Press Menu 3 (Profiles). Your phone lists each profile. Scroll to the desired profile in the list for which you want to set the ringing options, and press Options. Scroll to Customize, then press Select. Scroll to Ringing options and press Select. Scroll to one of the ringing options, as described below, and press Select. Ring: The phone rings normally. Ascending: Ringing volume increases (gets louder) if the phone is not answered. Ring once: The phone rings once to indicate an incoming call. Beep once: The phone beeps once to indicate an incoming call. Silent: The phone makes no sound. SET THE RINGING TONE The ringing tone is the sound your phone makes when you receive a call. Your phone contains preprogrammed ringing tones. You can set the ringing tone to a specific sound or tune to personalize how the phone rings. You can also add custom ringing tones to your phone. See Download a ringing tone on page 72 for more information. 1 Press Menu 3 (Profiles). Your phone lists each profile. Scroll to the profile for which you want to set the ringing tone, then press Options. Scroll to Customize, then press Select. Scroll to Ringing tone and press Select. 2 3 4 48 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 49 Wednesday, May 28, 2003 4:10 PM 5 Scroll through the options when you hear the tone you want, press Select. Note: If you have already chosen a ringing option of either Silent or Beep once, the ringing tones are already turned off. See Set the ringing options on page 48 for details. As you scroll through the ringing tones, you can listen to a sample of each if your current ringing option is not set to Silent. Press Menu 3 (Profiles). Scroll to the profile you will set and press Options. Scroll to Customize, then press Select. Scroll to Ringing volume and press Select. Scroll through the options. When you hear the right volume level, press Select. SET THE RINGING VOLUME Set the default ringing volume for incoming voice calls and message alert tones. 1 2 3 4 5 SET THE MESSAGE ALERT TONE Set your phone to use a certain tone to indicate an incoming text message. 1 2 Press Menu 3 (Profiles). Scroll to the profile for which you want to set the message alert tone and press Options. Scroll to Customize, then press Select. Scroll to Message alert tone, then press Select. Scroll through the tone selections. The phone plays samples of each selection as you scroll to it. 3 4 5 6 When you find the tone you want, press Select. SET A VIBRATING ALERT Set your phone to vibrate to indicate an incoming call. 1 2 Press Menu 3 (Profiles). Scroll to the profile for which you want to set the vibrating alert and press Options. Scroll to Customize, then press Select. Scroll to Vibrating alert and press Select. Scroll to On and press OK. The phone does not vibrate when it is connected to or placed in any charging device. 3 4 5 Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 50 Wednesday, May 28, 2003 4:10 PM Personalization SET KEYPAD TONES Keypad tones set the volume of the tone you hear when you press phone keys. 1 2 3 4 5 Press Menu 3 (Profiles). Scroll to the profile for which you want to set the keypad tones and press Options. Scroll to Customize, then press Select. Scroll to Keypad tones and press Select. Scroll to one of the levels and press Select.
If you choose Off, no keypad tones are heard. If you chose the Silent profile in step 2, the keypad tones are turned off. SET THE WARNING TONES Warning tones include the sounds your phone makes during error conditions, during confirmations, when the battery is low, and when you need to recharge the battery. 1 2 Press Menu 3 (Profiles). Scroll to the profile for which you want to set the warning tones, then press Options. Scroll to Customize, then press Select. Scroll to Warning tones, then press Select. Scroll to On or Off and press Select. 3 4 5 Rename a profile Press Menu 3 (Profiles). 1 Scroll to the desired profile, then press Options. 2 Scroll to Customize, then press Select. 3 Scroll to Profile name, then press Select. 4 5 Enter the new name and press OK. Note: You cannot rename the Normal profile. Accessory settings Use your phone with these Nokia accessories:
Headset (HDC-5, HDE-2, HDB-5, and HDC-10) Handsfree Car Kit (CARK-125, CARK-134 and PPH-1) Loopset (LPS-3) TTY/TDD Adapter (HDA-9) 50 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 51 Wednesday, May 28, 2003 4:10 PM Note: You can select a default profile that will be associated with each accessory, such as Normal. However, the Accessory settings menu will not appear until after an accessory has been connected to the phone at least once. Attach the loopset to the phone. Press Menu 4-4-3 (Settings > Accessory settings > Loopset). Scroll to Use loopset, then press Select. Scroll to Yes, then press Select. SET UP THE LOOPSET When you want to use the loopset, you will have to activate the accessory setting. 1 2 3 4 AUTOMATIC ANSWER This feature lets your phone answer incoming calls after just one ring when an accessory is connected to the phone. 1 2 3 4 SET THE LIGHTS (CAR KIT ONLY) When your phone is connected to a car kit, you have a choice of having the phone lights on (a) continuously or (b) only when you use it. 1 2 Press Menu 4-4 (Settings > Accessory settings). Scroll to Headset, Handsfree, or Loopset, then press Select. Scroll to Automatic answer, then press Select. Scroll to On and press Select. Press Menu 4-4-2-3 (Settings > Accessory settings > Handsfree > Lights). Choose one of the following options, then press OK:
On: The lights will remain on while the phone is connected to the car kit. Automatic: The lights will be turned on only when the phone is being used. SET THE DEFAULT PROFILE When you use the headset, car kit or loopset, you have the option of selecting a default profile. You can use the currently selected profile (for example, Normal) or you can choose from the list. 1 2 3 4 Press Menu 4-4 (Settings > Accessory settings). Scroll to Headset, Handsfree or Loopset, then press Select. Scroll to Default profile, then press Select. Scroll to the profile you want, then press Select. Note: The Active profile uses the current profile setting you have selected for your phone. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 52 Wednesday, May 28, 2003 4:10 PM Personalization Press Menu 4-3-1 (Settings > Phone settings > Language). Scroll to the language you want, then press Select. Set the display language You can choose your phones display language. 1 2 Set the clock Your phone contains a real-time clock that can be set two different ways: the clock can use the time information provided by the wireless system or it can be set manually. Once the time is set, you can display the clock on the start screen. For added convenience, the clock is connected to an alarm clock. See Use the alarm clock on page 69 for additional information. SELECT THE TIME FORMAT You can choose whether your clock shows time in an am/pm format or a 24-hour format. 1 2 SET THE CLOCK USING AM/PM FORMAT 1 2 Press Menu 4-1-2-3 (Settings > Time settings > Clock > Time format). Scroll to 24-hour or am/pm and press Select. Press Menu 4-1-2-2 (Settings > Time settings > Clock > Set the time). Enter the time using an hh:mm format and press OK. For example, to set your clock to 8:40, enter 08:40. Scroll to am or pm and press Select. 3 Note: Even if you have selected the am/pm format, you can still set the clock in the 24-hour format. SET THE CLOCK USING 24-HOUR FORMAT 1 2 Press Menu 4-1-2-2 (Settings > TIme settings > Clock > Set the time). Enter the time using an hh:mm format and press OK. For example, to set your clock to 8:40, enter 08:40 (for am) or 20:40 (for pm). Press OK. 3 Automatic update of time Set your phone to update the time from the network when you turn the phone on. If the clock in your phone is 30 seconds or more off the network time, the phone will automatically update to reflect the network time. Note: Auto update time is a network dependent feature. Contact your service provider for details and availability. 52 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 53 Wednesday, May 28, 2003 4:10 PM 1 2 Press Menu 4-1-3 (Settings > Time settings > Auto update of time). Scroll to one of the following options, then press Select. On: Updates the time automatically. Confirm first: Requires you to confirm that you want the update. You can accept or decline the update. Off: Prevents the time from being automatically updated. Display the clock 1 2 Press Menu 4-1-2 (Settings > Time settings > Clock). Scroll to Hide clock or Show clock (only one choice appears, depending on the current setting). Press Select. 3 Add a welcome note You can add a welcome note that your phone displays briefly each time you turn it on. 1 2 3 Press Menu 4-3-3 (Settings > Phone settings > Welcome note). Enter a note, then press Options. Scroll to Save, then press Select. To delete the welcome note, follow steps 1-2, scroll to Delete, then press Select. Restore factory settings If you have made changes to your phones profiles (settings), you can restore them to their original or factory settings. The memory, timers, language selection, and security code are not reset. However, profile and accessory settings are reset. 1 2 Press Menu 4-3-4 (Settings > Phone settings > Restore factory settings). At the prompt, enter your five-digit security code and press OK. See Understand the security code on page 67. for more information. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 54 Wednesday, May 28, 2003 4:10 PM Advanced calling features 9 Advanced calling features Options available while in a call This chapter covers advanced calling features, including:
Managing two calls at the same time
Not all features that are described are available in all wireless networks. Contact your service provider for availability of network services. Network services, such as call forwarding
UNDERSTAND ACTIVE-CALL OPTIONS Your phone allows you to use a number of features during a call; however, you may not be able to use all options at all times. Also, the order of in-call options may vary. Note: Many in-call options are network dependent features. To use these options, you may need to contact your service provider. During a call, press Options to see the in-call menu choices:
Menu Options What it does Lock keys Allows you to lock the phones keypad during a call. Mute Mutes the phones microphone. This option can affect the microphones of accessories connected to the phone. End all calls Ends all active calls. Touch tones Sends touch tones. New call Menu Allows you to make a call while you have a call in progress. Allows you to access the menus. Allows you to access the contact list. Contacts Access menus You can access your phones menus while in a call. 1 2 Press Options. Scroll to Menu, then press Select. To exit the menus, press Exit. Note: Do not press the End key to exit the menus or you will end your call. 54 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 55 Wednesday, May 28, 2003 4:10 PM Make a new call To make a new call while already in a call, dial the number, then press the Talk key. End all calls Press the End key. Access the contact list You can access information in the contact list during a call. 1 2 Save a name and/or number You can save a name and number during a call. 1 2 3 Enter the number you want to save. Press Options, scroll to Contacts, then press Select. Scroll to Add new, then press Select. Add the name and number as you normally would. Press Options. Scroll to Contacts, then press Select. Mute the phones microphone While in a call, you can mute the phones microphone. Press Options, scroll to Mute, press Select. Use conference call While in a call, you can call another number to add a third party to the call. Note: Conference calling is a provider dependent feature. Contact your service provider for availability and details. CONFERENCE A CALL 1 While in a call, you can either dial the number you want to add and press the Talk key. OR Press Options, scroll to New call, press Select, enter the phone number, and press OK. 2 When the third party answers, press the Talk key to connect all three parties. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 56 Wednesday, May 28, 2003 4:10 PM Advanced calling features DISCONNECT THIRD PARTY While all three parties are connected, pressing the Talk key disconnects the third caller, keeping the second partys call active. DISCONNECT SECOND PARTY If you wish to disconnect with the second party and remain connected to the third party, have the second party terminate the call on his/her end. RECALL A NUMBER FROM THE CONTACT LIST DURING A CALL If you dont remember the number of the second party you want to include in the conference and the number is in your contact list, you can recall the number. 1 2 3 To access the contact list, press Options, scroll to Contacts, and press Select. Follow the prompts to find the number as you normally would. Locate the number in your contact list, then press Select. The number appears in the number prompt. 4 Press OK to call the number. END A CONFERENCE CALL To end all calls, press the End key.
USE VOICE PRIVACY The voice privacy feature encrypts the voice channel so that people cannot eavesdrop on your phone conversations. Note: Voice privacy is a network dependent feature. Contact your service provider for more information on this feature. Press Menu 4-6-1 (Settings > Network services > Voice privacy). Scroll to On or Off and press Select. TURN VOICE PRIVACY ON/OFF 1 2 During a call, voice privacy becomes active and notifies you with a beep. A notification message also appears on the screen. If you turn this feature on and voice privacy becomes inactive, your phone beeps and displays Voice privacy not active. Note: Use caution when sending confidential information, if voice privacy is not active. 56 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 57 Wednesday, May 28, 2003 4:10 PM
USE CALL FORWARDING With call forwarding, you can forward incoming calls to another phone number. Before you can use call forwarding, you must first store the feature codes. Once call forwarding has been activated, Call forwarding appears as a menu option. Note: Call forwarding is a network-dependent feature. Some networks require that call forwarding be activated manually. Contact your service provider for availability and full details. Learn about call forwarding feature codes Your network requires separate codes for activating and cancelling the various types of call forwarding. Your carrier can provide you with the necessary feature codes for these network services. Once you store these feature codes in your phone, they are sent automatically to the network when you select one of the call forwarding options from your phones menu. Your phone can store the following types of feature codes:
Option What it does Forward all calls Forwards incoming calls to the number you specify. Forward if busy Forwards incoming calls when you are in a call. Forward if not answered Forwards incoming calls to another number when you are unable to answer. Forward if out of reach Forwards incoming calls to another number when the phone is out of the network or switched off. Cancel all call forwarding Cancels all active call forwarding options. Store the call forwarding feature code Before you can activate call forwarding, you must contact your service provider to obtain the feature codes. 1 2 3 Press Menu 4-6-5 (Settings > Network services). Enter the feature code your service provider gave you, then press OK. Scroll to Call forwarding and press Select. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 58 Wednesday, May 28, 2003 4:10 PM Advanced calling features Scroll to the call forwarding option you want and press Select. Scroll to Activate and press Select. 4 5 Activate/cancel call forwarding After you store the correct feature codes, you can activate (or cancel) call forwarding as follows:
1 2 3 4 Press Menu 4-6-2 (Settings > Network services > Call forwarding). Scroll to the desired call forwarding option, then press Select. Highlight Activate and press Select. Enter the number to which you want your calls forwarded or press Find to recall a number from the contact list. Press OK. 5 Note: When canceling call forwarding, follow steps 1 and 2.
USE CALL WAITING During a call, call waiting beeps to let you know that someone else is calling you. Depending on your caller ID setup, the phone might also display the number of the incoming call. Once call waiting has been activated, Call waiting appears as a menu option. Note: Call waiting is a network-dependent feature. In some networks the call waiting code must be activated manually. Contact your service provider for availability and full details. Store the call waiting feature code 1 Press Menu 4-6-5 (Settings > Network services > Network feature setting). The Feature code prompt appears. Enter the feature code issued by your service provider and press OK. Scroll to Call waiting and press Select. Scroll to Activate and press Select. 2 3 4 Activate call waiting 1 2 Press Menu 4-6-3 (Settings > Network services > Call waiting). Scroll to Activate and press Select. 58 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 59 Wednesday, May 28, 2003 4:10 PM Manage calls Call waiting works with both local and long distance calls.
To answer an incoming call, press the Talk key. To switch from one call to another, press the Talk key. To end both calls, press the End key.
USE SEND OWN CALLER ID This feature allows you to block caller ID when you call someone (your number will not be displayed on their caller ID). This feature is only effective when calling a number equipped with caller ID. Note: This feature is available only when supported by the wireless network and may not function if you are roaming. Important: This feature works on a call-by-call basis. You must enable this feature each time you want to block the sending of your own number to the recipients caller ID. STORE THE FEATURE CODE Before you can use the Send own caller ID call feature, you must store the feature codes for activating this feature. Once the code is stored in your phone, it is sent automatically to the network when you select this option from your phones menu. Press Menu 4-6-5 (Settings > Network services > Network feature setting). 1 The Feature code prompt appears. Enter the feature code issued by your service provider and press OK. Scroll to Send own caller ID, press Select, then select Yes. 2 3 PLACE A CALL WITHOUT SENDING YOUR NUMBER 1 2 3 Press Menu 4-6-4 (Settings > Network services > Send own caller ID). Scroll to No, then press Select. Enter the desired phone number, then press OK or press Find to recall a phone number from the contact list. The phone automatically inserts the feature code into the dialing string and dials the phone number. The phone you are calling will not display your phone number through caller ID. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 60 Wednesday, May 28, 2003 4:10 PM Advanced calling features
SELECT A PHONE NUMBER Your service provider programs your phone number and system information into your phones memory when your phone is first activated. Your phone can hold up to three numbers. This means that your phone can be activated in three different service areas. For example, your phone could be activated in Dallas, Chicago, and New York. Each service area would assign a different phone number or account to your phone. You must select a phone number for your home system. Only one phone number can be active at a time. If you travel outside your home system, you can choose another number. One phone number is usually enough if your service provider has service or roaming agreements for each area in which you wish to use your phone. Contact your service provider for details. Note: Phone number selection is a network dependent feature. Some networks may not support more than one number. Contact your service provider for availability and full details. Select the phone number 1 2 Press Menu 4-6-6 (Settings > Network services > Own number selection). Scroll to the phone number you want and press Select. Note: The first phone number on this list is selected. You need at least one active number to make calls. You cannot change from one phone number to another during a call.
USE AUTOMATIC REDIAL There are times when you may not be able to place a call (for example, due to the high volume of traffic on the wireless network). When the wireless network is busy or unavailable, Automatic redial instructs your phone to retry the call. ACTIVATE AUTOMATIC REDIAL 1 2 If the system is busy, your phone makes three additional call attempts. If you want to stop the automatic redial process before the last attempt, press the End key or Quit. Important: This feature does not automatically retry a number when the number you are calling is busy. Press Menu 4-2-1 (Settings > Call settings > Automatic redial). Scroll to On and press Select. 60 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 61 Wednesday, May 28, 2003 4:10 PM
USE 1-TOUCH DIALING You can assign a name from your contact list to a 1-touch dial location, using your phones keys 2-9. (The 1 key is used exclusively to dial your voice mailbox.) Once assigned, the phone number you associate with that key is dialed automatically when you press and hold the key. Assign a key to 1-touch dialing 1 2 3 Press Contacts, scroll to 1-touch dialing and press Select. Scroll to a number that has the message (empty) and press Assign. Scroll to the name and number to which you want to assign this key and press Select. Repeat steps 1-3 times as many times as necessary. To call a number using 1-touch dialing, press and hold the appropriate key for a few seconds. 4 Change 1-touch dialing numbers You can change the 1-touch dialing key assignments at any time. Press Contacts, scroll to 1-touch dialing, and press Select. 1 Scroll to the key you want to change and press Options. 2 Scroll to Change and press Select. 3 4 Scroll through the contact list until you reach the new number you want to select and press Select. Delete 1-touch dialing numbers You can delete 1-touch dialing key assignments at any time. 1 2 3 Press Contacts, scroll to 1-touch dialing and press Select. Scroll to the key you want to delete and press Options. Scroll to Delete, press Select, then press OK.
SET TOUCH TONE STRINGS Your phone allows you to create special sets of numbers known as touch tone strings which will dial a series of digits after a wait or a pause. For example, you can program your phone to send your account number while you are banking by phone. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 62 Wednesday, May 28, 2003 4:10 PM Advanced calling features You must be in the as usual. When you want to insert the special characters, press * repeatedly to switch among *, +, p, w characters. mode to enter these characters. Enter the numbers Note: Use caution when sending confidential information, if voice privacy is not active. Character Action p w
Creates a pause when a number is dialed. The numbers you enter after this special character are automatically sent as touch tones after a 2.5-second pause. Creates a wait when a number is dialed. This means that your phone waits for you to press the left selection key before it sends the number as touch tones. Sends command strings to the network. Contact your service provider for details. Use this character to link a 1-touch dialing number to a number in the contact list. Set manual touch tones 1 Press Menu 4-3-2-1 (Settings > Phone settings > Touch tones > Manual touch tones). Select one of the following options, then press Select:
Continuous: Sounds tone for as long as you press and hold a key. Fixed: Sets the tone length to 0.1 second, regardless of how long you press a key. Off: Turns off the tones. No tones are sent. Set touch tone length You can also set the length of each touch tone. 1 Press Menu 4-3-2-2 (Settings > Phone settings > Touch tones > Touch tone length). Use the Scroll up or Scroll down key to scroll to Short or Long. Short sets the tone length to 0.1 second. Long sets the tone length to 0.5 second. Press Select. 2 2 3 62 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 63 Wednesday, May 28, 2003 4:10 PM Store touch tone strings You can store touch tone strings the same way that you store names and numbers in your contact list. You can store an entire sequence of digits and send it as touch tones for frequently used strings of numbers. STORE TOUCH TONE STRINGS WITH PHONE NUMBERS 1 2 3 4 SEND A TOUCH TONE STRING 1 Enter the phone number that you want associated with a touch tone. Enter the touch tone character where needed (p, w, or *). Enter the touch tone string. Store the number as you normally would. Press Menu 4-3-2-1 (Settings > Phone settings > Touch tones > Manual touch tones). 2 Make sure that the setting is not set to Off. 3 4 If not set to Off., scroll to one of the other options and press Select. During your call, press Options, scroll to Touch tones, and press Select. Enter the touch tone string or recall the string from the contact list, then press OK. If you send touch tones while in the analog mode, be careful not to send confidential information.
LINK CONTACT LIST ENTRIES This feature allows you to store a phone number in one contact list location and link it to another contact list entry. For example, linking the phone number of an automated service (for example, automated banking service) with a touch tone string entry in your contact list
(example: account and PIN numbers) automatically recalls and sends the touch tone string when you call the service. USE LINKING OPTIONS 1 2 Store the touch tone string into your contact list. Assign the contact list entry with the touch tones to a one-touch dialing location
(example: location 3). For more information on 1-touch dialing, see Use 1-touch dialing on page 61. Edit the automated services phone number by adding +n to the end of the phone number (where n is the 1-touch dialing location). Example: 214-555-1234+3 3 Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 64 Wednesday, May 28, 2003 4:10 PM Advanced calling features 4 5 Press OK to save your changes. Dial the automated service number from your contact list. Your phone automatically sends the touch tones when the call connects. Note: You may need to enter a pause (p) or a wait (w) before the + in order to account for delays in the automated system answering your call (for example, 214-555-1234p+3).
SELECT A SYSTEM Your phone can operate in residential, private, and public systems (such as your home system). You can choose how your phone selects a network to use. Your phone may not show the options described here. For information, contact your service provider. Search for a network Press Menu 5 (System). You have the following three options:
Automatic: Your phone automatically searches for available networks and chooses the appropriate one. Every time you turn on your phone, it resets to Automatic.
Manual: The phone searches for networks and then shows a list of the ones that are available. If an available network is found, Available: appears on the screen, followed by the name of the network. To choose the network listed, press OK.
New search: Your phone begins a new search for both private and residential systems. When it finds the best system available, the phone shows the system name. If the phone doesnt find another system, the question Perform an extended search? will appear. Press OK if you wish to continue searching. Select a public system When you take your phone outside its home system, the phone is said to be roaming. The phone can search for home-type systems (that is, systems of the same type as your home system). Or, the phone can search for non-home-type systems. Your service provider programs a list of preferred systems into your phone. These are systems with which your service provider has roaming agreements. Your phone looks for these systems when youre roaming. Note: The options described here may not be available for your phone. Contact your service provider for information. 1 Press Menu 4-6-7 (Settings > Network services > Public system selection) to tell your phone how to choose a public system (network). Your selection remains active until you change it. 64 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 65 Wednesday, May 28, 2003 4:10 PM 2 Scroll to one of the following options, then press Select. Any system: When service is not available in your home system, the phone searches for a preferred system of either type and then searches for a home-
type system. Then it searches for a nonhome-type system. The search continues until your phone finds a system that can be used. Home type: When service is not available in your home system, the phone searches for a home-type system first. However, if a nonhome-type system is found, your phone will use that system. Nonhome type: The phone searches for a nonhome-type system only. The home-type system is not used. Home only: The phone uses only its home system. It will not roam. Select digital or analog Your phone can work in both digital and analog modes. The default mode is both digital and analog, which appears on your phone as Digital & analog when you press Menu 4-6-8 (Settings > Network services > Digital/analog selection). The menu options for choosing the mode you prefer are:
Your phone uses both digital and analog voice channels. The phone always tries to find a digital voice channel first, but if a digital voice channel is not available, the phone looks for an analog voice channel. Digit. & analog Analog Digital Note: This feature is available only for certain phones. Contact your service provider for more information. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 66 Wednesday, May 28, 2003 4:10 PM Security 10 Security Your phone is equipped with different security features that allow you to do the following:
Avoid making accidental calls Prevent unauthorized users from changing certain feature settings on your phone Restrict outgoing or incoming calls
USE KEYGUARD Keyguard disables your keypad to prevent accidental key presses. LOCK THE KEYPAD To lock the keys, press Menu then *. UNLOCK THE KEYPAD To unlock the keys, press Unlock then *. Note: When Keyguard is on, calls may be possible to emergency numbers
(for example, 911 or other official emergency number). Key in the emergency number and press the Talk key. The number is displayed only after you have keyed in its last digit. Answer a call while Keyguard is active You can answer calls when Keyguard is activated by pressing Answer or the Talk key. If you are connected to a headset or loopset, press and hold the End key to end the call. NOTES ABOUT KEYGUARD
After you end the call, Keyguard automatically becomes active again. If you need the phones lights while Keyguard is on, press the Power key to quickly switch the lights on for 15 seconds. Connecting your phone to a car kit automatically disables Keyguard.
66 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 67 Wednesday, May 28, 2003 4:10 PM
UNDERSTAND THE SECURITY CODE The Security code prevents unauthorized users from changing certain important feature settings on your phone. When the phone requires this code, it displays a prompt asking you to enter a Security code. The five-digit default Security code that comes with your phone is 12345. Nokia recommends that you change the default code immediately. Note: If you enter an incorrect security code five times in a row, the phone will not accept the correct code for 5 minutes. Change your security code 1 2 Press Menu 4-5-2 (Settings > Security settings > Change security code). At the Security code prompt, enter your five-digit default security code
(12345) or your current security code and press OK. At the Enter new security code prompt, enter your new five-digit security code and press OK. At the Verify new security code prompt, enter your new security code again and press OK. The confirmation Security code changed appears. 3 4 Keep your security code secret and stored in a safe place away from your phone. If you have changed your security code and dont remember the new code, contact your service provider.
RESTRICT CALLS You can create your own list of restrictions to restrict incoming and outgoing calls. To restrict the calls, you apply the appropriate restriction as desired. The maximum number of call restrictions you can define is ten. Before you define restrictions for outgoing calls, Add restriction is the only available option. After you use the Add restriction option to add at least one restriction, the following options become available:
Select: Allows you to select call restrictions from the outgoing calls list. Add restriction: Allows you to add a new restriction. Edit: Allows you to edit an existing call restriction. Delete: Allows you to delete an existing call restriction. Note: When calls are restricted, calls may be possible to the emergency number programmed into your phone (for example, 911 or other official emergency number). For example, you could dial 911 and press the Talk key. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 68 Wednesday, May 28, 2003 4:10 PM Security Add a number to the call restriction list 1 Press Menu 4-5-1-1 (Settings > Security settings > Call restrictions >
Restrict outgoing calls). Enter your security code, then press OK. Scroll to Restrict outgoing calls, then press Select. Scroll to Add restriction and press Select. At the number prompt, enter the number you want to restrict, and press OK. For example, if you want to restrict all long distance calls that begin with 1, enter 1. If you want to restrict all calls that begin with 972, enter 972. Enter a name for the restriction, then press OK. If you press OK without entering a name, the number will be used. Restrict outgoing calls 1 Press Menu 4-5-1-1 (Settings > Security settings > Call restrictions >
Restrict outgoing calls). Enter your security code, then press OK. Scroll to Restrict outgoing calls, then press Select. Scroll to Select to choose from your list of call restrictions. To deactivate a call restriction, highlight the restriction and press Unmark. Scroll to the restriction you want to activate and press Mark. Press Back. At Save changes?, press Yes. To return to the start screen, press the End key. Restrict all incoming calls 1 Press Menu 4-5-1-2 (Settings > Security settings > Call restrictions >
Restrict incoming calls). Enter your security code, then press OK. Scroll to Restrict incoming calls, then press Select. Press Mark to restrict all incoming calls. 2 3 4 5 6 2 3 4 5 6 7 2 3 4 68 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 69 Wednesday, May 28, 2003 4:10 PM 11 Special features This section describes several special features, including transmission of business cards, downloading ringing tones, using the calculator and setting the alarm clock.
USE THE ALARM CLOCK The alarm clock feature is based on your phones internal clock and sounds an alert at a time you specify. The alarm clock works even if you turn your phone off. Set the alarm clock 1 2 Press Menu 4-1-1 (Settings > Time settings > Alarm clock). Enter the alarm time in hh:mm format, then press OK. Step 3 is necessary only if you have selected am/pm format. Select either am or pm, then press Select. 3 Respond to the alarm At the time of the alarm, the phone sounds an alert tone. Pressing Stop or the End key stops the alarm from sounding, and returns you to the start screen. SNOOZING There are several ways you can enable the Snooze feature:
1 2 3 Press the Snooze selection key. Press any key except the End key. Allow the alarm to sound for one minute. Once snooze is enabled, the alarm will sound again in ten minutes. If you press Stop or the End key while snoozing, the alarm will be turned off. Alarm when phone power is off If the alarm time is reached while the phone is off, the phone switches itself on and starts sounding the alarm tone. If you press Stop, the phone asks whether you want to activate the phone for calls. Press No to switch off the phone or Yes to make and receive calls. Note: Do not press Yes when wireless phone use is prohibited or when it may cause interference or danger. Turn off the alarm clock 1 2 Press Menu 4-1-1 (Settings > Time settings > Alarm clock). Scroll to Off and press Select. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 70 Wednesday, May 28, 2003 4:10 PM Special features
USE THE CALCULATOR The calculator adds, subtracts, multiplies, divides and converts currencies. 1 2 Press Menu 7 (Calculator) Enter the first number in the calculation. To enter a decimal point, press #. Press Clear to delete any mistakes. Press Options and scroll to Add, Subtract, Multiply, or Divide. Press OK. Based upon the type of calculation, you also can use the following shortcut keys:
3 4 If you want to... add subtract multiply divide Press...
(for + symbol) twice (for - symbol)
(for * symbol)
(for / symbol) Enter the second number in the calculation and press Options. Equals appears. Press OK. Repeat steps 2-6 as many times as necessary. 5 6 Your phone must be switched on to use this function. Do not switch the phone on when wireless phone use is prohibited or when it may cause interference or danger. Note: This calculator has a limited accuracy and rounding errors may occur, especially in long divisions. Convert currency You can use the calculator function to set an exchange rate and then calculate prices based on that exchange rate. SET THE EXCHANGE RATE 1 2 Press Menu 7 (Calculator), then press Options. Scroll to Exchange rate, press OK and select one of the following options:
Foreign units converted to home units allows you to enter the number of foreign units to a domestic unit. Home units converted to foreign units allows you to enter the number of domestic units to a foreign unit.
70 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 71 Wednesday, May 28, 2003 4:10 PM 3 Press OK, enter the appropriate exchange rate (press # to enter a decimal point) and press OK. The initial default of 1 is overwritten by any number you enter and the Rate saved confirmation appears. CONVERT A CURRENCY AMOUNT 1 2 3 Press Menu 7 (Calculator). Enter the amount which you wish to convert. Press Options and scroll to one of the following options:
To home converts visited units of currency to home units using the exchange rate. To foreign converts home units of currency to visited units using the exchange rate.
4 Press OK.
BUSINESS CARDS Your phone can send or receive electronic business cards consisting of a name, phone number and e-mail. You can save received business cards in your contact list. This is a network dependent feature. Send a business card 1 2 3 4 Find the name in your contact list. Press Options and scroll to Send bus. card. Press Select. Enter or recall the phone number to which you want to send the business card and press Send. View a received business card When you receive a business card, the phone displays Business card received. 1 When your phone displays Business card received, press Options. 2 Show is selected. Press Select. 3 Scroll through the available information. Save a viewed business card 1 2 After viewing the business card, press Back, scroll to Save and press Select. At the Name: prompt, edit the name if desired, then press OK. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 72 Wednesday, May 28, 2003 4:10 PM Special features At the Number: prompt, edit the number if desired, then press OK. At the E-mail address prompt, edit the e-mail address if desired, then press OK. 3 4 Delete a viewed business card After viewing the business card:
1 2 3 Press Back. Scroll to Discard, then press Select. Discard business card? appears, press OK.
DOWNLOAD A RINGING TONE You can download up to ten ringing tones to replace the personal entries in your list of ringing tones. Since this is a network dependent feature, methods for downloading ringing tones vary. Some wireless providers allow you to send ringing tones to your phone via the Internet, but may charge for this service. Please contact your wireless service provider for details. Notification of a received ringing tone If you have this service and your phone receives a downloaded ringing tone, your phone displays Ringing tone received. Listen to received ringing tones 1 When your phone shows Ringing tone received, press Options. 2 Playback is selected. Press OK. The phone plays the ringing tone. To stop playing the ringing tone, press Quit. 3 Note: An incoming call or pressing any key stops the ringing tone from playing. Save a received ringing tone 1 2 3 After listening to the ringing tone, press Quit. Scroll to Save tone. Press OK. Choose which ringing tone you want to replace either an empty Personal location, if any are remaining, or a previously downloaded tone. Discard a received ringing tone After listening to the ringing tone, press Quit. 1 2 Scroll to Discard tone, then press OK. 72 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 73 Wednesday, May 28, 2003 4:10 PM 12 Prepaid services With prepaid service, you buy wireless network services in advance. Your phone works the same way it did before, with some additional features. Since prepaid service may not be available from your wireless service provider, the Prepaid screen may not appear. Contact your service provider for details.
MANAGE PREPAID SERVICE After you sign up with your service provider for prepaid service, you can activate the Prepaid menu in your phone. This menu appears on your screen only if youve activated the service. ACTIVATE PREPAID To activate prepaid services, enter the following sequence: *#7766#
DEACTIVATE PREPAID To deactivate prepaid services, enter the following sequence:*#77633#
USE THE MENU
To use the prepaid menu, press Menu and then press the Scroll up key to go immediately to Prepaid. Once you select the prepaid menu, press the Scroll up or Scroll down key to scroll through prepaid options.
CHECK YOUR PREPAID BALANCE You can check the balance remaining in your prepaid account. Contact your service provider for the access number used to check the balance. Note: When no more charging units or currency units are left, calls may only be possible to the emergency number programmed into your phone
(for example, 911 or other official emergency number). 1 2 3 Press Menu 8-1 (Prepaid > Check account balance). At Balance number, enter the balance number and press OK. If you have already saved the balance number under Save access phone numbers, the phone will initiate a call to the saved number. Follow the operator prompts. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 74 Wednesday, May 28, 2003 4:10 PM Prepaid services
ADD MONEY TO YOUR ACCOUNT Call the access number your service provider gave you to add money to your account. For convenience, see Save your access numbers on page 74. 1 2 Press Menu 8-2 (Prepaid > Add money to account). At Replenish no., enter the replenish number and press OK. If you have already saved the replenish number under Save access phone numbers, the phone will initiate a call to the saved number. Follow the operator prompts. 3
CALL CUSTOMER SERVICE You can call the customer service number for your prepaid account. Contact your service provider for the access numbers. 1 2 Press Menu 8-3 (Prepaid > Call customer service). Enter the customer service number your service provider gave you, then press OK. If you have already saved the customer service number under Save access phone numbers, the phone will initiate a call to the saved number. Follow the operator prompts. 3
SAVE YOUR ACCESS NUMBERS You can check your prepaid balance, add money to your account, and call customer service. To do that, you first need to save the correct access numbers in your phone. Contact your service provider for the access numbers. 1 2 3 Press Menu 8-4 (Prepaid > Save access phone numbers). At Save access phone numbers, press Select. Scroll to Replenish phone number, press Select, enter the replenish number from your service provider, then press OK. Scroll to Balance phone number, press Select. Enter the balance number from your service provider, then press OK. Scroll to Customer service phone number, then press Select. Enter the customer service number from your service provider, then press OK. 4 5 6 7 74 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 75 Wednesday, May 28, 2003 4:10 PM
EXPIRATION DATE You can store and edit the expiration date of your prepaid credit each time you add money to your account. Enter and change this date manually. 1 2 3 Press Menu 8 (Prepaid). Scroll to Expiration date, then press Select. Enter the expiration date, then press OK. To simply view the current expiration date that you have entered, press Menu 8-5 (Prepaid > Expiration date). Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 76 Wednesday, May 28, 2003 4:10 PM Games 13 Games You can use your phone for communication and some serious fun. Your phone offers three games:
Snake II Space impact Pairs II Note: Your phone must be switched on to use this function. Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger.
START A NEW GAME Press Menu 6 (Games) Scroll to the desired game and press Select. Select New game, then press Select. 1 2 3 Additional options under each game include:
Option What it does Continue New Game Level
(Snake II and Pairs II only) Continue a game that was stopped. Start a new game. Choose the games difficulty level. Mazes
(Snake II only) Top score Instructions Choose among different maze designs. Display the top score. Learn how to play the game. Time trial (Pairs II only) Puzzle (Pairs II only) To advance to the next level, you must pair up all tiles before the dynamite fuse runs out. Reveal pictures to find pairs with as few tries as possible. 76 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 77 Wednesday, May 28, 2003 4:10 PM Please visit Nokia games services on the Internet for more hints and tips at:
www.nokia.com/us. GAME SETTINGS Game sounds and lights can be turned on or off. To access the Settings menu, press Menu 6-4 (Games > Settings).
SNAKE II Feed the snake with as many goodies as possible and watch it grow. Press Menu 6-1. To turn the snake toward the food, press 2, 4, 6, and 8. The longer the snakes tail grows, the higher your score. You can choose to have a clear field, or select from five different mazes. If the snake runs into its own tail or the surrounding wall, found in one of the maze levels, the game is over.
SPACE IMPACT Use your weapons to survive alien attacks. When you defeat all the enemies, you progress to the next level. Press Menu 6-2.
To move up and down, press 8 and 0. To move to the left and right, press * and #. To fire the main weapons, press 1 or 3. To fire the bonus weapons, press 4 or 6.
PAIRS II The object of the game is to uncover the pictures to find pairs in as few tries as possible. Press Menu 6-3 and choose between Time Trial and Puzzle. Move the cursor with keys 2, 4, 5, and 8. To reveal the pictures, press 5. When playing in Time trial mode, you must match all the pairs before the dynamite fuse runs out in order to advance to the next level. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 78 Wednesday, May 28, 2003 4:10 PM Minute Manager 14 Minute Manager With Minute Manager service, you cap monthly spending of cellular service. This section describes how you can use your Minute Manager menu to manage your cellular account. Since this service may not be available from your wireless service provider, the Minute Mgr. screen may not appear. Contact your service provider for details. Note: The actual invoice for calls and services from your service provider may vary, depending upon network features, rounding-off for billing, taxes, and so forth.
CHECK YOUR CALL INFORMATION You can check information on charges, minutes and messages. To access this information press Menu 9-1 (Minute Mgr. > My calls). My charges My charges allows you to view your current call charges. You can view the current charges for all calls made this billing cycle, or you can view the charge for the last call you made. My charges information is approximate. The actual charges and minutes will be listed on your monthly bill. To view your charges:
1 Press Menu 9-1-1 (Minute Mgr. > My calls > My charges). Scroll to Current or My last call. 2 Press Select to view the charges. Press Back to return to the previous screen. 3 Note: If you exceed your Minute Manager limit, calls may only be possible to the emergency number programmed into your phone (for example, 911 or other official emergency number). You can also call 611 and the customer service number for your Minute Manager account. My minutes You can check the minutes youve used in the current billing cycle, as well as the number of anytime minutes remaining in your plans package. This information is for regular plan minutes. It does not include information on long distance calls or SMS messages. To view your minutes:
1 Press Menu 9-1-2 (Minute Mgr. > My calls > My minutes). 78 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 79 Wednesday, May 28, 2003 4:10 PM Scroll to Minutes used or Package mins. Press Select to view the number of minutes. 2 3 My data You can check the total number of SMS messages you have sent and received. This number includes any free messages provided by your plan. Press Menu 9-1-3 (Minute Mgr. > My calls > My data). 1 2 Scroll to Messages sent or Msgs received. Press Select to view the number of messages. 3
CHECK YOUR ACCOUNT INFORMATION You can check information on your current bill, limit and rate plan. To access this information press Menu 9-2 (Minute Mgr. > My account). My bill Bill information is updated by your service provider and reflects the current amount owed. To view your current bill, press Menu 9-2-1 (Minute Mgr. > My account >
My bill). My bill date The bill date is the date when the next bill cycle starts. To view your bill date, press Menu 9-2-2 (Minute Mgr. > My account >
My bill date). My limit You can view the spending limit of your account. This amount is set by your service provider during account activation and is independent of any balance information. Contact your service provider for more information. To view your limit, press Menu 9-2-3 (Minute Mgr. > My account > My limit). My rate plan This menu provides information about your current rate plan. Press Menu 9-2-4 (Minute Mgr. > My account > My rate plan). Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 80 Wednesday, May 28, 2003 4:10 PM Minute Manager My number To view your mobile number, press Menu 9-2-5 (Minute Mgr. > My account >
My number).
CUSTOMER CARE You can call the customer care number for your Minute Manager account. This is the same number you will call to make a payment. The customer care number may be pre-programmed in your phone. If not, contact your service provider for the number. Make a payment You can follow these steps to contact customer service and to make a payment. 1 2 When Make payment is highlighted, press Select. The customer care number Press Menu 9-3 (Minute Mgr. > Customer care). will appear on the screen. Press Call to dial the number. 3 80 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 81 Wednesday, May 28, 2003 4:10 PM 15 Reference information This section provides information about your phones batteries, accessories, chargers, safety guidelines and technical information. Be aware that the information in this section is subject to change as batteries, chargers, and accessories change.
BATTERY STATEMENTS Charging and discharging Your phone is powered by a rechargeable battery. Note that a new battery's full performance may be achieved only after two or three complete charge and discharge cycles!
The battery can be charged and discharged hundreds of times but it will eventually wear out. When the operating time (talk time and standby time) is noticeably shorter than normal, it is time to buy a new battery. Use only batteries approved by the phone manufacturer and recharge your battery only with the chargers approved by the manufacturer. Unplug the charger when not in use. Do not leave the battery connected to a charger for longer than a week, since overcharging may shorten its lifetime. If left unused, a fully charged battery will discharge itself over time. Temperature extremes can affect the ability of your battery to charge; allow it to cool down or warm up first. For good operation times with NiMH batteries, discharge the battery from time to time by leaving your phone switched on until it turns itself off (or by using the battery discharge facility of any approved accessory available for your phone). Do not attempt to discharge the battery by any other means. Use the battery only for its intended purpose. Never use any charger or battery which is damaged or worn out. Do not short-circuit the battery. Accidental short-circuiting can occur when a metallic object (coin, clip, or pen) causes direct connection of the + and - terminals of the battery (metal strips on the battery), for example, when you carry a spare battery in your pocket or purse. Short-circuiting the terminals may damage the battery or the connecting object. Leaving the battery in hot or cold places, such as in a closed car in summer or winter conditions, will reduce the capacity and lifetime of the battery. Always try to keep the battery between 59F and 77F (15C and 25C). A phone with a hot or cold battery may temporarily not work, even when the battery is fully charged. Batteries' performance is particularly limited in temperatures well below freezing. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 82 Wednesday, May 28, 2003 4:10 PM Reference information Do not dispose of batteries in a fire!
Dispose of batteries according to applicable local regulations (for example, recycling). Do not dispose of as household waste. Note: For information on how to charge and recharge your battery, refer to Important battery information on page 12.
PROPER CARE AND MAINTENANCE Your phone is a product of superior design and craftsmanship and should be treated with care. The suggestions below will help you to fulfill any warranty obligations and to enjoy this product for many years:
Keep the phone and all its parts and accessories out of the reach of small children. Keep the phone dry. Precipitation, humidity and all types of liquids or moisture can contain minerals that will corrode electronic circuits. Do not use or store the phone in dusty, dirty areas. Its moving parts can be damaged. Do not store the phone in hot areas. High temperatures can shorten the life of electronic devices, damage batteries, and warp or melt certain plastics. Do not store the phone in cold areas. When it warms up (to its normal temperature), moisture can form inside and may damage electronic circuit boards. Do not attempt to open the phone. Nonexpert handling may damage it. Do not drop, knock, or shake the phone. Rough handling can break internal circuit boards. Do not use harsh chemicals, cleaning solvents, or strong detergents to clean the phone. Do not paint the phone. Paint can clog the moving parts and prevent proper operation. Use only the supplied or an approved replacement antenna. Unauthorized antennas, modifications, or attachments could damage the phone and may violate regulations governing radio devices.
All of the above suggestions apply equally to your phone, battery, charger or any accessory. If any of them are not working properly, take them to your nearest qualified service facility. The personnel there will assist you, and if necessary, arrange for service. 82 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 83 Wednesday, May 28, 2003 4:10 PM
IMPORTANT SAFETY INFORMATION This section provides additional safety information. A brief overview of safety can be found in For your safety on page 1. Traffic safety Do not use a hand-held telephone while driving a vehicle. Always secure the phone in its holder; do not place the phone on the passenger seat or where it can break loose in a collision or sudden stop. Remember road safety always comes first!
Operating environment Remember to follow any special regulations in force in any area and always switch off your phone whenever it is forbidden to use it, or when it may cause interference or danger. Use the phone only in its normal operating positions. Parts of the phone are magnetic. Metallic materials may be attracted to the phone, and persons with a hearing aid should not hold the phone to the ear with the hearing aid. Always secure the phone in its holder, because metallic materials may be attracted by the earpiece. Do not place credit cards or other magnetic storage media near the phone, because information stored on them may be erased. Electronic devices Most modern electronic equipment is shielded from radio frequency (RF) signals. However, certain electronic equipment may not be shielded against the RF signals from your wireless phone. PACEMAKERS Pacemaker manufacturers recommend that a minimum separation of 6-8 inches
(20 cm) be maintained between a hand-held wireless phone and a pacemaker to avoid potential interference with the pacemaker. These recommendations are consistent with the independent research by and recommendations of Wireless Technology Research. Persons with pacemakers:
Should always keep the phone more than 6 inches (20 cm) from their pacemaker when the phone is switched on Should not carry the phone in a breast pocket Should use the ear opposite the pacemaker to minimize the potential for interference. If you have any reason to suspect that interference is taking place, switch off your phone immediately.
Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 84 Wednesday, May 28, 2003 4:10 PM Reference information HEARING AIDS Some digital wireless phones may interfere with some hearing aids. In the event of such interference, you may want to consult your service provider. Other medical devices Operation of any radio transmitting equipment, including cellular phones, may interfere with the functionality of inadequately protected medical devices. Consult a physician or the manufacturer of the medical device to determine if they are adequately shielded from external RF energy or if you have any questions. Switch off your phone in health care facilities when any regulations posted in these areas instruct you to do so. Hospitals or health care facilities may be using equipment that could be sensitive to external RF energy. Vehicles RF signals may affect improperly installed or inadequately shielded electronic systems in motor vehicles (for example, electronic fuel injection systems, electronic antiskid/
antilock braking systems, electronic speed control systems, air bag systems). Check with the manufacturer or its representative regarding your vehicle. You should also consult the manufacturer of any equipment that has been added to your vehicle. POSTED FACILITIES Switch your phone off in any facility where posted notices so require. Potentially explosive atmospheres Switch off your phone when in any area with a potentially explosive atmosphere and obey all signs and instructions. Sparks in such areas could cause an explosion or fire resulting in bodily injury or even death. Users are advised to switch off the phone when at a refuelling point (service station). Users are reminded of the need to observe restrictions on the use of radio equipment in fuel depots (fuel storage and distribution areas), chemical plants, or where blasting operations are in progress. Areas with a potentially explosive atmosphere are often but not always clearly marked. They include below deck on boats; chemical transfer or storage facilities;
vehicles using liquefied petroleum gas (such as propane or butane); areas where the air contains chemicals or particles, such as grain, dust, or metal powders; and any other area where you would normally be advised to turn off your vehicle engine. Vehicles Only qualified personnel should service the phone or install the phone in a vehicle. Faulty installation or service may be dangerous and may invalidate any warranty which may apply to the unit. Check regularly that all wireless phone equipment in your vehicle is mounted and operating properly. 84 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 85 Wednesday, May 28, 2003 4:10 PM Do not store or carry flammable liquids, gases or explosive materials in the same compartment as the phone, its parts or accessories. For vehicles equipped with an air bag, remember that an air bag inflates with great force. Do not place objects, including both installed or portable wireless equipment in the area over the air bag or in the air bag deployment area. If in-vehicle wireless equipment is improperly installed and the air bag inflates, serious injury could result. FCC regulations prohibit using your phone while in the air. Switch off your phone before boarding an aircraft. The use of wireless telephones in an aircraft may be dangerous to the operation of the aircraft, disrupt the wireless telephone network, and may be illegal. Failure to observe these instructions may lead to suspension or denial of telephone services to the offender, legal action or both.
MAKE EMERGENCY CALLS Important: This phone, like any wireless phone, operates using radio signals, wireless, and landline networks as well as user-programmed functions. Because of this, connections in all conditions cannot be guaranteed. Therefore you should never rely solely upon any wireless phone for essential communications (for example, medical emergencies). 3 Emergency calls may not be possible on all wireless phone networks or when certain network services and/or phone features are in use. Check with local service providers. To make an emergency call 1 2 If the phone is not on, switch it on, then check for adequate signal strength. Press the End key as many times as needed (for example, to exit a call, to exit a menu, etc.) to clear the display and ready the phone for calls. Key in the emergency number for your present location (for example, 911 or other official emergency number). Emergency numbers vary by location. Press the Talk key. 4 If certain features are in use, (keyguard, etc.) you may first need to turn those features off before you can make an emergency call. Consult this user guide and your local wireless service provider. When making an emergency call, remember to give all the necessary information as accurately as possible. Remember that your wireless phone may be the only means of communication at the scene of an accident - do not end the call until given permission to do so. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 86 Wednesday, May 28, 2003 4:10 PM Reference information Certification Information (SAR) THIS MODEL PHONE MEETS THE GOVERNMENTS REQUIREMENTS FOR EXPOSURE TO RADIO WAVES. Your wireless phone is a radio transmitter and receiver. It is designed and manufactured not to exceed the emission limits for exposure to radio frequency (RF) energy set by the Federal Communications Commission of the U.S. Government. These limits are part of comprehensive guidelines and establish permitted levels of RF energy for the general population. The guidelines are based on standards that were developed by independent scientific organizations through periodic and thorough evaluation of scientific studies. The standards include a substantial safety margin designed to assure the safety of all persons, regardless of age and health. The exposure standard for wireless mobile phones employs a unit of measurement known as the Specific Absorption Rate, or SAR. The SAR limit set by the FCC is 1.6W/kg.* Tests for SAR are conducted using standard operating positions accepted by the FCC with the phone transmitting at its highest certified power level in all tested frequency bands. Although the SAR is determined at the highest certified power level, the actual SAR level of the phone while operating can be well below the maximum value. This is because the phone is designed to operate at multiple power levels so as to use only the power required to reach the network. In general, the closer you are to a wireless base station antenna, the lower the power output. Before a phone model is available for sale to the public, it must be tested and certified to the FCC that it does not exceed the limit established by the government-
adopted requirement for safe exposure. The tests are performed in positions and locations (for example, at the ear and worn on the body) as required by the FCC for each model. The highest SAR value for this model phone as reported to the FCC:
When tested for use at the ear -
FCCID # GMLRH-40 is 1.23 W/kg FCCID # GMLRH-39 is 1.08 W/kg When worn on the body, as described in this user guide:
FCCID # GMLRH-40 is 1.18W/kg FCCID # GMLRH-39 is 0.96 W/kg
(Body-worn measurements differ among phone models, depending upon available accessories and FCC requirements). While there may be differences between the SAR levels of various phones and at various positions, they all meet the government requirement. 86 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 87 Wednesday, May 28, 2003 4:10 PM The FCC has granted an Equipment Authorization for this model phone with all reported SAR levels evaluated as in compliance with the FCC RF exposure guidelines. SAR information on this model phone is on file with the FCC and can be found under the Display Grant section of http://www.fcc.gov/oet/fccid after searching on FCC ID GMLRH-40 and GMLRH-39. For body worn operation, this phone has been tested and meets the FCC RF exposure guidelines for use with an accessory that contains no metal and that positions the handset a minimum of 5/8 inch (1.5 cm) from the body. Use of other accessories may not ensure compliance with FCC RF exposure guidelines. If you do not use a body-worn accessory and are not holding the phone at the ear, position the handset a minimum of 5/8 inch (1.5 cm) from your body when the phone is switched on.
*In the United States and Canada, the SAR limit for mobile phones used by the public is 1.6 watts/kilogram (W/kg) averaged over one gram of tissue. The standard incorporates a substantial margin of safety to give additional protection for the public and to account for any variations in measurements. SAR values may vary depending on national reporting requirements and the network band. For SAR information in other regions please look under product information at www.nokia.com/us. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 88 Wednesday, May 28, 2003 4:10 PM Reference information
ACCESSORY SAFETY This section provides information about the phones batteries, chargers, and accessories. Be aware that the information in this section is subject to change as the batteries, chargers, and accessories change. Check the model number of any charger before use with this phone. This device is intended for use when supplied with power from an ACP-7, ACP-8, ACP-12 or LCH-9 charger. Warning: Use only Nokia original accessories or batteries, chargers, and accessories approved by Nokia, for use with this Nokia phone model. The use of any other types may invalidate any approval or warranty applying to the phone, and may be dangerous. For availability of approved accessories, please check with your dealer. When you disconnect the power cord of any accessory, grasp and pull the plug, not the cord. When you are not using a charger, disconnect it from the power source. When the battery is running out of power and your phone only has a few minutes of talk time remaining, a warning tone sounds and the Battery low message appears briefly. When no more talk time is left, a warning tone is sounded and the phone switches itself off. Practical rules for accessory operation
When you disconnect the power cord of any accessory, grasp and pull the plug, Keep all accessories out of reach of small children.
not the cord. Check regularly that any vehicle-installed accessories are mounted and are operating properly. Installation of any complex car accessories must be made by qualified personnel only. Use only batteries, chargers, and accessories that have been approved by the phone manufacturer. The use of any other types could invalidate any approval or warranty applying to the phone and could be dangerous. Refer to Accessory safety on page 88 for important battery usage information. 88 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 89 Wednesday, May 28, 2003 4:10 PM Batteries This section provides information about the phones battery. Be aware that the information in this section is subject to change. Note: Dispose of used batteries in accordance with any local regulations. The tables shown in this section provide information about the batteries that are available for your phone, charging times with the Rapid Travel Charger (ACP-8 and ACP-12), the Standard Travel Charger (ACP-7), talk times, and standby times. Consult your service provider for more information. Charging times The charging times listed below are approximate. Battery option ACP-7 Charger ACP-8 Charger BMC-3 NiMH Battery 900 mAh up to 4 hours up to 2 hours ACP-12 Charger up to 1 hour, 40 minutes Standby and talk times Battery talk and standby times are estimates only and depend on signal strength, network conditions, features used, battery age and condition (including the effect of charging habits), temperatures to which the battery is exposed, use in digital mode, and many other factors. Please note that the amount of time a phone is used for calls will affect its standby time. Likewise, the amount of time that the phone is turned on and in standby mode will affect its talk time. Battery option BMC-3 NiMH Battery 900 mAh BLC-2 Li-Ion Battery 950 mAh Talk time Standby Time Digital Analog Digital up to 5 hours up to 2 hours up to 15 days up to 5 hours up to 2 hours up to 16 days Analog up to 2 days up to 2 days Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 90 Wednesday, May 28, 2003 4:10 PM Reference information
ACCESSORIES If you want to enhance the functionality of your phone, a range of accessories is available for you. You can select any of these items to help accommodate your specific communication needs. For availability of these and other accessories, contact your service provider. Warning: Use only Nokia original accessories, or batteries, chargers and accessories approved by Nokia, for use with this Nokia phone model. The use of any other types may invalidate any approval or warranty applying to the phone, and may be dangerous. 900 mAh NiMH Battery (BMC-3) Provides up to 5 hours of digital talk time and up to 15 days of digital standby time. Provides up to 2 hours of analog talk time and up to 2 days of analog standby time. Note: Operation times are estimates and may vary depending on network conditions, charging and phone use. 950 mAh Li-Ion Battery (BLC-2)) Provides up to 5 hours of digital talk time and up to 16 days of digital standby time. Provides up to 2 hours of analog talk time and up to 2 days of analog standby time. Note: Operation times are estimates and may vary depending on network conditions, charging and phone use. 90 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 91 Wednesday, May 28, 2003 4:10 PM Standard Travel Charger (ACP-7) The Standard Travel Charger is a lightweight (187 g) and durable AC charger. To use the Standard Travel Charger, plug it into a standard 120 V AC wall outlet and connect the lead from the charger to the base of your phone. Note: If the battery is completely empty, you cannot use the phone until it has enough charge to operate. Rapid Travel Charger (ACP-8) The Rapid Travel Charger is a lightweight (100 g) and durable AC charger. Calls can be made during charging, even with a fully discharged battery. To use the Rapid Travel Charger (ACP-8), plug it into a standard 120- or 220-Vac wall outlet, and connect the lead from the charger to the base of your phone. Approximate charging times for discharged batteries are shown in Charging times on page 89. Rapid Travel Charger (ACP-12) The Rapid Travel Charger is a lightweight and durable AC charger. Calls can be made during charging, even with a fully discharged battery. To use the Rapid Travel Charger (ACP-12), plug it into a standard 120- or 220-Vac wall outlet, and connect the lead from the charger to the base of your phone. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 92 Wednesday, May 28, 2003 4:10 PM Reference information Rapid Cigarette Lighter Charger (LCH-9) You can charge your phones battery from your vehicle battery by using the Rapid Cigarette Lighter Charger (LCH-9). Calls are possible during charging. A green light indicates that the charger is ready for charging. The battery charging times are the same as those for the Rapid Travel Charger (ACP-8). The input voltage range is from 11-24 Vdc, negative grounding. Avoid prolonged charging with the Rapid Cigarette Lighter Charger (LCH-9) when the car engine is not running; this could cause your car battery to drain. Note also, that in some cars, the cigarette lighter plug is not provided with electricity if the ignition is not switched on. Spare Battery Charger (DDC-1) Lightweight and stylish, this charger provides a convenient way to charge your spare battery. This charger is compatible with the Standard Travel Charger (ACP-7) and the Rapid Travel Charger (ACP-8). Headset (HDC-5) Small and lightweight, the headset allows easy and convenient hands-free operation. The headset has a foam earpiece cover for a comfortable fit and has a clip to hold it firmly in place. This headsets 4-wire 2.5 mm plug fits directly into the bottom of the phone. A remote control button located in the microphone makes the headset convenient to use while answering or receiving calls. 92 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 93 Wednesday, May 28, 2003 4:10 PM Headset (HDE-2) Small and lightweight, the headset allows easy and convenient hands-free operation. This headset comes with a clip for a comfortable fit. This headsets 4-wire 2.5 mm plug fits directly into the bottom of your phone. Boom Headset (HDB-5) Compact and functional, the Boom Headset provides you with convenient, portable hands-free facility. A new and modern over the ear concept with a stylish design and basic hands-free functionality, including the answer/end button. This headsets 4-wire 2.5 mm plug fits directly into the bottom of your phone. Retractable Headset Kit
(HDC-10) Compact and functional, this headset provides you with convenient, portable, hands-free operation. The retractable mechanism and remote control provide easy operation. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 94 Wednesday, May 28, 2003 4:10 PM Reference information Loopset (LPS-3) With the Nokia Loopset, people who use a T-coil equipped hearing aid have the freedom to talk on a digital mobile phone. The loopset goes around your neck - so it can be worn comfortably and discreetly. TTY/TDD Adapter (HDA-9) The TTY/TDD Adapter is a Nokia accessory that allows you to connect your mobile phone to a Telecommunications Device for the Deaf
(TTY/TDD) to make a call in digital mode. WHAT YOULL NEED Here is what youll need for TTY/TDD communication.
TTY/TDD Adapter A TTY/TDD device that is cellular ready or cellular compatible A cable for connecting the TTY/TDD to your phone, usually supplied by the manufacturer of the TTY/TDD device. The TTY/TDD Adapter (HDA-9), which can be purchased separately as an accessory at www.nokia.com/us.
Mobile Holder (MBC-6) Small and easy to use, the Mobile Holder provides an ideal place to hold the phone in a vehicle. The Mobile Holder is easy to attach to the dashboard via a mounting plate or swivel. The Mobile Holder is compatible with the Rapid Cigarette Lighter Charger (LCH-9) and the Express Car Kit (PPH-1). 94 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 95 Wednesday, May 28, 2003 4:10 PM Express Car Kit
(CARK-125) This car kit provides charging and hands-
free functionality. With excellent audio quality, the car kit is easy to use and is compatible with 12 V systems. The Express Car Kit includes a holder and plug-in, hands-free, external microphone. Express Car Kit (PPH-1) The Express Car Kit provides charging and hands-free functionality. Compatible with 12 V systems, the Express Car Kit plugs into the cigarette lighter socket for charging. A green light indicates readiness for charging. The Express Car Kit has a built in speaker and uses the phones microphone. The Express Car Kit also has a connector for an optional external microphone (HFM-8). The microphone should be installed 20 inches apart from the external speaker. The Express Car Kit requires no screws for installation and thus can be moved easily from car to car. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 96 Wednesday, May 28, 2003 4:10 PM Reference information Full Car Kit
(CARK-134) The Full Car Kit (CARK-134) offers a convenient hands-free option, automatic charging facility, transmission capacity with external antenna connection and car radio mute. The Full Car Kit contains the following:
MKU-1 Mounting Plate
HFM-8 Handsfree Microphone HFS-12 External Handsfree Speaker PCH-4J Power Cable HHS-9 Swivel Mount HFU-5 Junction Box Nokia Xpress-on color covers The Xpress-on cover is available in several fashion colors. Extra covers may be purchased from your authorized Nokia dealer. Note: Before changing the cover, always switch off the power and disconnect the phone from the charger or any other device. Always store the phone with covers attached. REMOVE THE BACK COVER 1 Switch off the power and disconnect the phone from the charger or any other device. Push in the release button on the back of the phone, slide the cover toward the top of the phone, and remove it. REMOVE THE FRONT COVER 1 Use the finger rests on each side of the phone and hold the phone face down. 2 While holding the phone, place your finger on the grove between the phone and the cover. Gently pry the front cover away from the phone and lift the phone out of 2 3 96 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 97 Wednesday, May 28, 2003 4:10 PM the cover. Lift the keypad from the inside of the front cover. Place the keypad into the new front cover. REMOVE THE KEYPAD 1 2 REPLACE THE FRONT COVER 1 Slide the top of the phone into the top of the front cover. Be careful to align the power key/IR port with its place in the top of the front cover. Gently push the bottom of the phone into the bottom of the front cover until it snaps into place. 2 REPLACE THE BACK COVER 1 2 Insert the two catches of the back cover in the corresponding slots in the phone. Slide the cover towards the bottom of the phone until it locks into place.
TECHNICAL INFORMATION Feature Specification Weight Volume Frequency Range 4.23 oz with BLC-2 battery 5.17 oz with BMC-3 battery 108 cc Lowband 824.04 - 848.97 MHz (TX) 869.04 - 893.97 MHz (RX) Highband 1850.04 - 1909.92 MHz (TX) 1930.08 - 1989.96 MHz (RX) Transmitter Output Power Up to 600 mW Battery Voltage 3.6 V nominal Operating Temperature
-4F to + 104F
(-20C to + 40C) Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 98 Wednesday, May 28, 2003 4:10 PM Reference information Feature Specification Number of Channels 832 lowband 1997 highband Phone Numbers Up to 3 Contact List Locations Up to 200 98 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 99 Wednesday, May 28, 2003 4:10 PM
TROUBLESHOOTING This section lists some of the most commonly encountered problems and provides possible solutions. Problem Possible cause Possible solution My phone is not charging. The charger and the phone are not properly connected. Securely connect the charger to the phone. My phone is not making or answering calls. I cannot listen to my voice messages. The charger is not properly plugged in. Ensure that the charger is plugged in correctly. The battery is not charged. Charge the battery. The signal strength is too low. If you are indoors, move toward a window. You do not have voice mail service. This is a service provider The voice mail number you have saved is incorrect. You have forgotten your password or are entering in incorrectly. Your voice mail number is not saved in the phone. dependent feature. Please call your wireless service provider. Refer to Save the voice mailbox number on page 38. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 100 Wednesday, May 28, 2003 4:10 PM Reference information Nokia One-Year Limited Warranty Nokia Inc. (Nokia) warrants that this cellular phone (Product) is free from defects in material and workmanship that result in Product failure during normal usage, according to the following terms and conditions:
1 2 3 4 5 6 7 The limited warranty for the Product extends for ONE (1) year beginning on the date of the purchase of the Product. This one year period is extended by each whole day that the Product is out of your possession for repair under this warranty. The limited warranty extends only to the original purchaser (Consumer) of the Product and is not assignable or transferable to any subsequent purchaser/
end-user. The limited warranty extends only to Consumers who purchase the Product in the United States of America. During the limited warranty period, Nokia will repair, or replace, at Nokias sole option, any defective parts, or any parts that will not properly operate for their intended use with new or refurbished replacement items if such repair or replacement is needed because of product malfunction or failure during normal usage. No charge will be made to the Consumer for any such parts. Nokia will also pay for the labor charges incurred by Nokia in repairing or replacing the defective parts. The limited warranty does not cover defects in appearance, cosmetic, decorative or structural items, including framing, and any non-operative parts. Nokias limit of liability under the limited warranty shall be the actual cash value of the Product at the time the Consumer returns the Product for repair, determined by the price paid by the Consumer for the Product less a reasonable amount for usage. Nokia shall not be liable for any other losses or damages. These remedies are the Consumers exclusive remedies for breach of warranty. Upon request from Nokia, the Consumer must prove the date of the original purchase of the Product by a dated bill of sale or dated itemized receipt. The Consumer shall bear the cost of shipping the Product to Nokia in Melbourne, Florida. Nokia shall bear the cost of shipping the Product back to the Consumer after the completion of service under this limited warranty. The Consumer shall have no coverage or benefits under this limited warranty if any of the following conditions are applicable:
a) The Product has been subjected to abnormal use, abnormal conditions, improper storage, exposure to moisture or dampness, unauthorized modifications, unauthorized connections, unauthorized repair, misuse, neglect, abuse, accident, alteration, improper installation, or other acts which are not the fault of Nokia, including damage caused by shipping. 100 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 101 Wednesday, May 28, 2003 4:10 PM b) The Product has been damaged from external causes such as collision with an object, or from fire, flooding, sand, dirt, windstorm, lightning, earthquake or damage from exposure to weather conditions, an Act of God, or battery leakage, theft, blown fuse, or improper use of any electrical source, damage caused by computer or internet viruses, bugs, worms, Trojan Horses, cancelbots or damage caused by the connection to other products not recommended for interconnection by Nokia. c) Nokia was not advised in writing by the Consumer of the alleged defect d) e) or malfunction of the Product within fourteen (14) days after the expiration of the applicable limited warranty period. The Product serial number plate or the accessory data code has been removed, defaced or altered. The defect or damage was caused by the defective function of the cellular system or by inadequate signal reception by the external antenna, or viruses or other software problems introduced into the Product. 8 Nokia does not warrant uninterrupted or error-free operation of the Product. If a problem develops during the limited warranty period, the Consumer shall take the following step-by-step procedure:
a) The Consumer shall return the Product to the place of purchase for repair or replacement processing. If a is not convenient because of distance (more than 50 miles) or for other good cause, the Consumer shall ship the Product prepaid and insured to:
Nokia Inc., Attn: Repair Department 795 West Nasa Blvd. Melbourne, FL 32901 The Consumer shall include a return address, daytime phone number and/
or fax number, complete description of the problem, proof of purchase and service agreement (if applicable). Expenses related to removing the Product from an installation are not covered under this limited warranty. The Consumer will be billed for any parts or labor charges not covered by this limited warranty. The Consumer will be responsible for any expenses related to reinstallation of the Product. b) c) d) e) Nokia will repair the Product under the limited warranty within 30 days after receipt of the Product. If Nokia cannot perform repairs covered under this limited warranty within 30 days, or after a reasonable number of attempts to repair the same defect, Nokia at its option, will provide a replacement Product or refund the purchase price of the Product less a reasonable amount for usage. In some states the Consumer may have the right to a loaner if the repair of the Product takes more than ten (10) days. Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 102 Wednesday, May 28, 2003 4:10 PM Reference information f) Please contact the Customer Service Center at Nokia at the telephone number listed at the end of this warranty if you need a loaner and the repair of the Product has taken or is estimated to take more than ten
(10) days. If the Product is returned during the limited warranty period, but the problem with the Product is not covered under the terms and conditions of this limited warranty, the Consumer will be notified and given an estimate of the charges the Consumer must pay to have the Product repaired, with all shipping charges billed to the Consumer. If the estimate is refused, the Product will be returned freight collect. If the Product is returned after the expiration of the limited warranty period, Nokias normal service policies shall apply and the Consumer will be responsible for all shipping charges. 9 You (the Consumer) understand that the product may consist of refurbished equipment that contains used components, some of which have been reprocessed. The used components comply with Product performance and reliability specifications. 10 ANY IMPLIED WARRANTY OF MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE OR USE, SHALL BE LIMITED TO THE DURATION OF THE FOREGOING LIMITED WRITTEN WARRANTY. OTHERWISE, THE FOREGOING LIMITED WARRANTY IS THE CONSUMERS SOLE AND EXCLUSIVE REMEDY AND IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESS OR IMPLIED. NOKIA SHALL NOT BE LIABLE FOR SPECIAL, INCIDENTAL, PUNITIVE OR CONSEQUENTIAL DAMAGES, INCLUDING BUT NOT LIMITED TO LOSS OF ANTICIPATED BENEFITS OR PROFITS, LOSS OF SAVINGS OR REVENUE, LOSS OF DATA, PUNITIVE DAMAGES, LOSS OF USE OF THE PRODUCT OR ANY ASSOCIATED EQUIPMENT, COST OF CAPITAL, COST OF ANY SUBSTITUTE EQUIPMENT OR FACILITIES, DOWNTIME, THE CLAIMS OF ANY THIRD PARTIES, INCLUDING CUSTOMERS, AND INJURY TO PROPERTY, RESULTING FROM THE PURCHASE OR USE OF THE PRODUCT OR ARISING FROM BREACH OF THE WARRANTY, BREACH OF CONTRACT, NEGLIGENCE, STRICT TORT, OR ANY OTHER LEGAL OR EQUITABLE THEORY, EVEN IF NOKIA KNEW OF THE LIKELIHOOD OF SUCH DAMAGES. NOKIA SHALL NOT BE LIABLE FOR DELAY IN RENDERING SERVICE UNDER THE LIMITED WARRANTY, OR LOSS OF USE DURING THE PERIOD THAT THE PRODUCT IS BEING REPAIRED. 11 Some states do not allow limitation of how long an implied warranty lasts, so the one year warranty limitation may not apply to you (the Consumer). Some states do not allow the exclusion or limitation of incidental and consequential damages, so certain of the above limitations or exclusions may not apply to you
(the Consumer). This limited warranty gives the Consumer specific legal rights and the Consumer may also have other rights which vary from state to state. 102 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 103 Wednesday, May 28, 2003 4:10 PM 12 Nokia neither assumes nor authorizes any authorized service center or any other person or entity to assume for it any other obligation or liability beyond that which is expressly provided for in this limited warranty including the provider or seller of any extended warranty or service agreement. 13 This is the entire warranty between the Nokia and the Consumer, and supersedes all prior and contemporaneous agreements or understandings, oral or written, relating to the Product, and no representation, promise or condition not contained herein shall modify these terms. 14 This limited warranty allocates the risk of failure of the Product between the Consumer and Nokia. The allocation is recognized by the Consumer and is reflected in the purchase price. 15 Any action or lawsuit for breach of warranty must be commenced within eighteen (18) months following purchase of the Product. 16 Questions concerning this limited warranty may be directed to:
Nokia Inc. Attn: Customer Service 7725 Woodland Center Blvd., Ste. 150 Tampa, FL 33614 Telephone: 1-888-NOKIA-2U (1-888-665-4228) Facsimile: (813) 287-6612 TTY/TDD Users Only: 1-800-24-NOKIA (1-800-246-6542) 17 The limited warranty period for Nokia supplied attachments and accessories is specifically defined within their own warranty cards and packaging. Manufactured or sold under one or more of the following US patents:
5001372 5045973 5101175 5124672 5212834 5230091 5233634 5241284 5241583 5266782 5317283 5335362 Pending:
5371481 5390223 5400949 5416435 5430740 5442521 5446364 5471655 5479476 5487084 5493255 5551067 29158527 5553125 5594797 5604921 5606548 5613235 5625274 5677620 5692032 5697074 5734683 5760568 5794142 29158526 5805084 5819165 5822366 5835858 5839101 5842141 5844884 5845219 5857151 5870683 5887262 5892475 29158528 5893060 5903839 5907823 5914796 5920826 5924026 5924038 5953665 5956625 5987406 5987639 5999523 29158485 6006114 6026161 6035194 6043760 6049796 6055439 6060193 6084962 6094587 6097961 6097964 6115617 29158529 6119002 6119003 6128509 6144243 6151485 6151507 6154457 6163609 6164547 6185295 6188909 6219560 29158524 6229996 6269331 6282373 6285888 6286122 6292668 6308084 6310609 6311054 6314166 6324412 Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 104 Wednesday, May 28, 2003 4:10 PM Reference information NOTES 104 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 105 Wednesday, May 28, 2003 4:10 PM Appendix A Message from the CTIA
(Cellular Telecommunications
& Internet Association) to all users of mobile phones.
&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ$OO5LJKWV
5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 106 Wednesday, May 28, 2003 4:10 PM 6DIHW\LVWKHPRVWLPSRUWDQWFDOO\RXZLOOHYHUPDNH
A Guide to Safe and Responsible Wireless Phone Use 7HQVRIPLOOLRQVRISHRSOHLQWKH86WRGD\WDNHDGYDQWDJHRIWKHXQLTXHFRPELQDWLRQ
RIFRQYHQLHQFHVDIHW\DQGYDOXHGHOLYHUHGE\WKHZLUHOHVVWHOHSKRQH4XLWHVLPSO\
WKHZLUHOHVVSKRQHJLYHVSHRSOHWKHSRZHUIXODELOLW\WRFRPPXQLFDWHE\YRLFHDOPRVW
DQ\ZKHUHDQ\WLPHZLWKWKHERVVZLWKDFOLHQWZLWKWKHNLGVZLWKHPHUJHQF\
SHUVRQQHORUHYHQZLWKWKHSROLFH(DFK\HDU$PHULFDQVPDNHELOOLRQVRIFDOOVIURP
WKHLUZLUHOHVVSKRQHVDQGWKHQXPEHUVDUHUDSLGO\JURZLQJ
%XWDQLPSRUWDQWUHVSRQVLELOLW\DFFRPSDQLHVWKRVHEHQHILWVRQHWKDWHYHU\ZLUHOHVV
SKRQHXVHUPXVWXSKROG:KHQGULYLQJDFDUGULYLQJLV\RXUILUVWUHVSRQVLELOLW\$
ZLUHOHVVSKRQHFDQEHDQLQYDOXDEOHWRROEXWJRRGMXGJPHQWPXVWEHH[HUFLVHGDW
DOOWLPHVZKLOHGULYLQJDPRWRUYHKLFOHZKHWKHURQWKHSKRQHRUQRW
7KHEDVLFOHVVRQVDUHRQHVZHDOOOHDUQHGDVWHHQDJHUV'ULYLQJUHTXLUHVDOHUWQHVV
FDXWLRQDQGFRXUWHV\,WUHTXLUHVDKHDY\GRVHRIEDVLFFRPPRQVHQVHNHHS\RXU
KHDGXSNHHS\RXUH\HVRQWKHURDGFKHFN\RXUPLUURUVIUHTXHQWO\DQGZDWFKRXW
IRURWKHUGULYHUV,WUHTXLUHVREH\LQJDOOWUDIILFVLJQVDQGVLJQDOVDQGVWD\LQJZLWKLQ
WKHVSHHGOLPLW,WPHDQVXVLQJVHDWEHOWVDQGUHTXLULQJRWKHUSDVVHQJHUVWRGRWKHVDPH
%XWZLWKZLUHOHVVSKRQHXVHGULYLQJVDIHO\PHDQVDOLWWOHPRUH7KLVEURFKXUHLVD
FDOOWRZLUHOHVVSKRQHXVHUVHYHU\ZKHUHWRPDNHVDIHW\WKHLUILUVWSULRULW\ZKHQEHKLQG
WKHZKHHORIDFDU:LUHOHVVWHOHFRPPXQLFDWLRQVLVNHHSLQJXVLQWRXFKVLPSOLI\LQJRXU
OLYHVSURWHFWLQJXVLQHPHUJHQFLHVDQGSURYLGLQJRSSRUWXQLWLHVWRKHOSRWKHUVLQQHHG
:KHQLWFRPHVWRWKHXVHRIZLUHOHVVSKRQHVVDIHW\LV\RXUPRVWLPSRUWDQWFDOO
Wireless Phone "Safety Tips"
%HORZDUHVDIHW\WLSVWRIROORZZKLOHGULYLQJDQGXVLQJDZLUHOHVVSKRQHZKLFK
VKRXOGEHHDV\WRUHPHPEHU
*HWWRNQRZ\RXUZLUHOHVVSKRQHDQGLWVIHDWXUHVVXFKDVVSHHGGLDODQGUHGLDO
&DUHIXOO\UHDG\RXULQVWUXFWLRQPDQXDODQGOHDUQWRWDNHDGYDQWDJHRIYDOXDEOH
IHDWXUHVPRVWSKRQHVRIIHULQFOXGLQJDXWRPDWLFUHGLDODQGPHPRU\$OVRZRUN
WRPHPRUL]HWKHSKRQHNH\SDGVR\RXFDQXVHWKHVSHHGGLDOIXQFWLRQZLWKRXW
WDNLQJ\RXUDWWHQWLRQRIIWKHURDG
:KHQDYDLODEOHXVHDKDQGVIUHHGHYLFH$QXPEHURIKDQGVIUHHZLUHOHVVSKRQH
DFFHVVRULHVDUHUHDGLO\DYDLODEOHWRGD\:KHWKHU\RXFKRRVHDQLQVWDOOHGPRXQWHG
GHYLFHIRU\RXUZLUHOHVVSKRQHRUDVSHDNHUSKRQHDFFHVVRU\WDNHDGYDQWDJHRI
WKHVHGHYLFHVLIDYDLODEOHWR\RX
3RVLWLRQ\RXUZLUHOHVVSKRQHZLWKLQHDV\UHDFK0DNHVXUH\RXSODFH\RXU
ZLUHOHVVSKRQHZLWKLQHDV\UHDFKDQGZKHUH\RXFDQJUDELWZLWKRXWUHPRYLQJ
\RXUH\HVIURPWKHURDG,I\RXJHWDQLQFRPLQJFDOODWDQLQFRQYHQLHQWWLPHLI
SRVVLEOHOHW\RXUYRLFHPDLODQVZHULWIRU\RX
106 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 107 Wednesday, May 28, 2003 4:10 PM
6XVSHQGFRQYHUVDWLRQVGXULQJKD]DUGRXVGULYLQJFRQGLWLRQVRUVLWXDWLRQV/HW
WKHSHUVRQ\RXDUHVSHDNLQJZLWKNQRZ\RXDUHGULYLQJ LIQHFHVVDU\VXVSHQGWKH
FDOOLQKHDY\WUDIILFRUKD]DUGRXVZHDWKHUFRQGLWLRQV5DLQVOHHWVQRZDQGLFH
FDQEHKD]DUGRXVEXWVRLVKHDY\WUDIILF$VDGULYHU\RXUILUVWUHVSRQVLELOLW\LV
WRSD\DWWHQWLRQWRWKHURDG
'RQRWWDNHQRWHVRUORRNXSSKRQHQXPEHUVZKLOHGULYLQJ,I\RXDUHUHDGLQJDQ
DGGUHVVERRNRUEXVLQHVVFDUGRUZULWLQJDWRGROLVWZKLOHGULYLQJDFDU\RX
DUHQRWZDWFKLQJZKHUH\RXDUHJRLQJ,WVFRPPRQVHQVH'RQWJHWFDXJKWLQD
GDQJHURXVVLWXDWLRQEHFDXVH\RXDUHUHDGLQJRUZULWLQJDQGQRWSD\LQJDWWHQWLRQ
WRWKHURDGRUQHDUE\YHKLFOHV
'LDOVHQVLEO\DQGDVVHVVWKHWUDIILF LISRVVLEOHSODFHFDOOVZKHQ\RXDUHQRWPRYLQJ
RUEHIRUHSXOOLQJLQWRWUDIILF7U\WRSODQ\RXUFDOOVEHIRUH\RXEHJLQ\RXUWULSRU
DWWHPSWWRFRLQFLGH\RXUFDOOVZLWKWLPHV\RXPD\EHVWRSSHGDWDVWRSVLJQUHG
OLJKWRURWKHUZLVHVWDWLRQDU\%XWLI\RXQHHGWRGLDOZKLOHGULYLQJIROORZWKLVVLPSOH
WLSGLDORQO\DIHZQXPEHUVFKHFNWKHURDGDQG\RXUPLUURUVWKHQFRQWLQXH
'RQRWHQJDJHLQVWUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVWKDWPD\EHGLVWUDFWLQJ
6WUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVDQGGULYLQJGRQRWPL[WKH\DUHGLVWUDFWLQJ
DQGHYHQGDQJHURXVZKHQ\RXDUHEHKLQGWKHZKHHORIDFDU0DNHSHRSOH\RX
DUHWDONLQJZLWKDZDUH\RXDUHGULYLQJDQGLIQHFHVVDU\VXVSHQGFRQYHUVDWLRQV
ZKLFKKDYHWKHSRWHQWLDOWRGLYHUW\RXUDWWHQWLRQIURPWKHURDG
8VH\RXUZLUHOHVVSKRQHWRFDOOIRUKHOS<RXUZLUHOHVVSKRQHLVRQHRIWKHJUHDWHVW
WRROV\RXFDQRZQWRSURWHFW\RXUVHOIDQG\RXUIDPLO\LQGDQJHURXVVLWXDWLRQV
ZLWK\RXUSKRQHDW\RXUVLGHKHOSLVRQO\WKUHHQXPEHUVDZD\'LDO RURWKHU
ORFDOHPHUJHQF\QXPEHULQWKHFDVHRIILUHWUDIILFDFFLGHQWURDGKD]DUGRUPHGLFDO
HPHUJHQF\5HPHPEHULWLVDIUHHFDOORQ\RXUZLUHOHVVSKRQH
8VH\RXUZLUHOHVVSKRQHWRKHOSRWKHUVLQHPHUJHQFLHV<RXUZLUHOHVVSKRQHSURYLGHV
\RXDSHUIHFWRSSRUWXQLW\WREHD*RRG6DPDULWDQLQ\RXUFRPPXQLW\,I\RX
VHHDQDXWRDFFLGHQWFULPHLQSURJUHVVRURWKHUVHULRXVHPHUJHQF\ZKHUHOLYHV
DUHLQGDQJHUFDOO RURWKHUORFDOHPHUJHQF\QXPEHUDV\RXZRXOGZDQW
RWKHUVWRGRIRU\RX
&DOOURDGVLGHDVVLVWDQFHRUDVSHFLDOZLUHOHVVQRQHPHUJHQF\DVVLVWDQFHQXPEHU
ZKHQQHFHVVDU\&HUWDLQVLWXDWLRQV\RXHQFRXQWHUZKLOHGULYLQJPD\UHTXLUH
DWWHQWLRQEXWDUHQRWXUJHQWHQRXJKWRPHULWDFDOOIRUHPHUJHQF\VHUYLFHV%XW
\RXVWLOOFDQXVH\RXUZLUHOHVVSKRQHWROHQGDKDQG,I\RXVHHDEURNHQGRZQ
YHKLFOHSRVLQJQRVHULRXVKD]DUGDEURNHQWUDIILFVLJQDODPLQRUWUDIILFDFFLGHQW
ZKHUHQRRQHDSSHDUVLQMXUHGRUDYHKLFOH\RXNQRZWREHVWROHQFDOOURDGVLGH
DVVLVWDQFHRURWKHUVSHFLDOQRQHPHUJHQF\ZLUHOHVVQXPEHU
&DUHOHVVGLVWUDFWHGLQGLYLGXDOVDQGSHRSOHGULYLQJLUUHVSRQVLEO\UHSUHVHQWDKD]DUG
WRHYHU\RQHRQWKHURDG6LQFH WKH&HOOXODU7HOHFRPPXQLFDWLRQV,QGXVWU\
$VVRFLDWLRQDQGWKHZLUHOHVVLQGXVWU\KDYHFRQGXFWHGHGXFDWLRQDORXWUHDFKWRLQIRUP
ZLUHOHVVSKRQHXVHUVRIWKHLUUHVSRQVLELOLWLHVDVVDIHGULYHUVDQGJRRGFLWL]HQV$VZH
DSSURDFKDQHZFHQWXU\PRUHDQGPRUHRIXVZLOOWDNHDGYDQWDJHRIWKHEHQHILWVRI
ZLUHOHVVWHOHSKRQHV$QGDVZHWDNHWRWKHURDGVZHDOOKDYHDUHVSRQVLELOLW\WR
GULYHVDIHO\
Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 108 Wednesday, May 28, 2003 4:10 PM 7KHZLUHOHVVLQGXVWU\UHPLQGV\RXWRXVH\RXUSKRQHVDIHO\ZKHQGULYLQJ
)RUPRUHLQIRUPDWLRQSOHDVHFDOO 6$)(
)RUXSGDWHV KWWS ZZZZRZFRPFRPFRQVXPHULVVXHVGULYLQJ
DUWLFOHVFIP",'
&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ$OO5LJKWV5HVHUYHG
&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
108 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 109 Wednesday, May 28, 2003 4:10 PM Appendix B Message from the FDA
(U.S. Food and Drug Administration) to all users of mobile phones.
-XO\
)RUXSGDWHV KWWS ZZZIGDJRYFGUKSKRQHV Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 110 Wednesday, May 28, 2003 4:10 PM Consumer Update on Wireless Phones U.S. Food and Drug Administration 1. Do wireless phones pose a health hazard?
7KHDYDLODEOHVFLHQWLILFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPVDUH
DVVRFLDWHGZLWKXVLQJZLUHOHVVSKRQHV7KHUHLVQRSURRIKRZHYHUWKDWZLUHOHVV
SKRQHVDUHDEVROXWHO\VDIH:LUHOHVVSKRQHVHPLWORZOHYHOVRIUDGLRIUHTXHQF\
HQHUJ\ 5) LQWKHPLFURZDYHUDQJHZKLOHEHLQJXVHG7KH\DOVRHPLWYHU\ORZOHYHOV
RI5)ZKHQLQWKHVWDQGE\PRGH:KHUHDVKLJKOHYHOVRI5)FDQSURGXFHKHDOWK
HIIHFWV E\KHDWLQJWLVVXH H[SRVXUHWRORZOHYHO5)WKDWGRHVQRWSURGXFHKHDWLQJ
HIIHFWVFDXVHVQRNQRZQDGYHUVHKHDOWKHIIHFWV0DQ\VWXGLHVRIORZOHYHO5)
H[SRVXUHVKDYHQRWIRXQGDQ\ELRORJLFDOHIIHFWV6RPHVWXGLHVKDYHVXJJHVWHGWKDW
VRPHELRORJLFDOHIIHFWVPD\RFFXUEXWVXFKILQGLQJVKDYHQRWEHHQFRQILUPHGE\
DGGLWLRQDOUHVHDUFK,QVRPHFDVHVRWKHUUHVHDUFKHUVKDYHKDGGLIILFXOW\LQ
UHSURGXFLQJWKRVHVWXGLHVRULQGHWHUPLQLQJWKHUHDVRQVIRULQFRQVLVWHQWUHVXOWV
2. What is FDAs role concerning the safety of wireless phones?
8QGHUWKHODZ)'$GRHVQRWUHYLHZWKHVDIHW\RIUDGLDWLRQHPLWWLQJFRQVXPHU
SURGXFWVVXFKDVZLUHOHVVSKRQHVEHIRUHWKH\FDQEHVROGDVLWGRHVZLWKQHZGUXJV
RUPHGLFDOGHYLFHV+RZHYHUWKHDJHQF\KDVDXWKRULW\WRWDNHDFWLRQLIZLUHOHVV
SKRQHVDUHVKRZQWRHPLWUDGLRIUHTXHQF\HQHUJ\ 5) DWDOHYHOWKDWLVKD]DUGRXVWR
WKHXVHU,QVXFKDFDVH)'$FRXOGUHTXLUHWKHPDQXIDFWXUHUVRIZLUHOHVVSKRQHVWR
QRWLI\XVHUVRIWKHKHDOWKKD]DUGDQGWRUHSDLUUHSODFHRUUHFDOOWKHSKRQHVVRWKDW
WKHKD]DUGQRORQJHUH[LVWV
$OWKRXJKWKHH[LVWLQJVFLHQWLILFGDWDGRQRWMXVWLI\)'$UHJXODWRU\DFWLRQV)'$KDV
XUJHGWKHZLUHOHVVSKRQHLQGXVWU\WRWDNHDQXPEHURIVWHSVLQFOXGLQJWKHIROORZLQJ
6XSSRUWQHHGHGUHVHDUFKLQWRSRVVLEOHELRORJLFDOHIIHFWVRI5)RIWKHW\SH
HPLWWHGE\ZLUHOHVVSKRQHV
'HVLJQZLUHOHVVSKRQHVLQDZD\WKDWPLQLPL]HVDQ\5)H[SRVXUHWRWKHXVHU
WKDWLVQRWQHFHVVDU\IRUGHYLFHIXQFWLRQ DQG
&RRSHUDWHLQSURYLGLQJXVHUVRIZLUHOHVVSKRQHVZLWKWKHEHVWSRVVLEOH
LQIRUPDWLRQRQSRVVLEOHHIIHFWVRIZLUHOHVVSKRQHXVHRQKXPDQKHDOWK
)'$EHORQJVWRDQLQWHUDJHQF\ZRUNLQJJURXSRIWKHIHGHUDODJHQFLHVWKDWKDYH
UHVSRQVLELOLW\IRUGLIIHUHQWDVSHFWVRI5)VDIHW\WRHQVXUHFRRUGLQDWHGHIIRUWVDWWKH
IHGHUDOOHYHO7KHIROORZLQJDJHQFLHVEHORQJWRWKLVZRUNLQJJURXS
1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ 1DWLRQDO7HOHFRPPXQLFDWLRQVDQG,QIRUPDWLRQ$GPLQLVWUDWLRQ 7KH1DWLRQDO,QVWLWXWHVRI+HDOWKSDUWLFLSDWHVLQVRPHLQWHUDJHQF\ZRUNLQJJURXS
DFWLYLWLHVDVZHOO
(QYLURQPHQWDO3URWHFWLRQ$JHQF\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ 110 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 111 Wednesday, May 28, 2003 4:10 PM
)'$VKDUHVUHJXODWRU\UHVSRQVLELOLWLHVIRUZLUHOHVVSKRQHVZLWKWKH)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQ )&& $OOSKRQHVWKDWDUHVROGLQWKH8QLWHG6WDWHV
PXVWFRPSO\ZLWK)&&VDIHW\JXLGHOLQHVWKDWOLPLW5)H[SRVXUH)&&UHOLHVRQ)'$
DQGRWKHUKHDOWKDJHQFLHVIRUVDIHW\TXHVWLRQVDERXWZLUHOHVVSKRQHV)&&DOVR
UHJXODWHVWKHEDVHVWDWLRQVWKDWWKHZLUHOHVVSKRQHQHWZRUNVUHO\XSRQ:KLOHWKHVH
EDVHVWDWLRQVRSHUDWHDWKLJKHUSRZHUWKDQGRWKHZLUHOHVVSKRQHVWKHPVHOYHVWKH
5)H[SRVXUHVWKDWSHRSOHJHWIURPWKHVHEDVHVWDWLRQVDUHW\SLFDOO\WKRXVDQGVRI
WLPHVORZHUWKDQWKRVHWKH\FDQJHWIURPZLUHOHVVSKRQHV%DVHVWDWLRQVDUHWKXVQRW
WKHVXEMHFWRIWKHVDIHW\TXHVWLRQVGLVFXVVHGLQWKLVGRFXPHQW
3. What kinds of phones are the subject of this update?
7KHWHUPZLUHOHVVSKRQHUHIHUVKHUHWRKDQGKHOGZLUHOHVVSKRQHVZLWKEXLOWLQ
DQWHQQDVRIWHQFDOOHGFHOOPRELOHRU3&6SKRQHV7KHVHW\SHVRIZLUHOHVVSKRQHV
FDQH[SRVHWKHXVHUWRPHDVXUDEOHUDGLRIUHTXHQF\HQHUJ\ 5) EHFDXVHRIWKHVKRUW
GLVWDQFHEHWZHHQWKHSKRQHDQGWKHXVHUVKHDG7KHVH5)H[SRVXUHVDUHOLPLWHGE\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQVDIHW\JXLGHOLQHVWKDWZHUHGHYHORSHGZLWK
WKHDGYLFHRI)'$DQGRWKHUIHGHUDOKHDOWKDQGVDIHW\DJHQFLHV:KHQWKHSKRQHLV
ORFDWHGDWJUHDWHUGLVWDQFHVIURPWKHXVHUWKHH[SRVXUHWR5)LVGUDVWLFDOO\ORZHU
EHFDXVHDSHUVRQ V5)H[SRVXUHGHFUHDVHVUDSLGO\ZLWKLQFUHDVLQJGLVWDQFHIURPWKH
VRXUFH7KHVRFDOOHGFRUGOHVVSKRQHV ZKLFKKDYHDEDVHXQLWFRQQHFWHGWRWKH
WHOHSKRQHZLULQJLQDKRXVHW\SLFDOO\RSHUDWHDWIDUORZHUSRZHUOHYHOVDQGWKXV
SURGXFH5)H[SRVXUHVIDUEHORZWKH)&&VDIHW\OLPLWV
4. What are the results of the research done already?
7KHUHVHDUFKGRQHWKXVIDUKDVSURGXFHGFRQIOLFWLQJUHVXOWVDQGPDQ\VWXGLHVKDYH
VXIIHUHGIURPIODZVLQWKHLUUHVHDUFKPHWKRGV$QLPDOH[SHULPHQWVLQYHVWLJDWLQJWKH
HIIHFWVRIUDGLRIUHTXHQF\HQHUJ\ 5) H[SRVXUHVFKDUDFWHULVWLFRIZLUHOHVVSKRQHV
KDYH\LHOGHGFRQIOLFWLQJUHVXOWVWKDWRIWHQFDQQRWEHUHSHDWHGLQRWKHUODERUDWRULHV
$IHZDQLPDOVWXGLHVKRZHYHUKDYHVXJJHVWHGWKDWORZOHYHOVRI5)FRXOGDFFHOHUDWH
WKHGHYHORSPHQWRIFDQFHULQODERUDWRU\DQLPDOV+RZHYHUPDQ\RIWKHVWXGLHVWKDW
VKRZHGLQFUHDVHGWXPRUGHYHORSPHQWXVHGDQLPDOVWKDWKDGEHHQJHQHWLFDOO\
HQJLQHHUHGRUWUHDWHGZLWKFDQFHUFDXVLQJFKHPLFDOVVRDVWREHSUHGLVSRVHGWR
GHYHORSFDQFHULQWKHDEVHQFHRI5)H[SRVXUH2WKHUVWXGLHVH[SRVHGWKHDQLPDOVWR
5)IRUXSWRKRXUVSHUGD\7KHVHFRQGLWLRQVDUHQRWVLPLODUWRWKHFRQGLWLRQV
XQGHUZKLFKSHRSOHXVHZLUHOHVVSKRQHVVRZHGRQWNQRZZLWKFHUWDLQW\ZKDWWKH
UHVXOWVRIVXFKVWXGLHVPHDQIRUKXPDQKHDOWK
7KUHHODUJHHSLGHPLRORJ\VWXGLHVKDYHEHHQSXEOLVKHGVLQFH'HFHPEHU
%HWZHHQWKHPWKHVWXGLHVLQYHVWLJDWHGDQ\SRVVLEOHDVVRFLDWLRQEHWZHHQWKHXVH
RIZLUHOHVVSKRQHVDQGSULPDU\EUDLQFDQFHUJOLRPDPHQLQJLRPDRUDFRXVWLF
QHXURPDWXPRUVRIWKHEUDLQRUVDOLYDU\JODQGOHXNHPLDRURWKHUFDQFHUV
1RQHRIWKHVWXGLHVGHPRQVWUDWHGWKHH[LVWHQFHRIDQ\KDUPIXOKHDOWKHIIHFWV
IURPZLUHOHVVSKRQH5)H[SRVXUHV+RZHYHUQRQHRIWKHVWXGLHVFDQDQVZHU
TXHVWLRQVDERXWORQJWHUPH[SRVXUHVVLQFHWKHDYHUDJHSHULRGRISKRQHXVHLQ
WKHVHVWXGLHVZDVDURXQGWKUHH\HDUV
Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 112 Wednesday, May 28, 2003 4:10 PM 5. What research is needed to decide whether RF exposure from wireless phones poses a health risk?
$FRPELQDWLRQRIODERUDWRU\VWXGLHVDQGHSLGHPLRORJLFDOVWXGLHVRISHRSOHDFWXDOO\
XVLQJZLUHOHVVSKRQHVZRXOGSURYLGHVRPHRIWKHGDWDWKDWDUHQHHGHG/LIHWLPH
DQLPDOH[SRVXUHVWXGLHVFRXOGEHFRPSOHWHGLQDIHZ\HDUV+RZHYHUYHU\ODUJH
QXPEHUVRIDQLPDOVZRXOGEHQHHGHGWRSURYLGHUHOLDEOHSURRIRIDFDQFHUSURPRWLQJ
HIIHFWLIRQHH[LVWV(SLGHPLRORJLFDOVWXGLHVFDQSURYLGHGDWDWKDWLVGLUHFWO\DSSOLFDEOH
WRKXPDQSRSXODWLRQVEXWRUPRUH\HDUVIROORZXSPD\EHQHHGHGWRSURYLGH
DQVZHUVDERXWVRPHKHDOWKHIIHFWVVXFKDVFDQFHU7KLVLVEHFDXVHWKHLQWHUYDO
EHWZHHQWKHWLPHRIH[SRVXUHWRDFDQFHUFDXVLQJDJHQWDQGWKHWLPHWXPRUVGHYHORS
LIWKH\GRPD\EHPDQ\PDQ\\HDUV7KHLQWHUSUHWDWLRQRIHSLGHPLRORJLFDOVWXGLHV
LVKDPSHUHGE\GLIILFXOWLHVLQPHDVXULQJDFWXDO5)H[SRVXUHGXULQJGD\WRGD\XVH
RIZLUHOHVVSKRQHV0DQ\IDFWRUVDIIHFWWKLVPHDVXUHPHQWVXFKDVWKHDQJOHDW
ZKLFKWKHSKRQHLVKHOGRUZKLFKPRGHORISKRQHLVXVHG
6. What is FDA doing to find out more about the possible health effects of wireless phone RF?
)'$LVZRUNLQJZLWKWKH861DWLRQDO7R[LFRORJ\3URJUDPDQGZLWKJURXSVRI
LQYHVWLJDWRUVDURXQGWKHZRUOGWRHQVXUHWKDWKLJKSULRULW\DQLPDOVWXGLHVDUH
FRQGXFWHGWRDGGUHVVLPSRUWDQWTXHVWLRQVDERXWWKHHIIHFWVRIH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\ 5)
)'$KDVEHHQDOHDGLQJSDUWLFLSDQWLQWKH:RUOG+HDOWK2UJDQL]DWLRQ,QWHUQDWLRQDO
(OHFWURPDJQHWLF)LHOGV (0) 3URMHFWVLQFHLWVLQFHSWLRQLQ $QLQIOXHQWLDOUHVXOW
RIWKLVZRUNKDVEHHQWKHGHYHORSPHQWRIDGHWDLOHGDJHQGDRIUHVHDUFKQHHGVWKDWKDV
GULYHQWKHHVWDEOLVKPHQWRIQHZUHVHDUFKSURJUDPVDURXQGWKHZRUOG7KH3URMHFWKDV
DOVRKHOSHGGHYHORSDVHULHVRISXEOLFLQIRUPDWLRQGRFXPHQWVRQ(0)LVVXHV
)'$DQGWKH&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ &7,$ KDYHD
IRUPDO&RRSHUDWLYH5HVHDUFKDQG'HYHORSPHQW$JUHHPHQW &5$'$ WRGRUHVHDUFK
RQZLUHOHVVSKRQHVDIHW\)'$SURYLGHVWKHVFLHQWLILFRYHUVLJKWREWDLQLQJLQSXWIURP
H[SHUWVLQJRYHUQPHQWLQGXVWU\DQGDFDGHPLFRUJDQL]DWLRQV&7,$IXQGHG
UHVHDUFKLVFRQGXFWHGWKURXJKFRQWUDFWVWRLQGHSHQGHQWLQYHVWLJDWRUV7KHLQLWLDO
UHVHDUFKZLOOLQFOXGHERWKODERUDWRU\VWXGLHVDQGVWXGLHVRIZLUHOHVVSKRQHXVHUV
7KH&5$'$ZLOODOVRLQFOXGHDEURDGDVVHVVPHQWRIDGGLWLRQDOUHVHDUFKQHHGVLQ
WKHFRQWH[WRIWKHODWHVWUHVHDUFKGHYHORSPHQWVDURXQGWKHZRUOG
7. How can I find out how much radiofrequency energy exposure I can get by using my wireless phone?
$OOSKRQHVVROGLQWKH8QLWHG6WDWHVPXVWFRPSO\ZLWK)HGHUDO&RPPXQLFDWLRQV
&RPPLVVLRQ )&& JXLGHOLQHVWKDWOLPLWUDGLRIUHTXHQF\HQHUJ\ 5) H[SRVXUHV
)&&HVWDEOLVKHGWKHVHJXLGHOLQHVLQFRQVXOWDWLRQZLWK)'$DQGWKHRWKHUIHGHUDO
KHDOWKDQGVDIHW\DJHQFLHV7KH)&&OLPLWIRU5)H[SRVXUHIURPZLUHOHVVWHOHSKRQHV
LVVHWDWD6SHFLILF$EVRUSWLRQ5DWH 6$5 RIZDWWVSHUNLORJUDP :NJ 7KH
)&&OLPLWLVFRQVLVWHQWZLWKWKHVDIHW\VWDQGDUGVGHYHORSHGE\WKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLF(QJLQHHULQJ ,((( DQGWKH1DWLRQDO&RXQFLORQ5DGLDWLRQ
3URWHFWLRQDQG0HDVXUHPHQW7KHH[SRVXUHOLPLWWDNHVLQWRFRQVLGHUDWLRQWKH
ERG\VDELOLW\WRUHPRYHKHDWIURPWKHWLVVXHVWKDWDEVRUEHQHUJ\IURPWKHZLUHOHVV
SKRQHDQGLVVHWZHOOEHORZOHYHOVNQRZQWRKDYHHIIHFWV
112 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 113 Wednesday, May 28, 2003 4:10 PM 0DQXIDFWXUHUVRIZLUHOHVVSKRQHVPXVWUHSRUWWKH5)H[SRVXUHOHYHOIRUHDFKPRGHO
RISKRQHWRWKH)&&7KH)&&ZHEVLWH KWWS ZZZIFFJRYRHWUIVDIHW\ JLYHV
GLUHFWLRQVIRUORFDWLQJWKH)&&LGHQWLILFDWLRQQXPEHURQ\RXUSKRQHVR\RXFDQILQG
\RXUSKRQHV5)H[SRVXUHOHYHOLQWKHRQOLQHOLVWLQJ
8. What has FDA done to measure the radiofrequency energy coming from wireless phones?
7KH,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV ,((( LVGHYHORSLQJDWHFKQLFDO
VWDQGDUGIRUPHDVXULQJWKHUDGLRIUHTXHQF\HQHUJ\ 5) H[SRVXUHIURPZLUHOHVV
SKRQHVDQGRWKHUZLUHOHVVKDQGVHWVZLWKWKHSDUWLFLSDWLRQDQGOHDGHUVKLSRI)'$
VFLHQWLVWVDQGHQJLQHHUV7KHVWDQGDUG5HFRPPHQGHG3UDFWLFHIRU'HWHUPLQLQJWKH
6SDWLDO3HDN6SHFLILF$EVRUSWLRQ5DWH 6$5 LQWKH+XPDQ%RG\'XHWR:LUHOHVV
&RPPXQLFDWLRQV'HYLFHV ([SHULPHQWDO7HFKQLTXHVVHWVIRUWKWKHILUVWFRQVLVWHQW
WHVWPHWKRGRORJ\IRUPHDVXULQJWKHUDWHDWZKLFK5)LVGHSRVLWHGLQWKHKHDGVRI
ZLUHOHVVSKRQHXVHUV7KHWHVWPHWKRGXVHVDWLVVXHVLPXODWLQJPRGHORIWKHKXPDQ
KHDG6WDQGDUGL]HG6$5WHVWPHWKRGRORJ\LVH[SHFWHGWRJUHDWO\LPSURYHWKH
FRQVLVWHQF\RIPHDVXUHPHQWVPDGHDWGLIIHUHQWODERUDWRULHVRQWKHVDPHSKRQH
6$5LVWKHPHDVXUHPHQWRIWKHDPRXQWRIHQHUJ\DEVRUEHGLQWLVVXHHLWKHUE\WKH
ZKROHERG\RUDVPDOOSDUWRIWKHERG\,WLVPHDVXUHGLQZDWWVNJ RUPLOOLZDWWVJ
RIPDWWHU7KLVPHDVXUHPHQWLVXVHGWRGHWHUPLQHZKHWKHUDZLUHOHVVSKRQH
FRPSOLHVZLWKVDIHW\JXLGHOLQHV
9. What steps can I take to reduce my exposure to radiofrequency energy from my wireless phone?
,IWKHUHLVDULVNIURPWKHVHSURGXFWVDQGDWWKLVSRLQWZHGRQRWNQRZWKDWWKHUH
LVLWLVSUREDEO\YHU\VPDOO%XWLI\RXDUHFRQFHUQHGDERXWDYRLGLQJHYHQSRWHQWLDO
ULVNV\RXFDQWDNHDIHZVLPSOHVWHSVWRPLQLPL]H\RXUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\ 5) 6LQFHWLPHLVDNH\IDFWRULQKRZPXFKH[SRVXUHDSHUVRQUHFHLYHV
UHGXFLQJWKHDPRXQWRIWLPHVSHQWXVLQJDZLUHOHVVSKRQHZLOOUHGXFH5)H[SRVXUH
,I\RXPXVWFRQGXFWH[WHQGHGFRQYHUVDWLRQVE\ZLUHOHVVSKRQHHYHU\GD\\RXFRXOG
SODFHPRUHGLVWDQFHEHWZHHQ\RXUERG\DQGWKHVRXUFHRIWKH5)VLQFHWKHH[SRVXUH
OHYHOGURSVRIIGUDPDWLFDOO\ZLWKGLVWDQFH)RUH[DPSOH\RXFRXOGXVHDKHDGVHWDQG
FDUU\WKHZLUHOHVVSKRQHDZD\IURP\RXUERG\RUXVHDZLUHOHVVSKRQHFRQQHFWHGWR
DUHPRWHDQWHQQD
$JDLQWKHVFLHQWLILFGDWDGRQRWGHPRQVWUDWHWKDWZLUHOHVVSKRQHVDUHKDUPIXO
%XWLI\RXDUHFRQFHUQHGDERXWWKH5)H[SRVXUHIURPWKHVHSURGXFWV\RXFDQXVH
PHDVXUHVOLNHWKRVHGHVFULEHGDERYHWRUHGXFH\RXU5)H[SRVXUHIURPZLUHOHVV
SKRQHXVH
10. What about children using wireless phones?
7KHVFLHQWLILFHYLGHQFHGRHVQRWVKRZDGDQJHUWRXVHUVRIZLUHOHVVSKRQHVLQFOXGLQJ
FKLOGUHQDQGWHHQDJHUV,I\RXZDQWWRWDNHVWHSVWRORZHUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\ 5) WKHPHDVXUHVGHVFULEHGDERYHZRXOGDSSO\WRFKLOGUHQDQGWHHQDJHUV
XVLQJZLUHOHVVSKRQHV5HGXFLQJWKHWLPHRIZLUHOHVVSKRQHXVHDQGLQFUHDVLQJWKH
GLVWDQFHEHWZHHQWKHXVHUDQGWKH5)VRXUFHZLOOUHGXFH5)H[SRVXUH6RPHJURXSV
VSRQVRUHGE\RWKHUQDWLRQDOJRYHUQPHQWVKDYHDGYLVHGWKDWFKLOGUHQEHGLVFRXUDJHG
Nokia 2220/2260 User Guide
Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 114 Wednesday, May 28, 2003 4:10 PM IURPXVLQJZLUHOHVVSKRQHVDWDOO)RUH[DPSOHWKHJRYHUQPHQWLQWKH8QLWHG.LQJGRP
GLVWULEXWHGOHDIOHWVFRQWDLQLQJVXFKDUHFRPPHQGDWLRQLQ'HFHPEHU7KH\QRWHG
WKDWQRHYLGHQFHH[LVWVWKDWXVLQJDZLUHOHVVSKRQHFDXVHVEUDLQWXPRUVRURWKHULOO
HIIHFWV7KHLUUHFRPPHQGDWLRQWROLPLWZLUHOHVVSKRQHXVHE\FKLOGUHQZDVVWULFWO\
SUHFDXWLRQDU\ LWZDVQRWEDVHGRQVFLHQWLILFHYLGHQFHWKDWDQ\KHDOWKKD]DUGH[LVWV
11. What about wireless phone interference with medical equipment?
5DGLRIUHTXHQF\HQHUJ\ 5) IURPZLUHOHVVSKRQHVFDQLQWHUDFWZLWKVRPHHOHFWURQLF
GHYLFHV)RUWKLVUHDVRQ)'$KHOSHGGHYHORSDGHWDLOHGWHVWPHWKRGWRPHDVXUH
HOHFWURPDJQHWLFLQWHUIHUHQFH (0, RILPSODQWHGFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUV
IURPZLUHOHVVWHOHSKRQHV7KLVWHVWPHWKRGLVQRZSDUWRIDVWDQGDUGVSRQVRUHGE\
WKH$VVRFLDWLRQIRUWKH$GYDQFHPHQWRI0HGLFDOLQVWUXPHQWDWLRQ $$0, 7KH
ILQDOGUDIWDMRLQWHIIRUWE\)'$PHGLFDOGHYLFHPDQXIDFWXUHUVDQGPDQ\RWKHU
JURXSVZDVFRPSOHWHGLQODWH7KLVVWDQGDUGZLOODOORZPDQXIDFWXUHUVWR
HQVXUHWKDWFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVDUHVDIHIURPZLUHOHVVSKRQH(0,
)'$KDVWHVWHGKHDULQJDLGVIRULQWHUIHUHQFHIURPKDQGKHOGZLUHOHVVSKRQHVDQG
KHOSHGGHYHORSDYROXQWDU\VWDQGDUGVSRQVRUHGE\WKH,QVWLWXWHRI(OHFWULFDODQG
(OHFWURQLF(QJLQHHUV ,((( 7KLVVWDQGDUGVSHFLILHVWHVWPHWKRGVDQGSHUIRUPDQFH
UHTXLUHPHQWVIRUKHDULQJDLGVDQGZLUHOHVVSKRQHVVRWKDWQRLQWHUIHUHQFHRFFXUV
ZKHQDSHUVRQXVHVDFRPSDWLEOHSKRQHDQGDDFFRPSDQLHGKHDULQJDLGDWWKHVDPH
WLPH7KLVVWDQGDUGZDVDSSURYHGE\WKH,(((LQ
)'$FRQWLQXHVWRPRQLWRUWKHXVHRIZLUHOHVVSKRQHVIRUSRVVLEOHLQWHUDFWLRQVZLWK
RWKHUPHGLFDOGHYLFHV6KRXOGKDUPIXOLQWHUIHUHQFHEHIRXQGWRRFFXU)'$ZLOO
FRQGXFWWHVWLQJWRDVVHVVWKHLQWHUIHUHQFHDQGZRUNWRUHVROYHWKHSUREOHP
12. Where can I find additional information?
)RUDGGLWLRQDOLQIRUPDWLRQSOHDVHUHIHUWRWKHIROORZLQJUHVRXUFHV
)'$ZHESDJHRQZLUHOHVVSKRQHV KWWS ZZZIGDJRYFGUKSKRQHVLQGH[KWPO
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ )&& 5)6DIHW\3URJUDP
KWWS ZZZIFFJRYRHWUIVDIHW\
,QWHUQDWLRQDO&RPPLVVLRQRQ1RQ,RQL]LQJ5DGLDWLRQ3URWHFWLRQ KWWS ZZZLFQLUSGH
:RUOG+HDOWK2UJDQL]DWLRQ :+2 ,QWHUQDWLRQDO(0)3URMHFW KWWS ZZZZKRLQWHPI 1DWLRQDO5DGLRORJLFDO3URWHFWLRQ%RDUG 8. KWWS ZZZQUSERUJXN
-XO\)RUXSGDWHV KWWS ZZZIGDJRYFGUKSKRQHV 114 Copyright 2003 Nokia 2220_2260.ENv1_9356390_.book Page 115 Wednesday, May 28, 2003 4:10 PM Index A accessibility loopset 15 web site 15 accessories boom headset (HDB-5) 93 car kit (PPH-1) 95 charger (ACP-12) 91 charger (ACP-7) 91 charger (ACP-8) 91 charger (LCH-9) 92 headset (HDC-5) 92 headset (HDE-2) 93 mobile holder (MBC-6) 94 reference information 90 safety information 88 settings 50 spare battery charger (DDC-1) 92 accessory TTY adapter 94 active call options 54 alarm clock 69 phone off 69 set 69 snooze 69 turn off 69 analog selection 65 antenna contact 10 location 10 performance 10 proper position 10 automatic redial 60 B back cover attaching 11 removing 11 battery charging 12 charging time 89 important information 12 initial charging 12 install 10 prolong life 13 reference information 88 remove 11 standby time 89 talk time 89 business cards 71 delete 72 receive 71 save 71 send 71 C calculator 70 call duration viewing 37 call forwarding 57 activate 58 feature codes 57 call log about 35 clear lists 36 dialed calls 36 missed calls 36 options 35 Nokia 2220/2260 User Guide
Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 116 Wednesday, May 28, 2003 4:10 PM received calls 36 call timers 37 clear timers 37 current call timer 37 call waiting 58 activate 58 answer 59 feature code 58 manage calls 59 storing the feature code 58 calls answer 18 automatic redial 60 conference 55 duration of 37 end 18 forward 57 make 17 redial last 18 silence 18 speed dialing 61 touch tones 61 car charger 92 car kit 95 automatic answer 51 default profile 51 set the lights 51 change 1-touch dialing numbers 61 contact list view 34 earpiece volume 18 letter case 27 message alert tone 49 profile name 50 ringing tone 48 ringing volume 49 security code 67 time format 52 charge the battery 12 charger ACP-12 91 ACP-7 91 ACP-8 91 connecting 12 information 88 clear call lists 36 clock 52 alarm 69 automatic update 52 set the time 52 show/hide 53 time format 52 color covers 96 conference calls 55 contact list delete entries 33 enter e-mail addresses 32 memory status 34 menu 25 menu options 25 new entry 32 quick access 18 scrolling view 34 contact Nokia 14 cover attaching 11 removing 11 currency conversion 70 customer care 14 D delete call lists 36 contact list entries 33 116 Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 117 Wednesday, May 28, 2003 4:10 PM messages from folders 41 text messages 43 dialed calls deleting 36 viewing 36 digital selection 65 display language 52 download ringing tones 72 E e-mail messages 45 emergency calls making 85 things to remember 85 with keypad locked 66 entering e-mail addresses 32 names and numbers 31 text 26 F folders about 41 archive 41 delete messages from 41 inbox 41 outbox 41 four-way scrolling 28 G games 76 Pairs II 77 Snake II 77 Space Impact 77 H headset connect 13 HDB-5 93 HDC-5 92 HDE-2 93 make and answer calls 13 hearing impaired solutions 15 help text 20 I icons 20 illustrated view antenna 10 battery install 10 battery removal 11 connect the charger 12 headset connection 13 phone 10 power key 17 in-call options 54 in-phone help 20 K Keyguard 66 keypad illustrated view 10 L label 14 language setting 52 letters uppercase and lowercase 27 lithium ion battery 90 lock/unlock the keypad 66 loopset 15 how it works 15 set for use 51 Nokia 2220/2260 User Guide
Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 118 Wednesday, May 28, 2003 4:10 PM M memory contact list 34 text message 43 menu shortcuts about 21 list of 22 menu tips 21 menus 21 messages alert tone 49 check voice mail 38 e-mail 45 picture 44 read 42 text 42 text entry 26 write and send 42 Minute Manager 78 missed calls deleting 36 viewing 36 mobile holder 94 N network search 64 network services 9 Nokia accessories 90 customer care center 14 warranty 100 O one-touch dialing 61 P personalization 47 phone illustrated 4 menus 21 register 9 switch on/off 17 warranty 100 picture messages 44 power 17 predictive text 29 turn off 29 turn on 29 prepaid 73 add money to account 74 check balance 73 saving access numbers 74 profiles accessory settings 50 customize 48 selecting 47 punctuation 28 R received calls deleting 36 viewing 36 reference information 81 ringing options 48 tone 48 volume 49 ringing tones change 48 download 72 receiving 72 save 72 118 Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 119 Wednesday, May 28, 2003 4:10 PM S save e-mail addresses 32 names and numbers 31 ringing tones 72 text messages 41 voice mailbox number 38 search for network 64 security code 67 service provider signing up 9 special characters available 28 four-way scrolling 28 standby time 89 start screen 19 strings, touch tone 63 symbols 28 T talk time 89 text clues 6 text messages 42 length 39 recipients 39 time 52 automatic update 52 select the format 52 set the clock 52 timers check 37 clear 37 current call 37 touch tones length 62 manual 62 sending 63 setting 61 storing 63 storing with numbers 63 troubleshooting 99 TTY 15 TTY adapter 94 TTY communication 94 turn the phone on/off 17 U unlock the keypad 66 user guide updates 6 user guide conventions 6 V vibrating alert 49 view call duration 37 clock on start screen 53 dialed calls 36 missed calls 36 picture messages 45 received calls 36 received messages 42 special characters 28 voice mail 38 listen to messages 39 messages 38 save number 38 volume earpiece 18 keypad tones 50 ringing 49 W warning tones 50 Nokia 2220/2260 User Guide
Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 120 Wednesday, May 28, 2003 4:10 PM warranty 100 web sites accessibility information 15 register your phone 9 write and send a message 42 X Xpress-on color covers 96 NOTES 120 Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 121 Wednesday, May 28, 2003 4:10 PM NOTES Nokia 2220/2260 User Guide
Copyright Nokia 2003 2220_2260.ENv1_9356390_.book Page 122 Wednesday, May 28, 2003 4:10 PM NOTES Para obtener un manual del usuario en espaol favor de llamar o enviar un fax al telfono 1-888-NOKIA-2U, fax 813-249-9619. 04/03 122 Copyright Nokia 2003
| frequency | equipment class | purpose | ||
|---|---|---|---|---|
| 1 | 2003-06-19 | 824.04 ~ 848.97 | TNE - Licensed Non-Broadcast Transmitter Held to Ear | Original Equipment |
| app s | Applicant Information | |||||
|---|---|---|---|---|---|---|
| 1 | Effective |
2003-06-19
|
||||
| 1 | Applicant's complete, legal business name |
Microsoft Corporation
|
||||
| 1 | FCC Registration Number (FRN) |
0005087978
|
||||
| 1 | Physical Address |
1 Microsoft Way
|
||||
| 1 |
Redmond, Washington 98052
|
|||||
| 1 |
United States
|
|||||
| app s | TCB Information | |||||
| 1 | TCB Application Email Address |
h******@AmericanTCB.com
|
||||
| 1 | TCB Scope |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
||||
| app s | FCC ID | |||||
| 1 | Grantee Code |
GML
|
||||
| 1 | Equipment Product Code |
RH-40
|
||||
| app s | Person at the applicant's address to receive grant or for contact | |||||
| 1 | Name |
H**** S****
|
||||
| 1 | Title |
Director, EMC, SI and RF Compliance
|
||||
| 1 | Telephone Number |
425-7********
|
||||
| 1 | Fax Number |
425-7********
|
||||
| 1 |
h******@microsoft.com
|
|||||
| app s | Technical Contact | |||||
| 1 | Firm Name |
Nokia Mobile Phones, Inc.
|
||||
| 1 | Name |
N******** W****
|
||||
| 1 | Physical Address |
6000 Connection Drive MS 2:200
|
||||
| 1 |
Irving, Texas 75039
|
|||||
| 1 |
United States
|
|||||
| 1 | Telephone Number |
972-8********
|
||||
| 1 |
n******@nokia.com
|
|||||
| app s | Non Technical Contact | |||||
| 1 | Firm Name |
Nokia Mobile Phones
|
||||
| 1 | Name |
A**** E********
|
||||
| 1 | Physical Address |
6000 Connection Drive MS 2:200
|
||||
| 1 |
Irving, Texas 75039
|
|||||
| 1 |
United States
|
|||||
| 1 | Telephone Number |
972-8********
|
||||
| 1 | Fax Number |
972-8********
|
||||
| 1 |
a******@nokia.com
|
|||||
| app s | Confidentiality (long or short term) | |||||
| 1 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
| 1 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
| if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
| app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
| 1 | Is this application for software defined/cognitive radio authorization? | No | ||||
| 1 | Equipment Class | TNE - Licensed Non-Broadcast Transmitter Held to Ear | ||||
| 1 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | Single Band, Dual Mode Cellular Phone | ||||
| 1 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
| 1 | Modular Equipment Type | Does not apply | ||||
| 1 | Purpose / Application is for | Original Equipment | ||||
| 1 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | No | ||||
| 1 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
| 1 | Grant Comments | Power Output is ERP. SAR compliance for body-worn operating conditions is limited to the specific configuration tested for this filing. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and must provide at least 1.5 cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Part 22 AMPS/TDMA Head 1.2 W/kg; Body-worn 1.2 W/kg. | ||||
| 1 | Is there an equipment authorization waiver associated with this application? | No | ||||
| 1 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
| app s | Test Firm Name and Contact Information | |||||
| 1 | Firm Name |
Nemko Dallas, Inc.
|
||||
| 1 | Name |
M**** C****
|
||||
| 1 | Telephone Number |
972-4********
|
||||
| 1 | Fax Number |
972-4********
|
||||
| 1 |
@******@.
|
|||||
| Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
| 1 | 1 | 22H | BC | 824.04 | 848.97 | 0.215 | 2.5 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
| 1 | 2 | 22H | BC | 824.04 | 848.97 | 0.215 | 2.5 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
| 1 | 3 | 22H | BC | 824.04 | 848.97 | 0.493 | 2.5 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC