all | frequencies |
|
exhibits | applications |
---|---|---|---|---|
manual |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 3 4 |
|
Manual | Users Manual | 3.47 MiB | ||||
1 2 3 4 | Cover Letter(s) | |||||||
1 2 3 4 | RF Exposure Info | |||||||
1 2 3 4 | RF Exposure Info | |||||||
1 2 3 4 | RF Exposure Info | |||||||
1 2 3 4 | Test Report | May 04 2004 | ||||||
1 2 3 4 | Cover Letter(s) | |||||||
1 2 3 4 | Cover Letter(s) | |||||||
1 2 3 4 | Cover Letter(s) | December 12 2003 | ||||||
1 2 3 4 | Test Report | December 12 2003 | ||||||
1 2 3 4 | Cover Letter(s) | November 09 2003 | ||||||
1 2 3 4 | Attestation Statements | November 09 2003 | ||||||
1 2 3 4 | Test Report | November 09 2003 | ||||||
1 2 3 4 | External Photos | November 09 2003 | ||||||
1 2 3 4 | ID Label/Location Info | November 09 2003 | ||||||
1 2 3 4 | Internal Photos | November 09 2003 | ||||||
1 2 3 4 | Cover Letter(s) | November 09 2003 | ||||||
1 2 3 4 | RF Exposure Info | November 09 2003 | ||||||
1 2 3 4 | RF Exposure Info | November 09 2003 |
1 2 3 4 | Manual | Users Manual | 3.47 MiB |
6560.ENv1a_9355907.book Page 1 Friday, April 23, 2004 4:40 PM Nokia 6560 phone at a glance See Learn the keys on page 16. Power key Earpiece Selection keys Talk key Keypad Display screen Four-way scroll key End key Charger plug Microphone Headset connector 6560.ENv1a_9355907.book Page 2 Friday, April 23, 2004 4:40 PM The wireless phone described in this guide is approved for use in TDMA and AMPS networks. LEGAL INFORMATION Part No. 9355907, Issue No. 1b Copyright 2003 Nokia. All rights reserved. Nokia, Nokia Connecting People, Nokia 6560, Triple Pop, Bounce, Backgammon, Chess Puzzle and the Nokia Original Enhancements logos are trademarks or registered trademarks of Nokia Corporation. Other company and product names mentioned herein may be trademarks or trade names of their respective owners. Printed in Canada 05/2004 US Patent Nos 5818437; 5953541; 6011554 and other pending patents associated with this products hardware and software T9 text input software Copyright 1999-2002. Tegic Communications, Inc. All rights reserved. Includes RSA BSAFE cryptographic or security protocol software from RSA Security. Java is a trademark of Sun Microsystems, Inc. The information in this user guide was written for the Nokia 6560 product. Nokia operates a policy of ongoing development. Nokia reserves the right to make changes to any of the products described in this document without prior notice. UNDER NO CIRCUMSTANCES SHALL NOKIA BE RESPONSIBLE FOR ANY LOSS OF DATA OR INCOME OR ANY SPECIAL, INCIDENTAL, AND CONSEQUENTIAL OR INDIRECT DAMAGES HOWSOEVER CAUSED. THE CONTENTS OF THIS DOCUMENT ARE PROVIDED "AS IS." EXCEPT AS REQUIRED BY APPLICABLE LAW, NO WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE MADE IN RELATION TO THE ACCURACY AND RELIABILITY OR CONTENTS OF THIS DOCUMENT. NOKIA RESERVES THE RIGHT TO REVISE THIS DOCUMENT OR WITHDRAW IT AT ANY TIME WITHOUT PRIOR NOTICE. EXPORT CONTROLS This device contains commodities, technology, or software exported from the United States in accordance with the Export Administration regulations. Diversion contrary to U.S. or Canadian law is prohibited. FCC/INDUSTRY CANADA NOTICE Your device may cause TV or radio interference (for example, when using a telephone in close proximity to receiving equipment). The FCC or Industry Canada can require you to stop using your telephone if such interference cannot be eliminated. If you require assistance, contact your local service facility. This device complies with part 15 of the FCC rules. Operation is subject to the condition that this device does not cause harmful interference. 6560.ENv1a_9355907.book Page iii Friday, April 23, 2004 4:40 PM Contents 1 For your safety . 1 About your device . 2 Network Services . 2 Shared Memory . 3 Patent numbers . 3 2 Welcome . 4 Get the most out of this guide . 4 Quick guide to functions. 5 Menu. 6 Contacts (Phone book) . 6 Contact Nokia . 7 Contact your service provider. 8 3 4 Review the basics. 9 The antenna . 9 The battery . 9 Important battery information . 11 Xpress-on covers . 11 Remove the back cover . 11 Remove the front cover. 12 The keypad . 12 Replace the front cover. 12 Replace the back cover . 13 Switch on your phone . 13 The start screen . 13 Phone setup. 15 Volume . 15 Headset. 15 Display contrast . 16 Equalizer. 16 Learn the keys . 16 1RNLD8VHU*XLGH
iii Copyright 2003 Nokia 6560.ENv1a_9355907.book Page iv Friday, April 23, 2004 4:40 PM Make and answer calls . 17 The speaker phone . 17 Phone symbols . 18 The selection keys . 19 In-phone help. 19 Phone menus . 19 Text entry . 21 Entering letters and numbers . 21 ABC and 123 methods. 21 Predictive text . 24 The phone book . 28 View contacts. 28 Save names and numbers . 28 Save a text entry with a name . 29 Retrieve information . 29 Menus . 29 Change contacts view . 30 Edit a name or number . 30 Erase stored names and numbers . 30 Delete the entire phone book . 31 Add a second number to a name . 31 Create caller groups. 32 Check memory status . 33 Call history . 34 Check missed, received, or dialed calls. 34 Clear call lists . 35 Call timers . 35 Turn on a current call timer . 36 Clear call timers . 36 iv Copyright 2003 Nokia 5 6 7
6560.ENv1a_9355907.book Page v Friday, April 23, 2004 4:40 PM 8 9 Advanced calling features . 37 Set in-call options . 37 Call waiting . 37 Make a conference call . 38 Voice privacy . 39 Call forwarding . 39 Automatic redial . 40 Calling card . 40 Voice tags. 42 Voice recorder . 43 Voice commands . 44 Caller ID . 45 Select a phone number . 46 Set touch tones . 47 Voice mail . 49 Check messages . 49 Set up mailbox. 49 Set greetings . 49 Listen to messages. 50 10 Personalize rings and tones . 51 Profiles . 51 Select a different profile . 51 Customize a profile . 51 Set a timed profile. 54 11 Personalize phone settings . 55 Set the language . 55 Set and display the clock . 55 Network updated clock . 56 Welcome note . 57 Start-up tone . 57 1-touch dialing . 57 Right selection key settings . 58 1RNLD8VHU*XLGH
v Copyright 2003 Nokia 6560.ENv1a_9355907.book Page vi Friday, April 23, 2004 4:40 PM Display settings . 59 Tone settings . 60 Enhancement settings . 60 Restore the factory settings . 60 Accessibility solutions . 61 12 Phone security . 63 Keyguard (Lock keypad) . 63 Change your security code . 64 Phone lock . 64 Restrict calls . 66 13 Personal digital assistant. 68 Calendar . 68 To-do list. 69 The calculator. 69 Convert currency . 70 Business cards . 71 Stopwatch . 71 14 Prepaid services. 73 Manage prepaid service. 73 Save your access numbers. 73 Add money to your account . 74 Check your prepaid balance . 74 15 Network services . 75 Search for a network . 75 Roaming . 76 16 Text messages . 77 Folders. 77 Write and send a message . 77 Options . 78 Resend a message . 78 Receive a message . 79
vi Copyright 2003 Nokia 6560.ENv1a_9355907.book Page vii Friday, April 23, 2004 4:40 PM Read a message . 79 Save a message . 80 Customize settings . 80 Memory full . 80 Delete messages . 80 Reply to a message . 81 Forward a message . 81 E-mail messages . 81 Templates . 82 Picture messages . 83 Chat . 84 17 Special features . 86 Gallery . 86 Applications . 87 Ringing tones . 89 Alarm clock . 89 18 Connectivity . 91 Infrared. 91 19 Internet service . 93 Set up for browsing . 93 Sign on to the Internet . 94 Browsing methods . 94 Browser options (Services Menu) . 94 Edit a data entry field . 95 Bookmarks . 95 Examples of wireless Internet sites . 96 20 Games . 97 21 Enhancements . 98 1RNLD8VHU*XLGH
vii Copyright 2003 Nokia 6560.ENv1a_9355907.book Page viii Friday, April 23, 2004 4:40 PM 22 Reference Information. 99 Battery information . 99 Care and Maintenance . 100 Additional safety information. 101 Battery . 106 Technical Information . 107 23 Nokia One-Year Limited Warranty. 108 Appendix A . 113 Appendix B . 117 Index . 123
viii Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 1 Friday, April 23, 2004 4:40 PM 1 For your safety Read these simple guidelines. Not following them may be dangerous or illegal. Read the complete user guide for further information. For your safety SWITCH ON SAFELY Do not switch the phone on when wireless phone use is prohibited or when it may cause interference or danger. ROAD SAFETY COMES FIRST Obey all local laws. Always keep your hands free to operate the vehicle while driving. Your first consideration while driving should be road safety. INTERFERENCE All wireless phones may be susceptible to interference, which could affect performance. SWITCH OFF IN HOSPITALS Follow any restrictions. Switch the phone off near medical equipment. SWITCH OFF IN AIRCRAFT Follow any restrictions. Wireless devices can cause interference in aircraft. SWITCH OFF WHEN REFUELING Dont use the phone at a refueling point. Dont use near fuel or chemicals. SWITCH OFF NEAR BLASTING Follow any restrictions. Dont use the phone where blasting is in progress. USE SENSIBLY Use only in the normal position as explained in the product documentation. Dont touch the antenna unnecessarily. QUALIFIED SERVICE Only qualified personnel may install or repair this product. ENHANCEMENTS AND BATTERIES Use only approved enhancements and batteries. Do not connect incompatible products. Nokia 6560 User Guide
1 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 2 Friday, April 23, 2004 4:40 PM WATER-RESISTANCE Your phone is not water-resistant. Keep it dry BACK-UP COPIES Remember to make back-up copies or keep a written record of all important information stored in your phone. CONNECTING TO OTHER DEVICES When connecting to any other device, read its user guide for detailed safety instructions. Do not connect incompatible products. EMERGENCY CALLS Ensure the phone is switched on and in service. Press the End key as many times as needed to clear the display and return to the start screen. Enter the emergency number, then press the Talk key. Give your location. Do not end the call until given permission to do so. ABOUT YOUR DEVICE The wireless device described in this guide is approved for use on the TDMA and AMPS networks. Contact your service provider for more information about networks. When using the features in this device, obey all laws and respect privacy and legitimate rights of others. Warning: To use any features in this device, other than the alarm clock, the phone must be switched on. Do not switch the device on when wireless phone use may cause interference or danger.
NETWORK SERVICES To use the phone you must have service from a wireless service provider. Many of the features in this device depend on features in the wireless network to function. These Network Services may not be available on all networks or you may have to make specific arrangements with your service provider before you can utilize Network Services. Your service provider may need to give you additional instructions for their use and explain what charges will apply. Some networks may have limitations that affect how you can use Network Services. For instance, some networks may not support all language-dependent characters and services. Your service provider may have requested that certain features be disabled or not activated in your device. If so, they will not appear on your device menu. Contact your service provider for more information. 2 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 3 Friday, April 23, 2004 4:40 PM For your safety
SHARED MEMORY The following features in this device may share memory: Contacts, calendar, to-do list, gallery, games, and Java applications. Use of one or more of these features may reduce the memory available for the remaining features sharing memory. For example, saving many Java applications may use all of the available memory. Your phone may display a message that the memory is full when you try to use a shared memory feature. In this case, delete some of the information or entries stored in the shared memory features before continuing. Some of the features, such as contacts, calendar, and to-do list may have a certain amount of memory specially allotted to them in addition to the memory shared with other features.
PATENT NUMBERS Nokia products may be covered by the following U.S. Patents:
5241583 5835858 5892475 6049796 6185295 6487397 5479476 5842141 5920826 6094587 6188909 6594472 5692032 5845219 6026161 6115617 6292668 5794142 5870683 6043760 6151507 6347218 Nokia 6560 User Guide
3 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 4 Friday, April 23, 2004 4:40 PM 2 Welcome Congratulations on your purchase of the Nokia 6560 mobile phone. Nokia recommends that you read this chapter before you use your new phone. You will find useful information about:
How to use this guide How to understand Network Services How to contact Nokia home screen
GET THE MOST OUT OF THIS GUIDE The tips that follow can help you use this guide efficiently as you learn to use your phone. Understand the terms
Press means to briefly press then release a key. For example, Press 0 means press the zero key. Press Menu means to press the key that is below the word Menu on the phone screen. Press and hold means to press and hold a key for 23 seconds
(depending on the feature you are using), and release the key. Use the Left selection and Right selection keys to choose an option in a menu. Highlighted means that an option you see on the screen is enclosed in a dark bar. Choices you make with the two selection keys act on the highlighted option.
4 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 5 Friday, April 23, 2004 4:40 PM Welcome
QUICK GUIDE TO FUNCTIONS Make a call Answer a call Answer with call waiting End a call Ignore a call Redial Adjust call volume Use the in-call menu Use 1-touch dialing Save a name and number
Enter the phone number, press the Talk key. Press the Talk key or Answer. Press the Talk key. Press the End key. Press the End key or Silence. Press the Talk key twice. During a call, scroll right or left to adjust call volume. In a call, select Options. Press and hold one of keys 29. Enter a number, select Options > Save, enter a name, and press OK. Select Contacts > Find. Select Options > Contacts > Find, and enter the first letter of the name. Press and hold 1 or call your voice mailbox number. Press and hold the left arrow on the Scroll key. Write the message, select Options > Send, enter the recipients number, and press OK. Select Menu > Messages > Create SMS e-mail. Enter the recipients address, press OK, enter the subject, press OK, write the message, press Options, select Send e-mail, enter the Gateway number (if needed), and press OK. Press Show. Select Options > Reply > Via text message, choose a reply option, write the reply, and select Options > Send > OK. Select Options > Reply > Via e-mail, choose a reply option, and follow instructions for sending an e-mail message. Retrieve a name from the phone book, select Details >
Options > Send bus. card > Via text message or Via infrared, enter the recipients number, and press OK. Retrieve a name/number Retrieve a name/number during a call Check voice mail Send a text message Send an E-mail message Read new message Reply to a message Reply to an E-mail message Send a business card Nokia 6560 User Guide
5 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 6 Friday, April 23, 2004 4:40 PM
MENU MESSAGES 1 Create message Create SMS e-mail Chat Inbox Sent items Archive Templates Delete messages Voice messages Message settings 2 3 4 CALL LOG Missed calls Received calls Dialed numbers Delete recent call lists Call timers PROFILES Normal Silent Meeting Outdoor Pager SETTINGS Right selection key settings Tone settings Time and date settings Call settings Phone settings Display settings Enhancement settings Network services Security settings Restore factory settings 5 ALARM CLOCK 6 VOICE Voice recorder Voice tags Voice commands 7 GALLERY 8 ORGANIZER Calendar To-do list 9 GAMES 10 APPLICATIONS 11 EXTRAS Calculator Stopwatch 12 INFRARED 13 SERVICES 14 PREPAID
CONTACTS (PHONE BOOK) 1 2 3 4 5 Find Add contact Edit name Delete Add number 6 7 8 9 Settings 1-touch dialing Voice tags Caller groups
6 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 7 Friday, April 23, 2004 4:40 PM Look for updates Nokia updates this user guide to reflect changes or corrections. The latest version may be available at the Nokia site on the World Wide Web:
Welcome www.nokia.com/us Also, an interactive user guide is available at:
www.nokiahowto.com Sign up with a service provider Before you can take advantage of any of the network services, you must sign up with a wireless service provider. Your service provider will make available descriptions of its services and instructions for using them. Note differences among service providers Wireless service providers may differ in their support of features. Some may not support all languages available in your phone. Before you sign up, make sure a wireless provider supports the features that you need.
CONTACT NOKIA When you need help, the Nokia Customer Care department can provide information about Nokia products. However, you may wish to check through your user guide before calling the customer care center, as it is a comprehensive guide to using your phone. Whether you are calling about your phone or an enhancement, have the equipment with you when you call. For example, if you are calling about a headset, please have it nearby. Have the right information available We recommend that you have the following information available before you contact the Nokia Customer Care department:
The phone model number Electronic serial number (ESN), located on the phone label. Your ZIP code Nokia 6560 User Guide
7 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 8 Friday, April 23, 2004 4:40 PM Nokia Customer Care Center, USA Customer Care Centre, Canada Nokia Mobile Phones 7725 Woodland Center Blvd., Suite #150 Tampa, Florida 33614 Tel: 1-888-NOKIA-2U
(1-888-665-4228) Fax: 1-813-249-9619 TTY/TDD users only:
1-800-24-NOKIA
(1-800-246-6542) Nokia Products Ltd. 601 Westney Rd. South Ajax, Ontario L1S 4N7 Tel: 1-888-22-NOKIA
(1-888-226-6542) Fax: 1-905-427-1070 The phone label The label is on the back of your phone (under the battery). It contains important information about your phone, including the model and serial numbers. Please do not remove or deface the label.
CONTACT YOUR SERVICE PROVIDER Some service providers program a one-key customer support number into the phone. This number can be useful if you are having trouble dialing a number, especially when you are traveling outside your home area. This one-key feature might not be available on your system. Contact your service provider for availability. 8 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 9 Friday, April 23, 2004 4:40 PM 3 Review the basics
THE ANTENNA Review the basics Dont touch Your device has an internal antenna. As with any other radio transmitting device, do not touch the antenna unnecessarily when the device is switched on. Contact with the antenna affects call quality and may cause the phone to operate at a higher power level than otherwise needed. Avoiding contact with the antenna area when operating the phone optimizes the antenna performance and the battery life. Hold the phone as you would any other telephone with the antenna pointed up and over your shoulder. Warning: If the phone becomes too hot during a call, the call is automatically terminated. You will not be able to make or receive calls until the phone cools.
THE BATTERY Installing If your dealer has already installed the battery, please see Charging on page 10. 1 Place the battery in the compartment with the label side facing up and the golden contact area aligned with the contact pins. Press the top end of the battery into place. To learn how to remove and replace the covers, see Xpress-on covers on page 11. gold contacts 2 Nokia 6560 User Guide
9 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 10 Friday, April 23, 2004 4:40 PM Charging Follow these guidelines to optimize battery performance. 1 With your phone turned off, connect the charger plug to the bottom of the phone. Connect the charger to an ac wall outlet. The battery indicator bar appears on the right-hand side of the screen and starts to scroll from bottom to top. It will remain constant when the phone is fully charged. Disconnect the charger from the phone and ac outlet when the battery is fully charged. After the indicator bar stops scrolling, you can leave the charger connected and the battery will accept a trickle charge to maintain a fully charged battery. See Reference Information on page 99 for more information on batteries. 2 Note: Charge the new battery for three hours before using. Use the battery until it is fully discharged. You should do this for a total of three charging cycles. After the first charge, you can make and receive calls during the charging cycle, but the calls interrupt the charge. When a call ends, the charge will resume. The charging time depends on the charger you use. Removing Before removing the battery, make sure the phone has been turned off for at least 10 seconds. 1 Place your index finger in the grove at the top of the battery, and lift out of phone. Take out the battery. 2 To learn how to remove and replace the covers, see Xpress-on covers on page 11. Warning: Use only your hands to remove the battery. Do not puncture, burn, or use any objects that may damage the phone or the battery. Please recycle the battery or dispose of properly according to local regulations. 10 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 11 Friday, April 23, 2004 4:40 PM Review the basics
IMPORTANT BATTERY INFORMATION
Recharge your battery only with a charger approved by Nokia. You can switch the phone on and use it for calls while the battery is charging. If the battery is totally empty, it may take a few seconds for the battery indicator to appear on the screen. If you are still connected to the charger and you switch the phone on when charging is complete, the screen momentarily shows Battery full. After fully charging and discharging your new battery three times, you no longer need to fully discharge the BLD-3 battery before recharging. Charging time depends on the charger used. See Battery on page 106 for charging, talk, and standby times. If the battery is completely empty, you may need to recharge it for a few minutes before you can make or receive calls.
XPRESS-ON COVERS Xpress-on covers are available in several fashion colors. Extra covers may be purchased from your authorized Nokia dealer.
Always store and use the device with the covers attached. Before removing the cover, always switch off the power and disconnect the charger and any other device. Avoid touching electronic components while changing the covers.
REMOVE THE BACK COVER 1 2 3 Hold the phone upside down with the back cover facing you. Push the release button down. Pull the back cover away from the phone. Nokia 6560 User Guide
11 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 12 Friday, April 23, 2004 4:40 PM
REMOVE THE FRONT COVER 1 2 3 Remove the back cover. Once the back cover has been removed, firmly hold the phone with one hand and grasp the top corners of the front cover with the other hand. Lift the front cover off the phone starting with the top.
THE KEYPAD Remove the keypad from the old front cover and place it into the new front cover as shown.
REPLACE THE FRONT COVER 1 2 3 4 Hold the phone face down. Insert the tabs at the bottom of the front cover into the matching holes at the bottom of the phone. Gently push the tabs at the middle of the front cover into the matching holes in the middle of the phone. Slowly push the tab at the top of the front cover through the slot at the top of the phone. 12 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 13 Friday, April 23, 2004 4:40 PM Review the basics
REPLACE THE BACK COVER 1 2 Insert the tab at the top of the back cover into the slot at the top of the phone. Lower the cover onto the back of the phone until the bottom locks into place.
SWITCH ON YOUR PHONE Once the battery is charged, you can switch on your phone. Press and hold the gray power key (located on the top of the phone) for two seconds. Warning: Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger.
THE START SCREEN When you switch on your phone, a welcome note appears, and then you see the start screen. In this guide, most instructions will begin with how to access a feature from Menu or Contacts, which are located on the start screen. You can easily return to the start screen from any activity by pressing the End key. The phone erases any text or information you may have entered, and returns to its home screen when you press the End key. However, if you were writing a new text message, the message remains available. Nokia 6560 User Guide
13 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 14 Friday, April 23, 2004 4:40 PM ABOUT THE START SCREEN HOME Your service providers name may appear here. Signal strength. A higher bar on the left side of the start screen indicates a stronger signal. If you do not see any bars, you are out of the range of service. Shows the battery charge level. The higher the bar, the higher the power level in the battery. Menu Contacts The top level of menu choices on your phone. Press the Left selection key to enter the menus. The entry point for the phone book. Press the right selection key to enter the Contacts feature. Indicates that you are connected to a digital network. This graphic is located in the top left corner of the start screen. 14 Copyright 2003 Nokia Phone setup Volume keys 6560.ENv1a_9355907.book Page 15 Friday, April 23, 2004 4:40 PM 4 Phone setup
VOLUME During a call, you can change the volume level on your phone, making incoming voice sounds louder or softer. The volume keys are the same as the left and right scroll keys. Press the right arrow to increase volume or the left arrow to decrease volume. A bar chart appears on the phone screen, showing the current volume level. Before adjusting the volume, you may need to clear digits from the display. Once you start entering digits, such as a bank account number, the scroll keys function as a cursor. You can adjust the volume when you are in a call at the start screen, or when you are listening to tones. If you are in a call, and have activated other phone menus or functions, you have to return to the start screen to adjust the volume.
HEADSET A headset may be purchased with your phone or separately as an enhancement. Using a headset provides convenient handsfree communications. To connect the headset, plug the headset jack into the Pop-Port connector on the bottom of your phone. With the headset connected, you can make, answer, and end calls as usual. To view available Nokia headsets for your phone, visit www.nokia.com/us. Nokia 6560 User Guide
15 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 16 Friday, April 23, 2004 4:40 PM
DISPLAY CONTRAST You can change the contrast on your display, making it brighter or darker. 1 Press Menu, then select Settings > Display settings > Display brightness. Press the right arrow to increase the contrast, or the left arrow to decrease it. Select OK to confirm your changes. 2 3
EQUALIZER Like a stereo, you can customize the audio properties of your phone using the equalizer. Choose from a list of presets or create a custom set of your own. 1 2 Press Menu, then select Settings > Call settings > Equalizer. Choose one of the following options from the Equalizer menu:
NormalSelects the default setting for the equalizer. BrightEmphasizes high frequencies. DarkEmphasizes low frequencies. LoudnessEmphasizes both high and low frequencies, but not middle frequencies. SetAllows you to define three different sets of sound settings that you can activate, deactivate, edit, or rename.
LEARN THE KEYS to make a call to the name or number shown on the screen The following is a list of keys and their functions. Refer to the diagram at the front of the book for the location of the keys. Power buttonPress and hold to switch the phone on or off. Press briefly to access the list of profiles. Talk keyPress or to answer a call. Press the Talk key once at the start screen to view a list of numbers you have recently dialed. Scroll to review the list and press the Talk key to call a number shown in the list. The Talk key is green. End keyPress Also, press to return to the start screen. The End key is red. Number keysUse keys 29 to enter numbers and letters. Use the 0 key if you want to insert a blank space while entering text. 1 keyAt the start screen, press and hold 1 key to call your voice mailbox. This feature requires one-time setup in your phone. to end a call or to silence the ring from an incoming call. 16 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 17 Friday, April 23, 2004 4:40 PM Phone setup
* keyWhen writing a message, press * to enter special characters, such as punctuation marks. Selection keysPress to choose the option shown by the word above the key (for example, Menu). Four-way Scroll keyPress the up, down, right, and left arrows to scroll through a menu list of options, change the volume during a call, move the cursor when entering text, and to move when playing games.
MAKE AND ANSWER CALLS Use this quick guide to make and answer calls. Switch the phone on (or off)Press and hold the Power key for 2 seconds. Make a callEnter a phone number, including 1 plus the area code if needed, and press the Talk key. Answer a callWhen your phone rings, press the Talk key. End a callPress End. Avoid unintentional callsPress Menu > *. Activates the Keyguard feature. Turn Keyguard offPress Unlock > *. You cannot accidentally make a call.
THE SPEAKER PHONE Your phone has a speaker phone that you can use during a call. Do not hold the phone to your ear while the speaker phone is activated.
To activate the speaker phone, press the Right selection key. To deactivate the speaker phone during a call, press Handset. The speaker phone is deactivated automatically when a call (or a call attempt) ends or when certain enhancements are connected. Note: When you select the New call option from the in-call menu, the speaker phone does not automatically deactivate. Nokia 6560 User Guide
17 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 18 Friday, April 23, 2004 4:40 PM
PHONE SYMBOLS The following is a collection of the various symbols you may see on your phone. Symbol What it means You have an active call. The phone is waiting for you to enter numbers or text. You have turned off call alert tones and text message alert tones, and set your ringing tone to Silent. You have activated Keyguard to help prevent any accidental key presses. You have one or more voice messages waiting. You have one or more unread text messages waiting. You have attempted to send the message. Digital service is available. Letters you enter will be uppercase (capital letters). Press # to switch to lowercase. Letters you enter will be lowercase. Press # to switch to uppercase. Letters you enter will be in sentence case. Characters you enter will be numbers. You are using predictive text. Available when entering information into your calendar, to-do list, or writing text messages. You are using predictive text. Characters you enter will be uppercase letters. You are using predictive text. Characters you enter will be lowercase letters (c, e, m, etc.). You can enter only symbols, such as punctuation marks. Appears when you press and hold * while entering or editing text. The alarm clock is set. 18 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 19 Friday, April 23, 2004 4:40 PM
THE SELECTION KEYS Phone setup Note the two selection keys beneath the screen. The function of each key is determined by the word shown above them on the screen. Left selection key Right selection key For example, press the Left selection key when the word Menu appears above it to show the first of many menus. Scroll through the menus with the scroll keys. Press the Right selection key when Contacts appears above it to open the phone book menu. The Right selection key can be personalized. See Right selection key settings on page 58 for more information.
IN-PHONE HELP Your phone provides brief descriptions of all menu options in an in-phone help system. To activate the help text, select Menu > Settings > Phone settings >
Help text activation. 1 2 Wait about 15 seconds and a short message appears, describing the option Scroll to a menu or submenu option. and what it does. Scroll up and down to read the longer descriptions. 3
PHONE MENUS Phone features are grouped according to function and are accessed through the main menus of your phone. Each main menu contains submenus and lists from which you can select or view items and customize phone features. You can access these menus and submenus by using the scroll method or by using a shortcut. Note: Some features may not be available, depending on your network. For more information, contact your service provider. Nokia 6560 User Guide
19 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 20 Friday, April 23, 2004 4:40 PM Scroll method 1 2 At the start screen, select Menu. Scroll through the main menus one at a time using the up and down arrows on the four-way Scroll key. As you scroll through the menus, the menu number appears in the upper right corner of the display. In addition, the name of the menu appears at the top of the display. 3 When the desired menu is highlighted, 4 press the Left selection key. If the menu contains submenus, use the scroll keys to highlight the desired menu, and press the Left selection key. Select Back (press the Right selection key) to return to the previous menu or submenu. Press the End key to return to the start screen from any main menu. Navigate the menu The convention for locating features in your phone is illustrated in the following sentence:
From the menu, select Settings > Call settings > Automatic redial. To locate Automatic redial you will first enter the menu from the start screen by pressing the left selection key. You will then scroll to Settings and press Select. You will continue to scroll and select each subsequent word listed in bold text. Shortcuts You can go directly to almost any menu or submenu, as well as activate most features by using a shortcut. Select Menu, and within a few seconds, press the key or keys associated with the menu function you would like to view or activate. The shortcut numbers are located on the display in the upper right corner of each menu. For example, to select the Meeting profile, select Menu 3-3-1 (Menu > Profiles >
Meeting > Select) from the start screen. After a brief pause, the Meeting profile is activated. 20 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 21 Friday, April 23, 2004 4:40 PM 5 Text entry Text entry This section gives detailed instructions for entering names, numbers, messages, and other information into your phone.
The phone book on page 28 tells you how to use and manage names and numbers. Text messages on page 77 tells you how to send, receive, and manage mobile messages.
ENTERING LETTERS AND NUMBERS Depending on the kind of information you are entering (names, numbers, or text), you can enter information into your phone in three ways:
Method Icon Description Function ABC All uppercase letters All lowercase letters Sentence style letters
(first letter capitalized-default) Entering text. You can switch the case by pressing the # key. 123 Numbers Predictive text Predicts text as you write Entering numbers. You can switch to number mode if you press and hold the # key. Writing messages and notes.
ABC AND 123 METHODS You can enter any combination of numbers and letters into phone book entries, Web addresses, and more using the ABC and 123 methods. When writing messages and notes, predictive text is available. See Predictive text on page 24 for more information. Nokia 6560 User Guide
21 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 22 Friday, April 23, 2004 4:40 PM The phone shows the current method with an icon in the upper left corner of the screen. Letters When you are in a name box in the phone book, use the phone keypad to enter letters:
1 Icon showing current entry method Find the key with the letter you want to enter. Press the key repeatedly until the letter appears on the screen. For example, press 2 three times to enter the letter C. 2 3 Wait for the blinking cursor to reappear before you enter another letter, unless the letter is on a different key. Example: To enter the name Albert:
Press 2 5 5 5 2 2 3 3 7 7 7 8 for A for l for b for e for r for t Displayed text A Al Alb Albe Alber Albert Note: The default case in Abc is sentence case. Only the first letter of each sentence is capitalized. Numbers When you are entering text, press and hold # until you see the screen. To enter numbers, simply press the numbers you want. icon on the 22 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 23 Friday, April 23, 2004 4:40 PM Punctuation and other characters Depending on the language selected for your phone, the following characters may be available:
Key Characters Key Characters Text entry 1 2 3 4 5 Punctuation and 1 A B C 2 D E F 3 G H I 4 J K L 5 6 M N O 6 7 8 P Q R S 7 T U V 8 9 W X Y Z 9 0 Space, 0
Press and hold for punctuation and symbols. Changes letter case. Note: Some networks may not support all language-dependent characters and/or services. SPACES AND PUNCTUATION
Press 0 to enter a space between words. Press 1 briefly while in Press * to show special characters. A screen appears with the available special characters. Use the scroll keys to select a character, and press Insert. to enter a period. ERASE MISTAKES If you make a mistake:
CHANGE LETTER CASE
Press Clear to erase one character to the left. To erase all text, select Options > Clear text, or press and hold Clear. To change cases (upper, lower, predictive, sentence), press #. The Press and hold a key until the number of that key appears on the screen, or press and hold #to switch to numbers.
, to indicate lowercase letters. icon switches to
Nokia 6560 User Guide
23 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 24 Friday, April 23, 2004 4:40 PM Special characters Your phone has specials characters, symbols, and punctuation that are available when writing text. Here is a sample:
Press and hold the * key to access available symbols. Use the arrow keys to move to the character you want, and select Insert. IN ABC 1 2 IN 123 The * key inserts special characters when you are prompted to enter a phone number.
This character sends command strings to the network. Contact your service provider for details. This character creates a pause that occurs when the phone dials a number. Numbers entered to the right of this special character are automatically sent as touch tones after a 2.5-second pause. p w This character causes the phone to wait for you to press Send.
PREDICTIVE TEXT When you are writing text messages on your phone, you can use the predictive text method of entering information. With predictive text, you need to press each number key only once for each letter. The phone predicts, or guesses, what you are writing. 24 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 25 Friday, April 23, 2004 4:40 PM For example: To write Nokia with the English dictionary selected:
Press Displayed text Text entry 6 6 5 4 2 o on onl onli Nokia The maximum number of characters available is 160. The character counter appears in the top right corner of the screen and counts down for each character you add. Keys for predictive text Key 2-9
Spell 0
Purpose Use for text entry. Press each key only once for each letter. Press to view the next matching word if the underlined word is not the word you intended. Press and hold this key for a list of symbols. If the dictionary sees a word it does not recognize, you see Spell above the Left selection key. Select Spell, enter the word, and press Save. Press once to accept a word and add a space. icon on Press and hold to enter a number. You see the the screen. Press and hold # again to write text letters. Press once quickly to switch the character case. indicates all uppercase, indicates lowercase, and Clear Press once to delete the character to the left of the cursor. Turn on text input 1 2 3 Select Menu > Messages > Create message. Select Options > Predictive text. Scroll to the dictionary you want (for example, English). Nokia 6560 User Guide
25 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 26 Friday, April 23, 2004 4:40 PM 4 Press Select. T9 prediction on appears. (T9 is the technical name for predictive text input.) This means you can use the predictive text method to enter text. When writing a text message, the predictive text icon appears. Predictive text can be turned on and off when you press the # key. You may need to press the # key more than once. Note: When you turn on predictive text, it is also active when adding notes to the calendar and to-do list. Select Menu > Messages > Create message. Select Options > Predictive text. Scroll to Prediction off and press Select. Turn off text input 1 2 3 Tips for text CHECK A WORD When you have finished writing, make sure the underlined word is the word you intended to write. If the word is correct:
If the word is not correct:
Insert a punctuation mark, if needed. Press 0 to confirm the change and enter a space. Start writing the next word. Press * repeatedly until the word you want appears, and then press 0 to confirm it. OR Select Options > Matches. Scroll to the correct word and press Use. Start writing the next word. When you enter a period to end a sentence, the phone switches to that the first letter in the next word will be uppercase (a capital letter).
so ADD A WORD TO THE DICTIONARY If Options changes to Spell, the word you intended to write is not in the dictionary. You can add the word to the dictionary. 1 2 Select Spell and enter the word using standard text entry. Select Save to save the word. 26 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 27 Friday, April 23, 2004 4:40 PM Text entry INSERT NUMBERS 1 To add a number to the message, press and hold # until screen. Enter the numbers you want, and then press and hold # to return to the appears on the 2 method. You can also press and hold any number key while writing a message. INSERT SYMBOLS 1 To put a symbol in the message, select Options > Insert symbol, or press *
and scroll to the symbol you want. Select the symbol you want and press Insert. 2 WRITE COMPOUND WORDS 1 Write the first word and scroll right to accept it. 2 Write the second word. Nokia 6560 User Guide
27 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 28 Friday, April 23, 2004 4:40 PM 6 The phone book Your phone includes a phone book that can store up to 500 contact names with up to five phone numbers per contact. The phone book can also store up to four text entries per contact, such as notes or addresses.
An entry in the phone book can consist of a number only or a name and a number. You cannot enter the same name twice. If you try to save a name that is already in the phone book, the phone asks if you want to add the number to an existing contact.
Phone book
VIEW CONTACTS There are several ways to view the contacts in your phone book:
At the start screen, use the up and down arrows on the Scroll key to view your contacts. Select Contacts > Find, and enter the first letter of the name. If more than one name appears, scroll to the name you want.
SAVE NAMES AND NUMBERS Enter the phone number using the keypad. Press and hold Options. You have several options for saving names and numbers. Quickly save a number 1 2 Quickly save a name and number 1 2 3 4 Save an entry using the Contacts menu 1 2 3 Enter the phone number using the keypad. Select Options > Save. Enter a name and press OK. Press Done to return to the start screen. Select Contacts > Add contact. Enter a name and press OK. Enter a number and press OK > Done to return to the start screen. 28 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 29 Friday, April 23, 2004 4:40 PM The phone book
SAVE A TEXT ENTRY WITH A NAME Once you have added a contact to your phone book, you can add up to four text entries, such as an e-mail address, a mailing address, or a note to that contact. Note: Text entries can only be added to existing contacts. For instance, you cannot enter an e-mail address until you have selected a name to add the address to. 1 2 3 4 Find the name or number to which you want to add text. Select Details > Options > Add detail > E-mail address, Street address, or Note. Add your text, and press OK. Press the End key to return to the start screen.
RETRIEVE INFORMATION At the start screen, select Contacts > Find. Enter the desired name. You can retrieve numbers from the phone book several different ways. Retrieve numbers 1 2 3 When the name appears, press the Talk key to call the number. Retrieve information with shortcuts You may want to use some of these shortcuts or alternate methods for retrieving a contact.
Press Contacts, enter the first letter of the name, scroll to the name, and press Details. At the start screen, press the up or down Scroll key to immediately enter your list of names, scroll to the name you want, and press Details. Press the Talk key to access a list of your last dialed calls, scroll to the one you want to dial, and press the Talk key again.
MENUS The phone book has several options from which you can choose. These options appear when you press Contacts. Use the scroll keys to move to the menu you want to use. FindSearch for a specific entry. Add contactAdd a new contact to your phone book. Edit nameEdit an existing contact. Nokia 6560 User Guide
29 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 30 Friday, April 23, 2004 4:40 PM DeleteDelete names and numbers one by one or all at once. Add numberAdd a number to an existing contact. SettingsCheck the phone book memory status and change the scrolling view. 1-touch dialingAssign up to eight keys for speed dialing. Voice tagsAllows you to playback, change, or delete your voice tags. Caller groupsThe caller groups feature enables you to identify callers by the ringing tone or graphic that you have assigned to their group. A group can be as small as one person or as large as your entire phone book. You can define the ringing tone and graphic for up to five predefined groups in your phone book.
CHANGE CONTACTS VIEW You can view your phone book in two different ways:
Name listShows all the names that are stored in your phone book. Four names appear on the screen at a time. Name and numberShows individual names and numbers. Only one name and its corresponding phone number appears on the screen at a time. In all views, you can use the Scroll key to move up and down through the list of names. To change contacts view:
1 2 Select Contacts > Settings > Contacts view. Scroll to the view you want and press Select.
EDIT A NAME OR NUMBER You can edit a name, a number, or both. 1 2 3 Retrieve the name or number you wish to edit. Select Details > Options > Edit number or Edit name. Edit the name or number and press OK.
ERASE STORED NAMES AND NUMBERS Erasing stored names and numbers removes them from your phone. Once you delete an item, you can restore it only by reentering it. Delete a number from a contact 1 2 3 When the message Delete? appears, press OK. Retrieve the contact you want to edit. Select Details > Options > Delete number. 30 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 31 Friday, April 23, 2004 4:40 PM The phone book Delete the contact 1 2 3 When the message Delete all details? appears, press OK. Select Contacts > Delete > One by one. Scroll to the entry you want to erase and press Delete.
DELETE THE ENTIRE PHONE BOOK Select Contacts > Delete > Select > Delete all. These steps delete all contacts in your phone book. 1 2 When you see the message Are you sure?, press OK. 3 Enter your security code, and press OK.
ADD A SECOND NUMBER TO A NAME There are several ways to add a number to an existing name in the phone book. Once you choose to add a number, you can select one of the following number type locations in which to store the second number: General, Mobile, Home, Work, or Fax. From the phone book 1 2 3 4 From the start screen 1 2 3 4 By retrieving the name 1 2 3 4 Select Contacts > Add number. Scroll to the name to which you want to add the number, and press Add. Select General, Mobile, Home, Work, or Fax. Enter the number and press OK. Enter the phone number using the keypad. Select Options > Add to contact. Scroll to the name to which you want to add the number and press Add. Scroll to the desired number type and press Select. Retrieve the name to which you would like to add a second number. Select Details > Options > Add number. Scroll to the desired number type, and press Select. Enter the number, and press OK. Nokia 6560 User Guide
31 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 32 Friday, April 23, 2004 4:40 PM Retrieve the name from the phone book. Press Details, and scroll to the number you want to change. Select Options > Change type. Scroll to the number type you would like and press Select. Change the number type Once you have saved a name with two numbers, you can change the number type for either of the phone numbers. (For example, you can change the type if you saved a number as General and you want to change it to Home.) 1 2 3 4 Specify a primary number If any contacts in your phone book have multiple numbers, specify the number that you dial most often (for that name) as the primary number. By assigning the most-used number as primary, you are telling the phone to dial that number when you select the name for dialinga great time saver when you dial names with two numbers. 1 2 3 Retrieve the name for which you want to select a primary number. Press Details, and scroll to the number you want to set as the primary number. Select Options > As primary number. Primary number set appears on the screen.
CREATE CALLER GROUPS Your phone allows you to create caller groups for listings with similar attributes in your phone book. The five available default caller groups are Family, VIP, Friends, Business, and Other. Each group has attributes that can be defined by the user:
Group name, Group tone, and Group logo. ADD A NAME AND PHONE NUMBER 1 Once you have retrieved the desired name and number from the phone book, select Details > Options > Caller groups. Scroll to the desired caller group (for example, Family), and press Select. 2 SET A RINGING TONE AND GRAPHIC 1 Select Contacts > Caller groups. Scroll to one of the caller groups and press Select. 2 32 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 33 Friday, April 23, 2004 4:40 PM The phone book 3 Scroll to one of the following functions and press Select. Rename groupEnter the new name for the caller group and press OK. Group ringing toneScroll to the desired tone and press OK. Default is the tone selected for the currently selected profile. Group logoScroll to On, Off, or View, and press Select. Group membersPress Select to view group members. To add or remove a member, select Options > Add name or Remove name.
CHECK MEMORY STATUS You can learn what percentage of phone memory is free and what percentage has been used. Select Contacts > Settings > Memory status. Nokia 6560 User Guide
33 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 34 Friday, April 23, 2004 4:40 PM 7 Call history Your phone provides a call log that registers information about calls you make and receive. The call log keeps track of:
Missed calls
Received calls Dialed numbers Time spent on calls
CHECK MISSED, RECEIVED, OR DIALED CALLS 1 2 3 4 From the start screen, select Menu > Call log. Scroll up or down to select Missed calls, Received calls, Dialed numbers, Delete recent call lists, or Call timers. For missed, received, and dialed numbers, a phone number (or the name associated with a number in the phone book) appears. Scroll up or down to the number or name you want, and press Options. For missed, received, and dialed names or numbers, select from the options in the following list:
Call timeShows the date and time when the call was connected, if you have set the phone clock. Send messageAllows you to write and send a text message to numbers listed in the call log. View numberShows a number when the contact name appears in the call list. Edit numberAllows you to edit the number shown on the screen and select from a list of options, which includes adding the number to a contact. SaveSaves the number in your phone book. Add to contactAllows you to add the number to an existing contact. DeleteRemoves the number from the call log. CallAllows you to call the number that just called your phone. To dial any number that appears on the phone screen, press the Talk key. MISSED CALLS Your phone stores the numbers of calls you have missed. When you miss a call, missed call(s) appears, along with the number of calls missed. You are notified of missed calls only if your phone was turned on in the original service area of your service provider. 34 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 35 Friday, April 23, 2004 4:40 PM Call history Note: If you chose the Forward if not answered option in Call Forwarding, your phone treats these forwarded calls as missed calls. See Call forwarding on page 39. DIALED CALLS, RECEIVED CALLS Your phone stores the numbers of the last several calls you have dialed or received.
CLEAR CALL LISTS Your phone uses call lists to track numbers for incoming, outgoing, and missed calls. You can delete some or all of the numbers that appear in the call log. You can delete dialed numbers, received call numbers, or missed call numbers. 1 2 From the menu, select Call log > Delete recent call lists. Scroll to the option you would like to clear and press Select. Warning: You cannot undo this operation.
CALL TIMERS Your phone uses call timers to track the amount of time you spend on each call. You can review phone use by checking the call timers. 1 2 From the menu, select Call log > Call timers. Scroll up or down through the options described in the following list:
Duration of last callShows the time used for the last call made. Duration of dialed callsShows the time used for all outgoing calls since you reset the timers. Duration of received callsShows the time used for all received calls since you reset the timers. Duration of all callsShows the time used for all calls that have been made and received since you reset the timers. Clear timersClears (erases) all call timers for the currently selected phone number. Your phone includes separate timers for each number used, with the exception of the life timer. Warning: This action cannot be undone. If you use this feature to log the amount of time spent on calls, you may want to record the information in the call timers before you clear them. Note: The actual invoice for calls and services from your service provider may vary, depending on network features, rounding off for billing, taxes, and so forth. Note: Some timers may be reset during service or software upgrades. Nokia 6560 User Guide
35 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 36 Friday, April 23, 2004 4:40 PM
TURN ON A CURRENT CALL TIMER You can set your phone to show the elapsed time during a call. 1 From the menu, select Settings > Call settings > Show call time on display > On. Now the timer is active during each call you make or receive. The time appears on the phone screen. After a call has ended, press any key on your phone to clear the current call time from the screen. 2
CLEAR CALL TIMERS 1 2 From the menu, select Call log > Call timers > Clear timers. Enter your security code and press OK. 36 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 37 Friday, April 23, 2004 4:40 PM Advanced calling features 8 Advanced calling features This chapter describes advanced calling features such as conference calling, using call waiting, and using credit cards for calls. Not all the features described here are available in all wireless network systems.
SET IN-CALL OPTIONS Your phone allows you to use a number of features during a call. These features are known as in-call options. To access an option during a call, press Options, and choose one of the following options:
Note: Many in-call options are network service features. To use these options, you may need to contact your service provider. LoudspeakerActivates the speaker phone. Lock keypadActivates Keyguard. RecordRecord sounds with your phone and listen to them later. EqualizerCustomizes the audio properties of your phone. New callCreates a new call while in a call. Touch tonesManually enter a touch tone string (series of tones) or search for a string in your phone. End all callsEnds all active calls. ContactsUse the phone book. Once you open the phone book, pressing the End key will not close the phone book, but it will end the current call. MenuTakes you to the main menus. MuteMutes the phone microphone. If the microphone has already been muted, Unmute appears instead of Mute. Press OK to choose either of these options. Note: The above options can affect the microphones of any enhancements connected to the phone.
CALL WAITING If you have call waiting, your phone beeps during a call to let you know that someone else is calling you. Depending on your caller ID setup, the phone might also show the number of the incoming call. Once call waiting has been activated, Call waiting appears as a menu option. Note: Call waiting is a network dependent feature. In some networks the call waiting code must be activated manually. Contact your service provider for availability and full details. Nokia 6560 User Guide
37 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 38 Friday, April 23, 2004 4:40 PM Store the feature code 1 From the menu, select Settings > Network services > Network feature setting. Enter the feature code your service provider gave you and press OK. Select Call waiting > Activate. 2 3 Activate Select Settings > Network services > Call waiting > Activate. Manage calls Call waiting works with both local and long distance calls.
To answer an incoming call, press the Talk key. To switch from one call to another, press the Talk key. To end both calls, press the End key.
MAKE A CONFERENCE CALL While in a call, you can call another number and add a third party to the call. Note: Conference calling is a network dependent feature. Contact your service provider for availability and details. Add a third party 1 While in a call, select Options > New call, enter the phone number, and press Call. 2 When the third party answers, press the Talk key to connect all calls. Disconnect third party While all three parties are connected, press the Talk key to disconnect the third caller while keeping the second partys call active. Disconnect second party To disconnect the second party and remain connected to the third party, have the second party terminate the call on his/her end. End a conference call To end all calls, press the End key. 38 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 39 Friday, April 23, 2004 4:40 PM Advanced calling features Number look-up during a call If you do not remember a number that you need to call while in another call, and you know that this number is in your phone book, you can retrieve the number without having to end the current call. 1 2 3 During the call, select Options > Contacts > Find. Enter a name and press Find, or scroll through the phone book. Press Details.
VOICE PRIVACY The voice privacy feature protects the privacy of your current phone conversation from other callers placing phone calls on your same network. Note: Voice privacy is a network dependent feature. Contact your service provider for more information. From the menu, select Settings > Network services > Voice privacy. Select On to activate, or Off to deactivate. 1 2 During a call, voice privacy becomes active and notifies you with a beep. A notification message also appears on the screen. If you turn this feature on and voice privacy becomes inactive, your phone beeps and displays the message Voice privacy not active. Note: Use caution when sending confidential information if voice privacy is not active.
CALL FORWARDING With call forwarding, you can send incoming calls to another phone number. Before you can use call forwarding, you must first store the feature codes. Once call forwarding has been activated, Call forwarding appears as a menu option. Note: Call forwarding is a network dependent feature. Some networks require that call forwarding be activated manually. Contact your service provider for availability and full details. Call forwarding feature codes Your network requires separate codes for activating and cancelling the various types of call forwarding. You must contact your service provider to obtain the necessary feature codes for these network services. Once you store these feature codes in your phone, they are sent automatically to the network when you select one of the call forwarding options. Nokia 6560 User Guide
39 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 40 Friday, April 23, 2004 4:40 PM Your phone can store the following types of feature codes:
Forward all callsForward all incoming calls to the number you specify. Forward if busyForward incoming calls when you are in a call. Forward if not answeredForward incoming calls when you are unable to answer. Forward if out of reachForward incoming calls when the phone is out of the network or switched off. Cancel all call forwardingCancel all active call forwarding options. Store the feature code 1 From the menu, select Settings > Network services > Network feature setting. Enter the feature code and press OK > Call forwarding. Select the call forwarding option you want, then select Activate. 2 3 Activate or cancel 1 2 3 4 From the menu, select Settings > Network services > Call forwarding. Select the desired call forwarding option. Select Activate. If you are activating call forwarding, enter the number to which you want your calls forwarded (or press Find to recall a number from the phone book);
then select OK.
AUTOMATIC REDIAL When the wireless network is busy or unavailable, Automatic redial instructs your phone to retry the call. However, this feature does not automatically retry a number when the number you are calling is busy. From the menus, select Settings > Call settings > Automatic redial > On. If the network is busy, your phone makes three additional call attempts. If you want to stop the automatic redial process before the last attempt, press the End key.
CALLING CARD You can use a calling card when you dial long distance. First you must store your calling card information in the phone. Your phone can store information for a maximum of four calling cards. 40 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 41 Friday, April 23, 2004 4:40 PM Advanced calling features Save calling card information PART 1 1 Select Settings > Call settings > Calling card. Enter your security code at the prompt. Scroll to card A, B, C, or D and select Options > Edit > OK > Dialing sequence. Scroll through the list of dialing sequences until you find the one that matches your calling card, and press Select. 2 3 5 PART 2 The order of the following steps may vary, depending on which dialing sequence your card uses. 4 When prompted for the calling card access number, enter the number and press OK. This number is usually the 1-800 number that is listed on the calling card. At the prompt, enter the calling card number (and PIN number if required), and press OK. Press OK again when the Save changes? message appears. Select Card name and enter the card name using your phone keypad. Press OK. 6 7 8 Choose a calling card If you have more than one calling card, you must choose one before making a call. 1 From the menu, select Settings > Call settings > Calling card. Enter your security code at the prompt. Scroll to the desired card and select Options > Select > OK. The message Card ready for use appears. 2 Make a call 1 Enter the phone number, including any prefix (such as 0 or 1) that your calling card might require when you make a calling card call. See your calling card for instructions. Press and hold the Talk key until your phone displays Card call and Wait for tone; then press OK. 2 3 When you hear the tone from your calling card service, press OK. After the tone, your phone displays Again, press OK after tone. Press OK. 4 Note: This procedure might not apply to all the calling card options that are programmed into your phone. Check your calling card for more information, or contact your local or long distance company. Nokia 6560 User Guide
41 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 42 Friday, April 23, 2004 4:40 PM
VOICE TAGS You can dial up to 10 of your stored phone book numbers using the voice dialing feature. Before you can place a call using voice dialing, you must first assign a voice tag to the number. Assign a voice tag to a phone number 1 2 At the start screen, scroll to the name to which you want to give a voice tag. Select Details > Options > Add voice tag > Start. You hear several beeps, and Please speak now appears. Speak clearly into the microphone, or press Quit to cancel the recording. The phone automatically stops recording and then saves and replays the voice tag. 3 VOICE TAG ERRORS If recording is not successful, you may see an error message. Press OK to try again. Before using voice tags, note that:
Voice tags are not language-dependent. They are dependent on the speakers voice. You must say the name exactly as you said it when you recorded it. Voice tags are sensitive to background noise. Record voice tags and use them in a quiet environment. Very short names are not accepted. Use long names and avoid similar names for different numbers.
Note: Using voice tags may be difficult in a noisy environment or during an emergency, so you should not rely solely upon voice dialing in all circumstances. DIAL A NUMBER USING VOICE DIALING 1 Press and hold the Right selection key. When you hear several beeps and Please speak now appears, release the button. If you have the optional headset attached, press and hold the headset button;
when the phone beeps and Please speak now appears, release the button. Pronounce the voice tag clearly into the microphone. When the phone finds the voice tag, the phone automatically dials the number. If the phone does not locate a number, you hear an error tone and No match found appears. To start voice dialing again, press and hold the Right selection key (or the headset button) immediately after the error tone. 2 42 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 43 Friday, April 23, 2004 4:40 PM Advanced calling features Play back a voice tag Select Contacts > Voice tags. 1 2 Scroll to the name with the voice tag you want to hear. 3 Select Options > Playback. Change a voice tag 1 2 3 Select Contacts > Voice tags. Scroll to the name with the voice tag you want to change. Select Options > Change > Start. The phone repeats your voice tag, and Voice tag changed appears. Erase a voice tag 1 2 3 Select Contacts > Voice tags. Scroll to the name with the voice tag you want to delete. Select Options > Delete > OK.
VOICE RECORDER This feature allows you to record speech or sounds with your phone. You can record information such as phone numbers and personal memos, but the voice recorder can also record an active phone conversation. The total available time is 180 seconds if no memos have been stored. The maximum length of a recording depends on how much memory remains available. The length of time remaining for a current recording will be displayed on the phone screen. Record speech or sound 1 From the menu, select Voice > Voice recorder > Record. After the recorder start tone is heard, the phone begins recording. Enter the title you wish to assign to the recording and press OK. 2 When you finish recording, select Stop. 3 Record while in a call 1 While in a call, select Options > Record. After the recorder start tone is heard, the recorder begins recording the phone conversation. Also, the recorder recording tone will play every 5 seconds to remind the other person on the call that the conversation is being recorded. 2 When recording is done, select Stop. Recording saved appears, and the recording is saved in the Recordings list. Nokia 6560 User Guide
43 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 44 Friday, April 23, 2004 4:40 PM View recording list and play recordings 1 View your saved recordings by selecting Voice > Voice recorder >
Recordings list. Scroll to the recording you would like to play, and select Options > Playback. End the playback by selecting Stop. 2 3 Delete a recording From the Recording list menu, select the recording you would like to delete, and select Options > Delete. Edit a recording title 1 Go to the Recordings list, and scroll to a recording. 2 Select Options > Edit title. 3 Edit the title as needed and press OK. Set the voice memo alarm 1 2 3 Go to the Recordings list, and scroll to a recording. Select Options > Add alarm. Enter the alarm date and time, and press OK. When the alarm sounds, select Stop > Options > Play or Play via IHF to hear the recording. Note: The recorder cannot be used when a data call or GPRS connection is active.
VOICE COMMANDS The voice command feature allows hands-free operation of certain phone features. You can add a voice command to select a profile, or activate a feature. Voice commands work similar to voice dialing. Before using voice commands, you must first associate a voice tag to the phone function. You can set as many as five voice commands. View available functions From the menu, select Voice > Voice commands to scroll through the list of profiles and features:
ProfilesNormal, Silent, Meeting, Outdoor, Pager Voice mailboxCheck your voice messages. InfraredActivates the IR port. Voice recorderRecord personal memos or active calls. Call logSet up a voice command to take you to your call log. 44 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 45 Friday, April 23, 2004 4:40 PM Advanced calling features Add a voice tag for the command 1 2 3 Select Voice > Voice commands. Scroll to the phone function you wish to tag, and press Select. Select Options > Add command > Start. Speak the voice tag clearly into the microphone, or press Quit to cancel the recording. The phone replays then saves the recorded tag. The commands which have voice tags assigned. icon appears next to Activate a voice command After you have associated a voice tag with a phone function, you can issue a command by speaking the voice tag. There are two ways to activate a voice command:
1 If you have the optional headset attached, press and hold the headset button. OR Press and hold the Right selection key. 2 When Please speak now appears, pronounce the voice tag clearly into the microphone. When the phone finds the tag, Found appears, and the command is issued. Voice command tag options After you have associated a voice tag to a command, you can choose one of the following options:
Listen to the tag (playback) Change the tag Delete the tag
CALLER ID With each call you place, you can determine whether your telephone number appears to the person you are calling. In most service areas, when you call others, your name is presented to their caller ID (if they subscribe). With Send my caller identity, you can block the display of your number when you make a call. Note: This feature is available only when supported by the wireless network and may not function if you are roaming. This feature works on a call-by-call basis. You must enable this feature each time you want to block the sending of your own number to the recipients caller ID. Nokia 6560 User Guide
45 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 46 Friday, April 23, 2004 4:40 PM Store the feature code Before you can use Send my caller identity, you must store the feature code for activating this feature. Once the code is stored in your phone, it is sent automatically to the network when you select this option from your phone menu. 1 From the menu, select Settings > Network services > Network feature setting. 2 Enter the feature code from your service provider and select OK. 3 Select Send my caller identity > Yes. Show or hide your number From the menu, select Settings > Network services > Send my caller identity >
Yes or No.
SELECT A PHONE NUMBER Your service provider programs your phone number and system information into your phone memory when your phone is first activated. Your phone can hold up to three numbers. This means that your phone can be activated in three different service areas. Each service area would assign a different phone number or account to your phone. You must select a phone number for your home system. Only one phone number can be active at a time. If you travel outside your home system, you can choose another number. One phone number is usually enough if your service provider has service or roaming agreements for each area in which you wish to use your phone. Contact your service provider for details. You need at least one active number to make calls. You cannot change from one phone number to another during a call. Note: Phone number selection is a network dependent feature. Some networks may not support more than one number. Contact your service provider for availability and full details. Select the phone number 1 From the menu, select Menu > Settings > Network services > Own number selection. Scroll to the phone number you want to use and press Select. 2 46 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 47 Friday, April 23, 2004 4:40 PM Advanced calling features
SET TOUCH TONES Touch tones (or DTMF tones) are sounds that are produced when you press the keys on your phone keypad. You can use touch tones for many automated over-the-phone services such as checking bank balances and airline schedules and using your voice mailbox. Touch tones can be sent only when a call is active. Warning: If you send touch tones while in the analog mode, be careful not to send confidential information. Set manual touch tones 1 From the menu, select Settings > Phone settings > Touch tones > Manual touch tones. Select one of the following options, and then press Select:
2 ContinuousThe tone sounds as long as you press and hold the key. FixedSets the length of touch tones to Short. OffTurns off the tones. No tones are sent when you press a key. Set length You can set the length of each touch tone when you are in analog mode. From the menu, select Settings > Phone settings > Touch tones > Touch tone length > Short or Long. Store strings You can store touch tone strings the same way that you store names and numbers in your phone book. You can store an entire sequence of digits and send it as touch tones for frequently used strings of numbers. WITH PHONE NUMBERS 1 2 Enter the phone number that you want associated with a touch tone. Press * as many times as needed to enter a w or p. w (wait): When you dial this phone number, your phone first dials the number, and then waits (because of the w character) for you to press Send. When you press Send, the phone sends your touch tone. p (pause): If you include a p character instead of a w, your phone pauses for 2.5 seconds and then automatically sends the touch tone. Enter the touch tone string. Store the number as you normally would. 3 4 Nokia 6560 User Guide
47 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 48 Friday, April 23, 2004 4:40 PM SEND A STRING 1 From the menu, select Settings > Phone settings > Touch tones > Manual touch tones. 2 Make sure that the setting is not set to Off; if it is set to off, scroll to one of 3 4 the other options and press Select. During your call, select Options > Touch tones. Enter the touch tone string or retrieve the string from the phone book, and press Tones. 48 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 49 Friday, April 23, 2004 4:40 PM Voice mail 9 Voice mail Voice mail provides a way for callers who miss you to leave a message that you can retrieve later. To use voice mail, you must sign up for the feature with your wireless service provider.
CHECK MESSAGES Your phone notifies you when you receive a voice message (see Set the message alert tone on page 53). The message New voice message appears on the phone screen, along with the If you have received more than one voice mail message, depending on your wireless network, your phone may show the number of messages that you have received. icon. Note: To use voice mail, you need to learn the various greetings, passwords, and prompts of the voice mail system. Your service provider can provide instructions.
SET UP MAILBOX As part of your networks voice mail feature, your service provider gives you a voice mailbox phone number. Save this number in your phone to make retrieving your voice messages quick and convenient. 1 2 Your voice mailbox number can be up to 32 digits long and is used until changed. Therefore, if your phone number changes, you may need to change your voice mailbox number along with it. From the menu, select Messages > Voice messages > Voice mailbox number. Enter your voice mailbox phone number, and press OK.
SET GREETINGS Voice greetings may vary in different wireless systems. If you need information about how to record your greeting, contact your service provider. Nokia 6560 User Guide
49 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 50 Friday, April 23, 2004 4:40 PM
LISTEN TO MESSAGES The method for listening to your voice messages varies, depending on your service provider. Call your service provider if you have any questions.
When your phone alerts you to new voice messages, press Listen and follow the instructions given on the phone. To listen later, press Exit. To listen to your voice messages at any time, press and hold the 1 key. OR From the menu, select Messages > Voice messages > Listen to voice messages. Follow the prompts to review your messages.
50 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 51 Friday, April 23, 2004 4:40 PM 10 Personalize rings and tones Personalize rings and tones
PROFILES Ringing options Ringing tone Ringing volume Vibrating alert A profile is a group of settings you can use to customize the way your phone works. You can set your own preferences for these items:
Message alert tone
Keypad tones
Warning tones
Your phone comes with five profiles, and each can be customized:
Meeting Outdoor
Pager Alert for Profile name (except for Normal) Normal (default setting) Silent
SELECT A DIFFERENT PROFILE Quickly tap the power key or select Menu > Profiles. Select the profile you want to use. Profile names are highlighted as you scroll through them.
CUSTOMIZE A PROFILE 1 2 1 2 Select Menu > Profiles. Select the desired profile in the list:
SelectActivates the currently highlighted profile. CustomizeEnables you to customize a profile by changing the current settings. Press Select to view a list of options. TimedAllows you to set a time length for the expiration of a profile setting. Note: When you change a setting in the current profile, it affects only that profile. Normal settings do not change. Nokia 6560 User Guide
51 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 52 Friday, April 23, 2004 4:40 PM Set ring options You can choose the type of ring your phone uses to notify you of an incoming call. This setting does not affect any incoming text message alert tones. 1 2 3 4 Select Menu > Profiles. Select the desired profile for which you want to set the ringing options. Select Customize > Ringing options. Select one of the ringing options:
RingThe phone rings normally. AscendingRinging volume increases (gets louder) if the phone is not answered. Ring onceThe phone rings once to indicate an incoming call. Beep onceThe phone beeps once to indicate an incoming call. SilentThe phone makes no sound. Set the ringing tone The ringing tone is the sound your phone makes when you receive a call. You can set the ringing tone to a specific sound or tune to personalize the rings. Note: If you have already chosen a ringing option of either Silent or Beep once, the ringing tones are already turned off. Select Menu > Profiles. Select the profile for which you want to set the ringing tones. Select Customize > Ringing tone. Scroll through the options; when you hear the tone you want, press Select. 1 2 3 4 Set the ring volume You can set the default ringing volume for incoming voice calls and message alert tones. 1 2 3 4 Select Menu > Profiles. Select the profile for which you want to set the ringing volume. Select Customize > Ringing volume. Scroll through the options; when you hear the volume level you want, press Select. Note: As you scroll through the ringing options, pause to hear a sample of the tone. Although the ringing sample for level 4 and level 5 are the same, ringing level 5 will produce very loud ringing. 52 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 53 Friday, April 23, 2004 4:40 PM Personalize rings and tones Select Menu > Profiles. Select the profile for which you want to set the vibrating alert, and press Select. Select Customize > Vibrating alert > On. Set a vibrating alert You can have your phone vibrate to indicate an incoming call. 1 2 3 The phone does not vibrate when connected to any charging device. Set the message alert tone You can set your phone to use a certain tone to indicate an incoming text message. 1 2 3 4 Select Menu > Profiles. Select the profile for which you want to set the message alert tone. Select Customize > Message alert tone. Scroll through your choices, and select the tone you want. The phone plays samples of each choice as you scroll to it. Set keypad tones Keypad tones set the volume of the tone you hear when you press your phone keys. 1 2 3 4 Select Menu > Profiles. Select the profile for which you want to set the keypad tones. Select Customize > Keypad tones. Scroll to one of the levels and press Select. If you choose Off, no keypad tones are heard. If you chose the Silent profile, the keypad tones are turned off. Set warning tones You can set warning tones and the tones used for the games in your phone. Warning tones include the sounds your phone makes during error conditions, during confirmations, when a battery is low, and when you need to recharge the battery. 1 2 3 Select Menu > Profiles. Select the profile for which you want to set the warning tones. Select Customize > Warning tones > On. If you do not want to use warning tones, you can select Off. Note: Game sounds can only be set under the Games menu. Nokia 6560 User Guide
53 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 54 Friday, April 23, 2004 4:40 PM AUDIBLE ALERT You can choose to have your phone sound an audible alert only when a member of a selected caller group is calling. For more details, see Create caller groups on page 32. RENAME A PROFILE You can rename any of the profiles except Normal. You may want to use your own name for one of the profiles. If you do this, and whenever that profile is selected, your name appears on the start screen. 1 2 3 4 Select Menu > Profiles. Select the desired profile. Select Customize > Profile name. Enter the new name and press OK.
SET A TIMED PROFILE Timed profiles can be used to prevent missed calls. For example, suppose you attend an event that requires your phone be set to Silent before the event starts, but you forget to return it to Normal until long after the event. During this time, you may have missed several calls because the ringing tone was silent. A timed profile can prevent this by automatically returning your phone to the default profile at a time you specify. Note: Timed profiles can be set up to 24 hours. At the start screen, select Menu > Profiles. Select the profile you wish to activate and set for timed expiration. Select Timed. Enter the time (hh:mm) and press OK Select am or pm. 1 2 3 4 5 The profile you have set for expiration is now active and appears in the start screen along with the icon. 54 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 55 Friday, April 23, 2004 4:40 PM Personalize phone settings 11 Personalize phone settings You can change certain settings so that your phone suits your own needs and lifestyle. Changes you can make include changing the language on the screen, showing or hiding the clock, and setting up 1-touch dialing.
SET THE LANGUAGE You can set your phone to use a certain language. Your possible choices are English, Spanish, Canadian French, Brazilian Portuguese, Russian, Hebrew, and traditional Chinese. These choices vary in different regions. All these languages may not be available in your phone. 1 2 From the menu, select Settings > Phone settings > Phone language. Select the language you want to use.
SET AND DISPLAY THE CLOCK Your phone has an internal clock that you can set to appear on the phone screen. The clock is connected to an alarm clock. See Alarm clock on page 89 for details. Set the clock 1 2 From the menu, select Settings > Time and date settings > Clock > Set the time. Enter the time (hh:mm) and press OK. For example, to set your clock to 9:30 a.m., enter 09:30. If you set the time format for 24-hour time, enter the number the same way: 09:30 for 9:30 a.m., or 21:30 for 9:30 p.m.
If you set the time format to am/pm, select am or pm. If you set the time format to 24-hour, the time is set as soon as you press OK after adjusting the time. Show or hide the clock 1 From the menu, select Settings > Time and date settings > Clock >
Show clock. Select Hide clock if you do not want to display it. 2 Nokia 6560 User Guide
55 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 56 Friday, April 23, 2004 4:40 PM Select the am/pm or 24-hour format You can change the way your clock shows the time, whether in am/pm (12-hour) or 24-hour format. From the menu, select Settings > Time and date settings > Clock > Time format >
24-hour or 12-hour. Set the date 1 At the start screen, select Menu > Settings > Time and date settings >
Date > Set the date. 2 Enter the date and press OK. Show or hide the date You have the option of displaying (or not displaying) the date on the start screen. At the start screen, select Menu > Settings > Time and date settings > Date >
Show date or Hide date. You will only see one of these options, depending on which one is currently selected. Change the date format 1 At the start screen, select Menu > Settings > Time and date settings >
Date > Date format or Date separator. Select the format of your choice. A message appears in the display confirming your selection. 2
NETWORK UPDATED CLOCK You can set the phone clock to be updated by the network, if supported by your network service. Turn on update From the menu, select Settings > Time and date settings > Auto-update of date
& time > On or Confirm first. If you choose Confirm first, you will receive a confirmation message before the clock is updated. Select OK to accept the update, or Exit to reject it. Turn off update From the menu, select Settings > Time and date settings > Auto-update of date & time > Off. 56 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 57 Friday, April 23, 2004 4:40 PM Personalize phone settings
WELCOME NOTE You can set your phone to show a brief welcome note each time you switch on your phone. The maximum length of this note is 44 characters. 1 2 3 From the menu, select Settings > Phone settings > Welcome note. Enter the text of the welcome note. Select Options > Save. If you ever want to delete the welcome note, select Delete in this step.
START-UP TONE You can set your phone to play a brief start-up tone when you switch it on. From the menu, select Settings > Phone settings > Start-up tone > On or Off.
1-TOUCH DIALING You must store names and numbers in your phone book before you can use speed dialing (1-touch dialing). To set up speed dialing, assign a name from the phone book to a 1-touch dial location, using keys 2-9. When you press and hold the key, the phone automatically dials the associated number. The 1 key is used exclusively to dial your voice mailbox. See Voice mail on page 49 for more information. The 2 key may be used as a customer support number to dial your service provider. See Contact your service provider on page 8 for details. You can overwrite this feature and assign a 1-touch dial location to the 2 key. Set up 1 2 3 Select Contacts > 1-touch dialing. Scroll to the first number that includes the message (empty) and press Assign. Press Find or scroll to the name and number to which you want to assign this key and press Select. Speed dialing To call a number using speed dialing, press and hold the appropriate key for a few seconds. The phone dials the number. Nokia 6560 User Guide
57 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 58 Friday, April 23, 2004 4:40 PM Edit numbers After you have assigned a speed dialing number to a key, you can change key and number associations at any time. 1 2 3 4 When you have entered the number, press OK. Select Contacts > 1-touch dialing. Scroll to the key you want to change and select Options > Change. Enter the new number or retrieve a number from the phone book. OR If you have found a number in the phone book, press Select. If the name you selected has more than one number, scroll to the number you want and press Select. Note: When 1-touch dialing is activated, calls may still be possible to the official emergency number programmed into your phone. Delete numbers You can delete speed dialing key assignments at any time. 1 2 3 Select Contacts > 1-touch dialing. Scroll to the key with the number you want to delete. Select Options > Delete > OK.
RIGHT SELECTION KEY SETTINGS You can change the function of the Right selection key so that your most frequently used functions can be quickly accessed from the start screen. This list of functions is called the Go to menu. Choose functions 1 2 From the menu, select Settings > Right selection key settings > Select options. Highlight the desired functions from the list of available functions, and press Mark (Unmark to remove a marked function from the list). A mark appears in the box next to the selected function indicating that you have selected the function. Continue to Mark (select) or Unmark (remove) as many functions as you wish. Select Done when you have finished creating your quick list of functions. 3 4 5 When Save changes? appears in the display, select Yes. On the start screen, Go to is now the Right selection key option. Select Go to to display a list of the functions you selected. 58 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 59 Friday, April 23, 2004 4:40 PM Personalize phone settings Organize functions 1 2 3 From the menus, select Settings > Right selection key settings > Organize. Highlight the function you wish to rearrange, and select Move. Select Move up, Move down, Move to top, or Move to bottom from the list of choices. The list of Right selection key functions is displayed in the new order. Select Done > Yes to save the changes. 4
DISPLAY SETTINGS Wallpaper You can set your phone to display a background picture (wallpaper) on the start screen. Some preselected pictures are saved in the Gallery menu. You can also download pictures from xHTML pages, or transfer them and save them in the gallery. Your phone supports JPEG, GIF, BMP, PNG, and WBMP formats. SELECT WALLPAPER 1 From the menu, select Settings > Display settings > Wallpaper > Select wallpaper. Highlight Graphics and press Open. Scroll through the image gallery. 2 3 4 When you arrive at the image of your choice, select Options > Set as wallpaper. ACTIVATE OR DEACTIVATE From the menu, select Settings > Display settings > Wallpaper > On or Off. Color schemes You can change the color of some display components in your phone, such as indicators and signal bars. 1 2 Screen saver The screen saver is activated when no function of the phone is used after a preset period of time. Press any key to deactivate the screen saver. The screen saver is also deactivated when the phone is out of the network coverage area. From the menu, press Settings > Display settings > Color Schemes. Scroll to the color scheme of your choice and press Select. Nokia 6560 User Guide
59 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 60 Friday, April 23, 2004 4:40 PM You can set your phone to display a screen saver after a preset time or after a custom time (up to 60 minutes) of your choosing. 1 From the menu, select Settings > Display settings > Screen saver timeout >
2 minutes or 5 minutes. If you want to set a custom time (up to 60 minutes), select Other, enter the custom time, and press OK. 2 Display brightness You can change the brightness of your phone display. See Display contrast on page 16 for more information.
TONE SETTINGS You can adjust the ringing volume, keypad tones, and more for the currently active profile. From the menu, select Menu > Settings > Tone settings. The options are described in detail under Customize a profile on page 51.
ENHANCEMENT SETTINGS The Enhancement settings menu and submenus are shown only if the phone is or has been connected to a compatible enhancement, such as the headset, car kit, mobile inductive Loopset, or TTY/TDD device. 1 At the start screen, select Menu > Settings > Enhancement settings >
Headset, Handsfree, Loopset, or TTY/TDD. Scroll to the option of your choice and press Select to enter the option submenu and modify its settings. The following options are available:
2 Default profileChoose the profile you wish to be automatically activated. See Profiles on page 51 for more information. Automatic answerCalls are answered automatically after one ring. Select On or Off. LightsChoose to keep the phone lights always on, or to shut off automatically after several seconds. Select On or Automatic. Note: Lights are only available with Handsfree.
RESTORE THE FACTORY SETTINGS You can change the default (factory) settings for your phone. You can return them to the original settings when needed. Note: The phone does not reset the memory, timers, call log, language selection, and security code. However, any profiles you have modified are reset when you restore your settings. 60 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 61 Friday, April 23, 2004 4:40 PM 1 2 From the menu, select Settings > Restore factory settings. Enter your security code and press OK. See Phone security on page 63 for more details about the security code. Personalize phone settings
ACCESSIBILITY SOLUTIONS Nokia is committed to making mobile phones easy to use for all individuals, including those with disabilities. Nokia maintains a site on the World Wide Web that is dedicated to accessibility solutions. For more information about phone features, enhancements, and other Nokia products designed with your needs in mind, visit www.nokiaaccessibility.com. LPS-4 Mobile Inductive Loopset The LPS-4 Loopset is a Nokia enhancement designed to make the phone more accessible to hearing-aid users. The Nokia Loopset gives hearing-impaired wireless customers clear access to digital telephony for the first time. With the Loopset, people who use a T-coil equipped hearing aid can make and receive calls without noise interference. The LPS-4 Loopset uses inductive technology to transmit sound to a hearing aid equipped with a T-coil. With inductive technology, the sound from the phone is amplified more efficiently and background noise is eliminated. The Loopset is easy to use. You wear the Loopset around your neck, connect it to your phone, and speak directly toward the microphone. For detailed instructions on using the Loopset, refer to the booklet that comes with the LPS-4. Note: The Loopset can be purchased separately as an enhancement. TTY/TDD capable This feature makes the phone more user friendly for hearing-impaired users. This is a network-dependent feature. Contact your service provider to ensure that it supports this feature. To send and receive messages using a TTY or TDD device, you will need the following equipment (in addition to your phone):
A TTY/TDD device that is cellular ready or cellular compatible A connector cable, usually supplied with the TTY/TDD device The Nokia HDA-10 phone adapter, which can be purchased as an enhancement. Nokia 6560 User Guide
61 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 62 Friday, April 23, 2004 4:40 PM Connect the TTY/TDD device 1 2 3 Connect the cable to the TTY machine. Connect the cable to the adapter. Connect the adapter to the phone. 18 in Make a call 1 From the menu, select Settings > Enhancement settings > TTY/TDD >
Use TTY > Yes. Dial the number on the phone, and press the Talk key. 2 3 When the receiving party answers, you can begin typing text on the TTY/TDD. Receive a call 1 Ensure that the TTY/TDD and phone are powered on and are connected, and ensure TTY/TDD setting in under Enhancement settings is set to Yes. Once contacted by the other party, type responses on the TTY/TDD. 2 End a call Press the End key to end your call. 62 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 63 Friday, April 23, 2004 4:40 PM 12 Phone security Phone security Your phone is equipped with a versatile security system that is intended to prevent unauthorized use of the phone. You cannot activate or use certain phone features until you enter your security code.
The default (preset) security code is 12345. Nokia highly recommends that you immediately change this code. Then, write down and store the new code in a safe place, away from your phone.
When you enter the security code, an * appears on the screen each time you press a key. The * prevents others from seeing your code. If you enter the wrong security code five times in a row, your phone will not accept any entries for the next five minutes. However, if you realize that you have entered the code incorrectly before pressing OK, you can use Clear to delete the code, digit by digit, beginning with the last digit.
Your phone is equipped with helpful security features:
Avoid making accidental calls. Prevent unauthorized use of your phone. Restrict outgoing or incoming calls. Avoid erasing your phone book directory.
KEYGUARD (LOCK KEYPAD) Keyguard disables your keypad to prevent accidental key presses. When the Keyguard is on, calls still may be possible to the official emergency number programmed into your phone. Enter the emergency number and press the Talk key. The number is displayed only after you have keyed in its last digit. To lock the keys, press Menu > *. To unlock the keys, press Unlock > *. Manual Keyguard
If the phone rings with Keyguard on, press the Talk key or Answer to answer the call. Keyguard reactivates once the call has ended. To activate the lights with Keyguard on, press the Power key. Nokia 6560 User Guide
63 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 64 Friday, April 23, 2004 4:40 PM Automatic Keyguard You can set your phone to automatically lock the keys. 1 From the menu, select Settings > Phone settings > Automatic keyguard > On. Set delay appears, with the time displayed in mm:ss format. Enter the amount of time you want the phone to wait before turning Keyguard on, and press OK. For example, to enter five minutes, press 0, 5, 0, 0, and OK. 2 The shortest time you can enter is 10 seconds, and the longest time you can enter is 60 minutes. You will still press Menu > * to unlock the keys manually and use all the features of your phone. When you are finished, Keyguard automatically activates at the time you set.
CHANGE YOUR SECURITY CODE 2 3 4 Nokia highly recommends that you immediately change your security code so that others who know the default code cannot enter the correct code. 1 From the menu, select Settings > Security settings > Access codes >
Change security code. Enter the default security code (1 2 3 4 5) and press OK. At the prompt, Enter new security code, enter your new security code and press OK. At the prompt, Verify new security code, enter your new security code again and press OK. Security code changed appears. If you have changed your security code and do not remember the new code, contact your service provider. Once you have changed your security code, the default setting is no longer valid.
PHONE LOCK This feature protects your phone from unauthorized outgoing calls or unauthorized access to information stored in the phone. When phone lock is activated, Phone locked is displayed in the start screen when you turn the phone on. When you press Menu or Contacts, you are prompted to enter the lock code. Once the lock code has been accepted, the phone functions normally. Call not allowed is displayed if you attempt to place a call while the phone is locked. 64 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 65 Friday, April 23, 2004 4:40 PM Note: When the phone is locked, calls still may be possible to the official emergency number programmed into your phone. Phone security Lock code In addition to a security code, your phone also has a lock code. You will need the lock code to activate and deactivate the phone lock feature or to change your lock code. The default lock code is 1234. If you enter an incorrect lock code five times in a row, your phone will prompt you for the security code (see Change your security code on page 64). Change your lock code 1 From the menu, select Settings > Security settings > Access codes >
Change lock code. Enter the current (or default) lock code and press OK. Enter the new lock code and press OK. Reenter the new lock code for verification, and press OK. 2 3 4 Note: When you change your lock code, make sure you store it in a safe place, away from your phone. Avoid entering access codes similar to emergency numbers to prevent accidental emergency calls. Activate and deactivate 1 From the menu, select Settings > Security settings > Access codes >
Phone lock. Enter the lock code, and press OK. Select On power-up, On, or Off. If you selected On power-up, turn the phone off and back on to complete the phone lock activation. 2 3 4 Answer a call with phone lock on Press the Talk key or Answer. Allowed number when phone locked When phone lock is on, the only outgoing calls that can be made are to the following numbers:
The emergency number programmed into your phone (for example, 911) The number stored in the Allowed no. when phone locked location Nokia 6560 User Guide
65 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 66 Friday, April 23, 2004 4:40 PM 2 3 Store the allowed phone number 1 From the menu, select Settings > Security settings > Access codes >
Allowed no. when phone locked. Enter the lock code and press OK. Press Assign and enter the phone number, or press Find and recall the number from the phone book. Press OK. 4 Call the allowed phone number With the phone locked, at the start screen, press the Scroll key up or down to display the number, and press the Talk key to place the call.
RESTRICT CALLS You can restrict incoming and outgoing calls. To restrict outgoing calls, you create a list of restrictions and apply the appropriate restriction. Before you define restrictions for outgoing calls, two restriction options are available: Select and Add restriction. The maximum number of call restrictions you can define is 10. Note: When calls are restricted, calls still may be possible to the official emergency number programmed into your phone. Enter the emergency number and press the Talk key. Add a number to the call restriction list You can create a list of restrictions for both outgoing and incoming calls. 1 2 3 4 From the menu, select Settings > Security settings > Call restrictions. Enter your security code, and press OK. Select Restrict outgoing calls or Restrict incoming calls > Add restriction. Enter the number you want to restrict, or retrieve the number from the phone book, and press OK. If the name selected has more than one number assigned, scroll to the number you want and press Select > OK. Contact name appears. 66 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 67 Friday, April 23, 2004 4:40 PM Phone security 5 Enter a name for the restriction, if needed, and press OK. If you press OK without entering a name, the number will be used. After you have used the Add restriction option to add at least one restriction, the options become available:
SelectAllows you to select call restrictions from the outgoing calls list. Add restrictionAllows you to add a call restriction. EditAllows you to edit an existing call restriction. EraseErases an existing call restriction. From the menu, select Settings > Security settings > Call restrictions. Restrict outgoing calls 1 2 When Security code appears, enter your security code, and press OK. 3 4 5 Select Restrict outgoing calls > Select. Scroll through your list of restrictions and mark the ones you want to restrict. Select Done > Yes to save the changes. When you or someone else attempts to place a call to a number you have restricted, Call not allowed appears, and the call is cancelled. If you have not added any numbers for call restrictions, your only option will be All calls. Restrict incoming calls 1 2 3 From the menu, select Settings > Security settings > Call restrictions. Enter your security code, and press OK. Select Restrict incoming calls > Add Restriction to choose from your list of call restrictions. Scroll through your list of restrictions and mark the ones you want to restrict. Select Done > Yes to save the changes. If you have not added any restrictions, your only option will be All calls. 4 5 Turn off call restrictions 1 2 From the menu, select Settings > Security settings > Call restrictions. Enter your security code, and select OK > Restrict outgoing calls or Restrict incoming calls. Scroll to Select and press Select to choose from your list of call restrictions. If you have not added any restrictions, your only option will be All calls. Scroll to the number you want to deactivate and press Unmark > Done > Yes. The restriction is turned off. 3 4 Nokia 6560 User Guide
67 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 68 Friday, April 23, 2004 4:40 PM 13 Personal digital assistant Your phone features a personal digital assistant which includes a calendar, to-do list, a calculator, currency converter, and a stopwatch. Each of these features can help you organize your everyday life.
CALENDAR The calendar keeps track of notes, calls, meetings, and birthdays. It can also sound an alarm when it is time for you to make a call, go to a meeting, or wake up. To get to the calendar feature, select Organizer > Calendar, or press and hold the right arrow on the Scroll key when at the start screen. Note: Your phone must be on to use this function. Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger. Options in day view VIEW DAY This option allows you to view notes added to a specific day. MAKE A NOTE You can use predictive text when writing a note. If it is not already active, choose it from the Options menu. For more information, see Turn on text input on page 25. 1 To make a note for a specific date, select the date and Options > Make a note > Meeting, Call, Birthday, Memo, or Reminder. The maximum length of a calendar note is 256 characters. Press Options > Save to save your note. Follow the prompts for the type of note you have selected. Press Options and select an item from the list, or press OK where appropriate, to complete your note:
MeetingEnter a subject, location, and start time. CallEnter the phone number, name, time, and alarm option. BirthdayEnter the persons name, year of birth, and alarm option. The note displays the persons age. MemoEnter a subject, end date, and alarm option. ReminderEnter the reminder, and alarm option 2 3 4 GO TO DATE To go to a specific date, enter the date and press OK. The month appears and the date you entered is highlighted. 68 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 69 Friday, April 23, 2004 4:40 PM Personal digital assistant SETTINGS
The Settings option allows you to set the date, time, date format, date separator, time format and the week starts format for the calendar. The Auto Delete option allows you to set the phone to automatically delete old notes after a certain period of time. However, repeat notes such as birthday or anniversary notes will not be deleted. GO TO TO-DO LIST This option allows you to go to the to-do list from the calendar, where you can save a task to a specified day. SEND NOTE Send a note directly from your calendar to another phone. While viewing the note, select Options > Send note > Via infrared, Via calendar, or Via text message. If you select Via infrared, the phone begins sending the note immediately. If you select Via calendar or Via text message, enter the phone number, and press OK.
TO-DO LIST Use this feature to create a to-do list and prioritize to-do items. ADDING A TASK 1 2 3 From the menu, select Organizer > To-do list > Options > Add. Enter the subject of the To-do list and select Options > Save. Select the desired priority (High, Medium, or Low). You can change the priority later when viewing the note by selecting Options > Edit priority. VIEW TASKS Once in the To-do list, scroll to an item and select Options > View to view its details. From the Options menu, you can view, add, delete, or edit a task. You can also edit the priority of a task, save a task to your calendar, turn predictive text (Dictionary) on/off, or send your task as text, using SMS or infrared.
THE CALCULATOR The calculator adds, subtracts, multiplies, divides, and calculates exchange rates. 1 2 From the menu, select Extras > Calculator. Enter the first number. Press the Clear key to erase any mistakes. Nokia 6560 User Guide
69 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 70 Friday, April 23, 2004 4:40 PM 3 Based on the type of calculation that you need, use one of the following functions:
Function Enter a decimal Add Subtract Multiply Divide Square the number Action Press # (.) Press * (+) Press * twice (-) Press * three times (*) Press * four times (/) Select Options > Square. Take the square root Select Options > Square root. Change the sign Select Options > Change sign. 4 5 6 Enter the second number. Repeat steps 3 and 4 as many times as necessary. Select Options > Equals. Note: This calculator has limited accuracy and is designed for simple calculations.
CONVERT CURRENCY You can use the calculator to first set the exchange rate and then to calculate the exchange value. Set the exchange rate 1 From the menu, select Extras > Calculator > Options > Exchange rate >
Foreign units in home units or Home units in foreign units. The exchange rate box opens, with the number 0. Enter the appropriate number and press OK. To enter a decimal point, press #. Press OK. 2 3 70 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 71 Friday, April 23, 2004 4:40 PM Personal digital assistant Calculate currency using the exchange rate 1 2 3 From the menu, select Extras > Calculator. Enter the number of units you want to convert. Select Options > To home or To foreign > Select. To home converts foreign units of currency to home units using the exchange rate you entered. To foreign converts home units of currency to foreign units using the exchange rate you entered. Note: When you change base currency, you must enter the new rates because all previously set exchange rates are reset to 0.
BUSINESS CARDS Your phone can send or receive electronic business cards. A business card may consist of a name, phone number, and text entry. You can save received business cards in your phone book. Send a business card 1 2 Find the name in your phone book. Select Details > Options > Send bus. card > Via text message or Via infrared. Enter the phone number or recall it from the phone book, and press OK. 3 View a received card When you receive a business card, the phone shows Business card received. Note: If you press Exit at any time before you save the business card, Discard business card? appears. Choose OK or Back. Scroll through the available information. 1 When your phone shows Business card received, press Show. 2 Save a viewed card While viewing the business card, select Save > OK. Delete a viewed card While viewing the business card, select Exit > OK.
STOPWATCH You can use your stopwatch feature to measure time in hours, minutes and seconds with your phone. This measured time can be saved, viewed, or erased. Nokia 6560 User Guide
71 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 72 Friday, April 23, 2004 4:40 PM Note: Using the stopwatch or allowing it to run in the background when using other features increases the demand on battery power and reduces the battery life. Measure split time 1 2 From the menu, select Extras > Stopwatch > Split timing > Start. Take an intermediate time by pressing Split. The clock continues to run and the split time appears below the running time. If you split the time more than once, the new measured time appears at the beginning of the list, and all times are numbered in descending order. Measure lap time The lap time function allows you to measure the amount of time it takes to complete a cycle or lap. 1 From the menu, select Extras > Stopwatch > Lap timing > Start. The running time appears on the display. Take a lap time by pressing Lap. Pressing Lap will stop the running time and cause it to restart from zero. Each lap time will appear below the running time. The newest measured time will appear at the top of the list of lap times. You can scroll to review previous times. 2 Save the time 1 While the clock is running, select Stop > Options > Save. 2 Enter a title for the measurement, and press OK. If a title is not entered, the time measurement will be used as a title. Other options You can choose the following options when using the stopwatch:
Split timingAllows you to record and split a time sequence Lap timingAllows you to record multiple lap times ContinueShows up when the stopwatch was interrupted without pressing Stop. Show last timeAllows you to view the last measured time. View timesAllows you to browse the saved times. Delete timesAllows you to delete the saved times. You can delete the saved times one by one or all at once. If you receive a call when using the stopwatch, the clock continues to run in the background. After ending the call, you can return to the stopwatch menu by taking the following action:
From the menu, select Extras > Stopwatch > Continue. 72 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 73 Friday, April 23, 2004 4:40 PM Prepaid services 14 Prepaid services With prepaid service, you buy wireless network services in advance. Your phone works the same way it did before with some additional features. Prepaid service may not be available from your wireless service provider. Contact the service provider for details. Note: When no more charging units or currency units are left, calls may only be possible to the official emergency number programmed into the phone.
MANAGE PREPAID SERVICE After you sign up with your service provider for prepaid service, you need to activate the Prepaid menu. This menu appears on your screen only if you have activated the service. ACTIVATE PREPAID To activate prepaid services, enter the following sequence:
* # 7 7 6 6 #
DEACTIVATE PREPAID To deactivate prepaid services, enter the following sequence:
* # 7 7 6 3 3 #
USE THE MENU 1 2 To use the Prepaid menu, select Menu > Prepaid. Scroll through the prepaid options.
SAVE YOUR ACCESS NUMBERS You can check your prepaid balance and add money when the balance runs low. To do that, you first need to save the correct access numbers in your phone. Contact your service provider for the access numbers. 1 From the menu, select Prepaid > Save access phone numbers > Replenish phone number. Enter the access number from your service provider, and press OK. Scroll to Balance phone number, enter the balance number from your service provider, and press OK. Saved appears to confirm each entry. 2 3 Nokia 6560 User Guide
73 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 74 Friday, April 23, 2004 4:40 PM
ADD MONEY TO YOUR ACCOUNT To add money, you must first have saved the correct access number in your phone.
(See the previous section for instructions.) 1 2 3 When you see Listen for prompt then press OK, press OK. From the menu, select Prepaid > Add money to account. At Card number, enter your prepaid card number, and press OK. When the addition to your account is complete, a voice message gives you the new balance. 4 When you see Wait for prompt, then press End, press the End key.
CHECK YOUR PREPAID BALANCE You can check the balance remaining in your prepaid account, free of charge. Contact your service provider for the toll-free access number used to check the balance. To check the balance, select Prepaid > Check account balance. The phone calls your service provider, and a voice message tells you your balance. 74 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 75 Friday, April 23, 2004 4:40 PM Network services 15 Network services Voice privacy Call waiting Call forwarding Send my caller identity You can subscribe to various network services whose availability depends on your service provider. Your phone supports the network services listed here. These services are not available from all providers or in all areas.
Feature codeWhen you subscribe to any of these services, your service provider gives you a feature code that activates each service. Deactivation codes are used to deactivate each service. After you store the appropriate code, your phone sends the code to the network to verify that you are using the correct feature code. Menus for network featuresMenus for the services described here appear on your phone only after you have stored the appropriate feature code. You can use these menus to activate and deactivate the network services. Voice privacyThe voice privacy feature does not require you to store a feature code before using it. More than one number?If your phone has more than one phone number assigned to it, stored feature codes apply only to the primary phone number.
SEARCH FOR A NETWORK Your phone may not show the options described here. For information, contact your service provider. From the menu, select Settings > Network services > System selection. You can choose from the following network options:
AutomaticYour phone automatically searches for available networks and chooses the appropriate one. Every time you turn on your phone, it resets to Automatic. ManualThe phone searches for networks and then shows a list of the ones that are available. If an available network is found, the word Available appears on the screen followed by the name of the network. To choose the network listed, press OK. New searchYour phone begins a new search for both private and residential systems. When it finds the best system available, the phone shows the system name. If the phone does not find another system, the question Perform an extended search? will appear. Press OK if you wish to continue searching. Note: If you have two phone numbers, you can use the Manual and New search options only with your primary phone number. Nokia 6560 User Guide
75 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 76 Friday, April 23, 2004 4:40 PM
ROAMING Using your phone outside its home area is roaming. Calls made or received while you are roaming may cost more than calls made in your home area. Check with your service provider for details.
When roaming, the phone may show the word ROAM on the screen, depending on how roaming works with your phone.
When not roaming, the phone shows the word HOME or the name of your service provider.
When you are roaming in some systems outside your home area, the system in which you are traveling (the host system) may not recognize your phone. You may not be able to place a call. 76 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 77 Friday, April 23, 2004 4:40 PM Text messages 16 Text messages You can use your phone to send and receive short text messages and e-mail if your service provider offers the message feature and if you subscribe to the service. Both services are network dependent features, so you must consult your service provider. Message recipients: The phone to which you send a text message must support text messages. It may not be possible to send an SMS text message to someones phone who has an account with a different service provider or a phone with a different protocol, but you can send and receive e-mail messages. Message length: The maximum length of a text message is 160 characters. Your phone has space for several text messages, depending on the length of each message. The maximum length of a text message depends on the capabilities of the network from which the message originated. When writing text messages, use predictive text for fast text entry. For details, see Predictive text on page 24.
FOLDERS Your phone has four folders for managing text messages. InboxThe inbox stores messages you receive. Messages remain in the inbox until you delete them or save them in the archive folder. Sent itemsThe sent items folder stores messages you have written, sent, edited and forwarded. The sent icon appears next to the message ArchiveThe archive folder stores messages you want to save. TemplatesThe templates folder stores message templates you edit and create. A template is like a form lettera message you can use many times. 1
WRITE AND SEND A MESSAGE From the menu, select Messages > Create message, or press and hold the left arrow on the Scroll key when at the start screen. Enter a message of up to 160 characters. A counter in the upper right corner of the screen shows the number of characters remaining. 2 Counter 3 When you have finished writing, select 4 Options > Send. Enter or retrieve the recipients phone number, and press OK. Nokia 6560 User Guide
77 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 78 Friday, April 23, 2004 4:40 PM If you need to exit while writing the message, press the End key at any time. Later, return to the write message screen to finish writing the message. If you turn off the phone without saving the message, the message will be lost. Note: When sending messages, your device may display the words Message Sent. This is an indication that the message has been sent by your device to the message center number programmed into your device. This is not an indication that the message has been received at the intended destination. For more details about messaging services, check with your service provider.
OPTIONS SendSends the message. SettingsAllows you to choose options for the message:
Callback no., Read receipt, and Urgent. (Depending on your service provider, Read receipt may not be available.) SaveSaves the message. Clear textClears the message screen. Exit editorTakes you back to the Write message screen. Insert contactLets you insert a name from the phone book. Insert numberLets you insert a number from the phone book. Use templateLets you insert a template. Insert pictureLets you attach a picture to a text message. Insert wordLets you insert a word that is not stored in the dictionary. Insert symbolLets you insert a symbol from the symbols list. Predictive textActivates or deactivates predictive text.
RESEND A MESSAGE You can resend a message from the sent items folder. 1 2 3 Select the message you want to resend. Select Options > Send. Enter or find the number to which you want to send the message, and press OK. 78 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 79 Friday, April 23, 2004 4:40 PM Text messages
RECEIVE A MESSAGE appears, along with one of the following messages:
When you receive a text message, the phone plays a message alert tone, and the text message icon Message receivedYou have an unread message or page. If you have more than one message or page, the appropriate number is listed before this message. New emergency messageAn emergency message or page was sent by someone using the service provider. Emergency messages are sent only in situations where life or property are in immediate danger. Emergency messages are listed first and override all other messages. UrgentThe message has a high priority. These messages are indicated by an exclamation point (!).
READ A MESSAGE 1 2 3 4 Press Show. If only one message has been received, the message is displayed. If more than one message has been received, this action takes you to the Inbox, where the new message is highlighted. Press Select to read the message. Press Options for a list of choices:
DeleteDeletes the current message. ReplyProvides a screen where you can write a reply. ChatAllows you to start a chat session. Use numberCalls the person who sent you the text message, if their phone number is included in the message. You can also press the Talk key while the message is open to dial the number. If more than one number is on the screen, the numbers appear in a list. Scroll to the phone number you want to call and press the Talk key. ForwardForwards the message to another person. That person must have the appropriate message service. EditAllows you to edit the message. SaveSaves the message in the archive folder. RenameAllows you to rename the message. Press Select when the option you want is highlighted. In your inbox, text messages are shown in the order in which they were received unless one is an emergency message. An emergency message overrides any other message and appears first. Nokia 6560 User Guide
79 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 80 Friday, April 23, 2004 4:40 PM
SAVE A MESSAGE When you send or receive a text message, you can save it in the archive folder. Messages can be saved from the inbox and the sent items folders. 1 2 Highlight the message you wish to save and press Select. Select Options > Save.
CUSTOMIZE SETTINGS From the menu, select Messages > Message settings > Sending profile or Font size. Sending profileSelect Sending profile to view and access the features you can change in order to customize the default style of the messages you send from your phone. Font sizeChoose between small and large fonts to customize your view of messages which you will read or edit.
MEMORY FULL When the message memory is full, one or more messages of the lowest priority are automatically deleted. If memory is still full after deleting messages, your phone shows No space: message waiting. The icon blinks. Clear the notification by pressing OK. You may need to manually delete messages from your folders to create space to receive new messages.
DELETE MESSAGES You can delete a message individually or delete the contents of an entire folder at once. You also have the option of erasing all read messages from all folders at the same time. Delete a message 1 While reading a message, press Options. 2 Scroll to Delete, and press Select. Your phone asks you to confirm that you want to delete the message. Press OK. 3 Delete messages from folders 1 From the menu, select Messages > Delete messages > All read, Inbox, Sent items, or Archive. 80 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 81 Friday, April 23, 2004 4:40 PM 2 Enter your security code and press OK. All messages in that folder will be deleted. If you choose All read, every message you have read will be deleted simultaneously from the inbox, sent items and archive folders. Text messages 1 2 3 4 2 3
REPLY TO A MESSAGE After reading a message, select Options > Reply > Via text message or Via e-mail. Edit your reply. Select Options > Send. The phone shows the return number. Edit the number if needed, and press OK.
FORWARD A MESSAGE 1 While reading a message in the Inbox, select Options > Forward > Via text message or Via e-mail. Select Options or edit the message and select Options > Send. Enter or retrieve the recipients phone number, and press OK. Note: When sending messages using SMS, your phone may display Message Sent. This is an indication that the message has been sent by your phone to the message center number programmed into your phone. This is not an indication that the message has been received at the intended destination. For more details about SMS services, check with your service provider.
E-MAIL MESSAGES You can use your phone to send and receive e-mail messages. The e-mail feature is not available from all service providers. Send a message 1 2 3 Select Menu > Messages > Create SMS e-mail. Enter the e-mail address, or press Find. If you press Find, scroll to the name you want and press OK. The address appears in the recipient address box. Press OK. Enter a subject and press OK. 4 5 Nokia 6560 User Guide
81 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 82 Friday, April 23, 2004 4:40 PM 6 When the message screen appears, enter your message. The maximum number of characters for message length varies; check with your service provider for details. 7 When you have finished the message, select Options > Send e-mail. A status message tells you the mail is being sent. Note: If your phone asks for an e-mail gateway number, contact your service provider. Reply to or forward a message 1 2 3 From the menu, select Menu > Messages > Inbox. Select the message you received and press Select. Select Options > Reply or Forward > Via e-mail. Choose a reply option and press Select. The E-mail address box appears with the senders e-mail address. Press OK. Enter a subject and press OK. 4 5 6 When the message screen appears, enter your message. The maximum number of characters for message length varies; check with your service provider for details. 7 When you have finished the message, select Options > Send e-mail. Note: A status message tells you the mail is being sent. If your phone asks for an e-mail gateway number, contact your service provider. Receive an e-mail message To receive e-mail messages, you need the special e-mail address provided by your wireless service provider. You can give this address to people who need to reach you by e-mail. They can then send e-mail messages to you from their computers or other e-mail devices. Messages sent to you by e-mail arrive as regular text messages. You can use all the options described earlier to save, reply to, or forward a message. See your service provider to get the e-mail address for your phone and for more information on using e-mail on the service.
TEMPLATES You can view and edit the preset messages, or templates, that are available for writing a message. Templates can be used when you write, reply to, or edit a message. 1 From the menu, select Messages > Templates. 82 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 83 Friday, April 23, 2004 4:40 PM Text messages 2 3 Select the template you want and press Select. Press Options to view the menu list:
SendSends the template as a text message. EditAllows you to edit the template before sending. RenameAllows you to rename the template. Use numberLets you use any number included in the message. Insert a template when writing a new message:
1 2 3 From the menu, select Messages > Create message > Options > Use template. Scroll to the template you want and press Select. Continue as you would when sending a new text message. If you wish to exit without using a template, either choose the clear screen option or press the End key. Note: You can also insert a template when replying to or editing a message.
PICTURE MESSAGES You can send picture messages with your phone. There are several images included in your phone and space for five additional pictures. Note: This function can be used only if it is supported by your network operator or service provider. Only phones that offer picture message features can receive and display picture messages. Send 1 From the menu, select Messages > Create message, write your text message, and select Options > Insert picture. Scroll to the picture you want to send, press View. Select Insert > Options. OR To choose a different picture, press Back, scroll to another picture, and press View. Select Preview to see the message and picture, or select Send. Enter the phone number to which you want to send the picture message and press OK. 2 3 4 5 Note: The phone number you choose must be able to receive picture messages. Nokia 6560 User Guide
83 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 84 Friday, April 23, 2004 4:40 PM Receive 1 When your phone displays Message received, press Show. 2 If the picture has a text message with it, scroll up or down to see the entire message. Options DeleteDeletes the picture you select. ReplyLets you reply as a text message or e-mail. ChatStarts a chat session with the person who sent the message. Use numberLets you use any phone number included in the message. ForwardSends the message to a friend. Edit textEdits the message if needed. SaveSaves the message to your archive. RenameCreates a new name for the message.
CHAT You can have a direct conversation with another person using the chat feature. Chat has distinct advantages over text messaging, such as faster send and reply, as well as direct, uninterrupted communication with your chat partner. To use chat you must subscribe to text messaging, which is network dependent. Contact your service provider for more information. Start a session 1 2 From the menu, select Messages > Chat. Enter the other partys phone number or retrieve it from the phone book and press OK. At My chat name, enter a name for the chat session (up to five characters) and press OK. 3 4 Write your chat message, select Options > Send. 5 6 The reply from the other party is shown above your original message. Press OK to clear the screen and reply to the message. To view the previous message or edit your chat name, select Options > Chat history or Chat name. Note: You can start a chat session when replying to a regular text message. After reading the message, select Options > Chat. 84 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 85 Friday, April 23, 2004 4:40 PM Text messages From the menu, select Messages > Chat > Options > Predictive text. Select the language you want. Use predictive text When you are in a chat session, you can use the phone dictionary to help speed up text entry. 1 2 Chat history You can view messages sent and received during the active chat session. From the message screen, select Options > Chat history. Change chat name 1 From the message screen, select Options > Chat name. 2 Enter a new nickname. End chat session From the message screen select Options > Quit. Warning: Once you exit your chat session, the messages are deleted automatically. There is no way to save the chat history. Nokia 6560 User Guide
85 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 86 Friday, April 23, 2004 4:40 PM 17 Special features This section describes several special features, including Java applications, transmission of business cards, downloading ringing tones and graphics from the Internet, and setting the alarm clock.
GALLERY You can save pictures and ringing tones to folders in the gallery, or create folders of your own and save them there. You can download images and tones via WAP. Note: This feature uses shared memory. Please see Shared Memory on page 3 for more information. Open the gallery From the menu, select Menu > Gallery. After a brief pause, the following submenus appear in the display:
View foldersExplore the folders in the gallery menu. See Folders in the following section for more info. Add folderAdd a folder of your own. Delete folderDelete a folder you have created. Rename folderRename a folder you have created. Gallery downloadsUse the graphic and tone downloads in your phone. The phone tries to connect to the Internet using your WAP browser and the currently active set of gallery downloads. If the connection fails, you may need to activate another set or change the current settings. See Set up for browsing on page 93. Folders 1 2 3 4 At the start screen, select Gallery > View Folders. Scroll to a folder, such as Graphics or Tones, and press Open. Scroll through the list of graphics or tones and press Options. Press select to activate one of the following options or enter its submenu:
OpenOpen the selected file. RenameRename the selected file. Set as wallpaper or Set as ring toneSet the graphic as wallpaper. In the Tones folder, this option is Set as ring tone; the tone is applied to the profile in use. 86 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 87 Friday, April 23, 2004 4:40 PM Special features DetailsView details of the file, such as the name, time and date the file was created. SortSort the files according to name, date, format, or size. Note: Copyright protections may prevent some images, ringing tones, and other content from being copied, modified, transferred or forwarded.
APPLICATIONS With the Applications menu you can manage the Java applications installed on your phone. Your phone includes some Java applications specially designed for this phone. Various service providers offer other applications using WAP services. Check with your service provider for more information. 1 2 From the menu, select Applications > Select application. Scroll to an application, and select Options > Open. If the selection is a single application it launches. Otherwise, a list of applications in the selected application set appears. To launch a single application within the set, scroll to the desired application, and select Options > Open. 3 Ask first (ask for net access) Allowed (allow net access) Options OpenStarts the application. DeleteDelete the application or application set from your phone. Web accessProvides options for restricting network access:
Not allowed (refuse net access) Service settingsChoose application or default settings. Update versionCheck if a new version of the application is available for download. DetailsShows additional information about the application. Downloads You can download new Java applications in different ways. From the menu, select Applications > App. downloads. 1 2 Scroll to the appropriate bookmark that contains the application you wish to download, and press Select to connect to the WAP page. See Internet service on page 93 for information on browsing WAP pages. Nokia 6560 User Guide
87 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 88 Friday, April 23, 2004 4:40 PM OR Select More bookmarks to access the list of any bookmarks saved in your Services menu. Note: This feature is network-dependent. Contact your wireless provider for more information. A cache is a memory location that is used to store data temporarily. If you have tried to access or have accessed confidential information requiring passwords, empty the cache after each use. The information or services you have accessed are stored in the cache. To empty the cache, select Services > Clear the cache. Your device may have some bookmarks loaded for sites not affiliated with Nokia. Nokia does not warrant or endorse these sites. If you choose to access them, you should take the same precautions for security or content as you would with any Internet site. The security icon does not indicate that the data transmission between the gateway and the content server (or place where the requested resource is stored) is secure. The service provider secures the data transmission between the gateway and the content server. Only install software from sources that offer adequate protection against harmful software. Game downloads 1 2 From the menu, select Games > Game downloads. Scroll to the appropriate bookmark that contains the application you wish to download and press Select to connect to the WAP page. See Internet service on page 93 for information on browsing WAP pages. OR Select More bookmarks to access the list of any bookmarks saved in your Services menu. Note: This feature is network-dependent. Contact your wireless provider for more information. If the connection fails, enter the Services menu and activate another set of service settings. See Options available during connection on page 94 for more information on browser settings. Memory From the menu, select Applications > Memory to view the amount of memory available. 88 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 89 Friday, April 23, 2004 4:40 PM Special features
RINGING TONES From the options menu, select Save tone. Enter a name for the tone, and press OK. Find a folder location for the tone, and press Select. You can download additional ringing tones to the gallery. Ringing tones can be ringing sounds or short tunes. For details about this network service, contact your wireless service provider, who can also point you to Web sites that offer these tones. Receive a tone If you have this service and your phone receives a downloaded ringing tone, your phone shows Ringing tone received. Select Options > Playback, Save tone, or Discard. It may not be possible to play the tone until the call is disconnected. Save a tone 1 2 3 Play tones 1 2 3 Discard tones You can discard a downloaded ringing tone before you save it by selecting Back > OK. OR To discard a downloaded tone from a folder, select Options > Delete > Yes. Locate a tone from one of your folders. Select Options > Open. To end the tone, press Stop.
ALARM CLOCK The alarm clock is based on the time settings in the phone clock. You can set the alarm clock to ring at any time, even if your phone is turned off.
The alarm clock sounds one quiet beep, and several quick, quiet beeps. These beeps continue and increase in volume until answered. If you have selected the Silent or Beep once ringing tone, the alarm clock quietly beeps once. The best profile to use with the alarm clock is Normal or Outdoor, unless these profiles have been modified from their original settings.
Nokia 6560 User Guide
89 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 90 Friday, April 23, 2004 4:40 PM Note: If the alarm time is reached while the device is switched off, the device switches itself on and starts sounding the alarm tone. If you press Stop, the device asks whether you want to activate the device for calls. Press No to switch off the device or Yes to make and receive calls. Do not press Yes when wireless phone use may cause interference or danger. Set the alarm 1 2 From the menu, select Alarm clock. Enter the time for the alarm and press OK. Use the hh:mm format (03:40, for example). The alarm clock replaces any existing numbers with the new time. Select am or pm > OK. The am and pm options appear only if you have chosen the am/pm format for the clock. Alarm on appears, and the alarm clock icon appears on the start screen. 3 Turn off the alarm When the alarm clock sounds:
Press Stop to turn it off.
Press Snooze to set the alarm to go off again in 10 minutes. Snoozing appears
on the screen. If you wish to cancel the snooze, press Stop. If you let the alarm ring for 1 minute or more without pressing a key, it stops sounding, waits 10 minutes, and then sounds again. This continues until you press Stop. Deactivate the alarm From the menu, select Alarm clock > Off. 90 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 91 Friday, April 23, 2004 4:40 PM Connectivity 18 Connectivity The Infrared port on your phone allows you to use your phone to connect to other IR-equipped phones. With this feature you can transfer business cards and calendar notes. Note: You can also use your phone to connect to any IR-equipped PC. For more information on connectivity, refer to the PC Connectivity Guide. The PC Connectivity Guide and all related software can be downloaded from the U.S. Mobile Phone products section of www.nokia.com/us. Check for periodic updates on connectivity options.
INFRARED You can set up the phone to receive data through its IR port. To use an IR connection, transmission and reception must be to or from an infrared compatible phone or device. You can send or receive data to or from a compatible phone or data device
(such as a computer) using the IR port of your phone. Important: Do not point the IR (infrared) beam at anyones eye or allow it to interfere with other IR devices. This device is a class 1 laser product. SEND AND RECEIVE DATA Ensure that the IR ports of the sending and receiving devices are pointing at each other and that there are no obstructions between the devices. The preferable distance between the two devices in an infrared connection is from 3 inches to 3 feet. From the start screen, select Menu >
Infrared to activate IR in your phone. Activate IR in the receiving device as well. If data transfer is not started within two minutes after the activation of the IR port, the connection is cancelled and has to be started again. CONNECTION INDICATOR
When 3-ft maximum distance is shown continuously, the IR connection is activated and your phone is ready to send or receive data using its IR port.
When blinks, your phone is trying to connect to the other device or a connection has been lost. Nokia 6560 User Guide
91 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 92 Friday, April 23, 2004 4:40 PM Data communication applications For information on using a data communication application, refer to the documentation provided with the application. Start using the data communications application on the computer. Note: Making or answering phone calls during a computer connection is not recommended as it might disrupt the operation. For better performance during data calls, place the phone on a stationary surface. Do not move the phone by holding it in your hand. 92 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 93 Friday, April 23, 2004 4:40 PM Internet service 19 Internet service Your phone has a built-in browser you may use to connect to selected services on the Internet. You may view weather reports, check news or flight times, view financial information, and much more. You may also save the address of an Internet site as a bookmark, much the same way you bookmark a Web page on your personal computer. Note: To use the browser, you may need to subscribe to additional services. Also, your service provider may need to configure your phone for browsing after you have subscribed. This is a network dependent feature. Contact your service provider for more information. Service providers role Because wireless Internet content is designed to be viewed from your phone, your wireless service provider now becomes your wireless Internet service provider as well. It is likely that your service provider has created a home page and set up your browser to go to this page when you connect to the Internet. Once at your service providers home page, you will find links to a number of other sites that offer wireless access. The information or services you have accessed are stored in the cache of your phone. A cache is a memory location that is used to store data temporarily. If you have tried to access or have accessed confidential information requiring passwords, empty the cache after each use. To empty the cache, select Services > Clear the cache. Your device may have some bookmarks loaded for sites not affiliated with Nokia. Nokia does not warrant or endorse these sites. If you choose to access them, you should take the same precautions for security or content as you would with any Internet site. Note: The security icon does not indicate that the data transmission between the gateway and the content server (or place where the requested resource is stored) is secure. The service provider secures the data transmission between the gateway and the content server. Only install software from sources that offer adequate protection against harmful software.
SET UP FOR BROWSING You should not need to do anything to set up your phone for browsing. Your service provider usually modifies the appropriate settings when you subscribe to the feature. Contact your service provider if you have problems using the browser. Nokia 6560 User Guide
93 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 94 Friday, April 23, 2004 4:40 PM
SIGN ON TO THE INTERNET Use the Services menu to connect to the Internet, if you have a wireless internet service provider. 1 From the menu, select Services > Home, or press and hold the 0 key. The word Home may be replaced with the name of the internet setting. If an error message appears, the phone may not be set up for browsing. Contact your service provider to make sure that your phone is configured properly. To sign off the internet, press the End key, or select Options > Quit. The connection may drop automatically after a period of inactivity. 2
BROWSING METHODS The browser uses that same key and text functionality as other phone features. Use the four-way Scroll key to scroll through options and links. To quickly activate a link, press the Talk key.
BROWSER OPTIONS (SERVICES MENU) The services menu gives you several options both before you browse and while you are browsing. Options will change depending on your activity. Options available without connection Some service providers may have customized the options on the services menu. Contact your service provider for more information about the options they provide:
HomeStarts the browser and takes you to your service providers home page. BookmarksShows a list of all saved bookmarks SettingsProvides options for changing connection settings, appearance settings, and security settings. Go to addressAccepts an address you enter. Clear the cacheEmpties the browsers temporary memory and frees up space. Options available during connection While you are connected to the Internet, the phone browser may provide some of the additional options described in the following list:
HomeTakes you back to the service providers home page. The word Home may be replaced with the name of the internet setting. BookmarksShows a list of all saved bookmarks. Open linkActivates the link you selected. BackThe previous screen appears. 94 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 95 Friday, April 23, 2004 4:40 PM Internet service Add bookmarkAdds a web site address for quick reference. Go to addressAccepts an address you enter. Appearance settingsAllows you to choose page appearance. Cookie settingsGives you the option to allow or decline cookies. ReloadRefreshes the page. Clear the cacheEmpties the browsers temporary memory. Security infoShows security items such as owner, server, issuer, etc. QuitExits the current session and returns to the start screen. Developers of wireless Internet sites may add options to the browser menu that are specific to their Web sites. These options are often links to other areas within the site. As in any other menu, scroll to the link you want and press Select.
EDIT A DATA ENTRY FIELD When you need to enter information, follow these steps:
1 2 Scroll to highlight the data entry field, select Options > Edit. Use the keypad to enter the text in the data entry field
(for example, Miami), and select Options > OK. Scroll to the link you want (for example, Get forecast?), and select Options > Open link. 3
BOOKMARKS You can save addresses for your favorite sites as bookmarks. A bookmark helps you find a site again, just as a slip of paper in a book helps you find a page.
If a wireless Internet site has a title, it will appear in the bookmark list
(for example, Yahoo! News, ebay on WAP, Mapquest). If the site has no title, the site address will appear in the list of bookmarks
(for example, http://www.yahoo.com/news.wml).
Navigate to the site you want to bookmark and press Options. Select Add Bookmark. SAVE AN ADDRESS 1 2 ENTER A BOOKMARK MANUALLY 1 2 From the menu, select Services > Bookmarks > Options > New bookmark. Enter the site address (for example, my.yahoo.com) and press OK. You do not need to enter http://. They are added automatically. Enter a name for the new bookmark and press OK. 3 Nokia 6560 User Guide
95 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 96 Friday, April 23, 2004 4:40 PM RETURN TO A BOOKMARKED SITE 1 2 From the menu, select Services > Bookmarks. Scroll to the bookmark you want, and select Options > Go to. If you are not currently browsing, the phone will connect to the Internet. Note: Only install software from sources that offer adequate protection against viruses and other harmful software.
EXAMPLES OF WIRELESS INTERNET SITES The following illustrations show elements you may find on a wireless Internet site. These are examples only. 1) 2) 3) 4) 5) 7) 1) Header line. Shows the current Internet site. 2) Active link. Appears as a highlighted 3) word. Inactive link. Appears as an underlined word. 6) Scroll up or down through the list of links. 4) Selection list. Brackets [ ] appear when you have the option to enter information. 5) Options. Select Options to go to the site menu and/or browser page. 6) Back. Select Back to return to the previous page. 7) Data entry field. Brackets [ ] that enclose dots indicate when you need to enter information. In this example, you can enter your zip code to receive the local weather forecast. 96 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 97 Friday, April 23, 2004 4:40 PM Games 20 Games Select Games > Select game. Scroll to the desired game, and select Options > Open. Not only can you use your phone for communication, but also for some serious fun. You can choose from any of the four games listed below. Backgammon Triple Pop Bounce Chess Puzzle Start a new game 1 2 Use the option Instructions to learn how to play the game. With the option Level you can choose the difficulty level of the game. Settings Go to game settings by selecting Games > Settings. Here you can customize a game by activating or deactivating game sounds, game lights and shakes. Downloads The Nokia 6560 phone has the capability to download Java games from the Internet. This is a network dependent feature. Please check with your service provider for details. Please visit Nokia games services on the Internet for more hints and tips:
http://www.nokia.com/us. Memory From the menus, select Games > Memory to view the amount of memory available. Nokia 6560 User Guide
97 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 98 Friday, April 23, 2004 4:40 PM 21 Enhancements Check the model number of any charger before use with this device. This device is intended for use when supplied with power from ACP-7, ACP-8, and ACP-12. Warning: Use only batteries, chargers and enhancements approved by Nokia for use with this particular model. The use of any other types may invalidate any approval or warranty, and may be dangerous. For availability of approved enhancements, please check with your dealer. Your device and its enhancements may contain small parts. Keep them out of reach of small children. A few practical rules about accessories and enhancements:
When you disconnect the power cord of any accessory or enhancement, grasp Keep all accessories and enhancements out of the reach of small children.
and pull the plug, not the cord. Check regularly that enhancements installed in a vehicle are mounted and are operating properly. Installation of any complex car enhancements must be made by qualified personnel only. Power
Audio
Standard 780-mAh Li-Ion Battery (BLD-3) Standard Travel Charger (ACP-7) Rapid Travel Charger (ACP-8) Travel Charger (ACP-12) Battery Charging Stand (DDC-1) Earbud Headset (HS-5) Boom Headset (HDB-4) Retractable Headset (HS-10) FM Radio Headset (HS-2R) Accessibility Loopset (LPS-4) Phone Adapter (HDA-10) Car Kit (CARK-143) Car
Mobile Holder (MBC-15S)
Mobile Charger (LCH-12)
Headrest Handsfree (BHF-1) Covers and carrying
Xpress-on Color Covers Carry Cases 98 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 99 Friday, April 23, 2004 4:40 PM Reference Information 22 Reference Information
BATTERY INFORMATION Charging and discharging Your device is powered by a rechargeable battery. The full performance of a new battery is achieved only after two or three complete charge and discharge cycles. The battery can be charged and discharged hundreds of times but it will eventually wear out. When the talk and standby times are noticeably shorter than normal, buy a new battery. Use only Nokia approved batteries, and recharge your battery only with Nokia approved chargers designated for this device. Unplug the charger from the electrical plug and the device when not in use. Do not leave the battery connected to a charger. Overcharging may shorten its lifetime. If left unused, a fully charged battery will lose its charge over time. Temperature extremes can affect the ability of your battery to charge. Use the battery only for its intended purpose. Never use any charger or battery that is damaged. Do not short-circuit the battery. Accidental short-circuiting can occur when a metallic object such as a coin, clip, or pen causes direct connection of the positive
(+) and negative (-) terminals of the battery. (These look like metal strips on the battery.) This might happen, for example, when you carry a spare battery in your pocket or purse. Short-circuiting the terminals may damage the battery or the connecting object. Leaving the battery in hot or cold places, such as in a closed car in summer or winter conditions, will reduce the capacity and lifetime of the battery. Always try to keep the battery between 59F and 77F (15C and 25C). A device with a hot or cold battery may not work temporarily, even when the battery is fully charged. Battery performance is particularly limited in temperatures well below freezing. Do not dispose of batteries in a fire! Dispose of batteries according to local regulations. Please recycle when possible. Do not dispose as household waste. Nokia 6560 User Guide
99 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 100 Friday, April 23, 2004 4:40 PM
CARE AND MAINTENANCE Your device is a product of superior design and craftsmanship and should be treated with care. The suggestions below will help you protect your warranty coverage and enjoy your device for many years.
Keep the device dry. Precipitation, humidity, and all types of liquids or moisture can contain minerals that will corrode electronic circuits. If your device does get wet, remove the battery and allow the device to dry completely before replacing it. Do not use or store the device in dusty, dirty areas. Its moving parts and electronic components can be damaged. Do not store the device in hot areas. High temperatures can shorten the life of electronic devices, damage batteries, and warp or melt certain plastics. Do not store the device in cold areas. When the device returns to its normal temperature, moisture can form inside the device and damage electronic circuit boards. Do not attempt to open the device other than as instructed in this guide. Do not drop, knock, or shake the device. Rough handling can break internal circuit boards and fine mechanics. Do not use harsh chemicals, cleaning solvents, or strong detergents to clean the device. Do not paint the device. Paint can clog the moving parts and prevent proper operation. Use only the supplied or an approved replacement antenna. Unauthorized antennas, modifications, or attachments could damage the device and may violate regulations governing radio devices.
All of the above suggestions apply equally to your device, battery, charger, or any enhancement. If any device is not working properly, take it to the nearest authorized service facility for service. 100 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 101 Friday, April 23, 2004 4:40 PM
ADDITIONAL SAFETY INFORMATION Reference Information Operating environment Remember to follow any special regulations in force in any area and always switch off your device when its use is prohibited or when it may cause interference or danger. Use the device only in its normal operating positions. To maintain compliance with radio frequency exposure guidelines only use accessories approved by Nokia for use with this device. When the device is on and being worn on the body, always use an approved carrying case. Medical devices Operation of any radio transmitting equipment, including wireless phones, may interfere with the functionality of inadequately protected medical devices. Consult a physician or the manufacturer of the medical device to determine if they are adequately shielded from external RF energy or if you have any questions. Switch off your phone in health care facilities when any regulations posted in these areas instruct you to do so. Hospitals or health care facilities may be using equipment that could be sensitive to external RF energy. PACEMAKERS Pacemaker manufacturers recommend that a minimum separation of 6 in.
(15.3 cm) be maintained between a wireless phone and a pacemaker to avoid potential interference with the pacemaker. These recommendations are consistent with the independent research by and recommendations of Wireless Technology Research. To minimize the potential for interference, persons with pacemakers should
Always keep the device more than 6 in. (15.3 cm) from their pacemaker when the device is switched on Not carry the device in a breast pocket Hold the device to the ear opposite the pacemaker
If you have any reason to suspect that interference is taking place, switch off your device immediately. HEARING AID Some digital wireless devices may interfere with some hearing aids. If interference occurs, consult your service provider. Nokia 6560 User Guide
101 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 102 Friday, April 23, 2004 4:40 PM Vehicles RF signals may affect improperly installed or inadequately shielded electronic systems in motor vehicles such as electronic fuel injection systems, electronic antiskid (antilock) braking systems, electronic speed control systems, air bag systems. For more information, check with the manufacturer or its representative of your vehicle or any equipment that has been added. Only qualified personnel should service the device, or install the device in a vehicle. Faulty installation or service may be dangerous and may invalidate any warranty that may apply to the device. Check regularly that all wireless device equipment in your vehicle is mounted and operating properly. Do not store or carry flammable liquids, gases, or explosive materials in the same compartment as the device, its parts, or enhancements. For vehicles equipped with an air bag, remember that an air bags inflate with great force. Do not place objects, including installed or portable wireless equipment in the area over the air bag or in the air bag deployment area. If in-vehicle wireless equipment is improperly installed and the air bag inflates, serious injury could result. Potentially explosive environments Switch off your device when in any area with a potentially explosive atmosphere and obey all signs and instructions. Potentially explosive atmospheres include areas where you would normally be advised to turn off your vehicle engine. Sparks in such areas could cause an explosion or fire resulting in bodily injury or even death. Switch off the device at refuelling points such as near gas pumps at service stations. Observe restrictions on the use of radio equipment in fuel depots, storage, and distribution areas, chemical plants or where blasting operations are in progress. Areas with a potentially explosive atmosphere are often but not always clearly marked. They include below deck on boats, chemical transfer or storage facilities, vehicles using liquefied petroleum gas (such as propane or butane), and areas where the air contains chemicals or particles such as grain, dust or metal powders. FCC regulations prohibit using your wireless device while in the air. The use of wireless telephones in an aircraft may be dangerous to the operation of the aircraft, disrupt the wireless telephone network, and may be illegal. Failure to observe these instructions may lead to suspension or denial of telephone services to the offender, legal action, or both. 102 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 103 Friday, April 23, 2004 4:40 PM Reference Information EMERGENCY CALLS Important: Wireless phones, including this phone, operate using radio signals, wireless networks, landline networks, and user-programmed functions. Because of this, connections in all conditions cannot be guaranteed. You should never rely solely on any wireless phone for essential communications like medical emergencies. To make an emergency call:
1 2 3 If the phone is not on, switch it on. Check for adequate signal strength. Press End key as many times as needed to clear the display and ready the phone for calls. Key in the official emergency number for your present location. Emergency numbers vary by location. Press the Talk key. 4 If certain features are in use, you may first need to turn those features off before you can make an emergency call. Consult this guide or your service provider. When making an emergency call, give all the necessary information as accurately as possible. Your wireless phone may be the only means of communication at the scene of an accident. Do not end the call until given permission to do so. Nokia 6560 User Guide
103 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 104 Friday, April 23, 2004 4:40 PM CERTIFICATION INFORMATION (SAR) THIS MODEL PHONE MEETS THE GOVERNMENTS REQUIREMENTS FOR EXPOSURE TO RADIO WAVES. Your wireless phone is a radio transmitter and receiver. It is designed and manufactured not to exceed the emission limits for exposure to radio frequency (RF) energy set by the Federal Communications Commission of the U.S. Government. These limits are part of comprehensive guidelines and establish permitted levels of RF energy for the general population. The guidelines are based on standards that were developed by independent scientific organizations through periodic and thorough evaluation of scientific studies. The standards include a substantial safety margin designed to assure the safety of all persons, regardless of age and health. The exposure standard for wireless mobile phones employs a unit of measurement known as the Specific Absorption Rate, or SAR. The SAR limit set by the FCC is 1.6W/kg.* Tests for SAR are conducted using standard operating positions accepted by the FCC with the phone transmitting at its highest certified power level in all tested frequency bands. Although the SAR is determined at the highest certified power level, the actual SAR level of the phone while operating can be well below the maximum value. This is because the phone is designed to operate at multiple power levels so as to use only the power required to reach the network. In general, the closer you are to a wireless base station antenna, the lower the power output. Before a phone model is available for sale to the public, it must be tested and certified to the FCC that it does not exceed the limit established by the government-adopted requirement for safe exposure. The tests are performed in positions and locations (for example, at the ear and worn on the body) as required by the FCC for each model. The highest SAR value for this model phone as reported to the FCC when tested for use at the ear is 1.25 W/kg, and when worn on the body, as described in this user guide, is 1.19 W/kg. (Body-worn measurements differ among phone models, depending upon available enhancements and FCC requirements). While there may be differences between the SAR levels of various phones and at various positions, they all meet the government requirement. The FCC has granted an Equipment Authorization for this model phone with all reported SAR levels evaluated as in compliance with the FCC RF exposure guidelines. SAR information on this model phone is on file with the FCC and can be found under the Display Grant section of http://www.fcc.gov/oet/fccid after searching on FCC ID GMLRH-25. For body worn operation, this phone has been tested and meets the FCC RF exposure guidelines for use with a carry case, belt clip, or holder that contains no metal and that positions the handset a minimum of 5/8-inch (1.5 cm) from the body. Use of other carry cases, belt clips, or holders may not ensure compliance with FCC RF exposure guidelines. If you do not use a body-worn accessory and are not holding the phone at the ear, position the handset a minimum of 5/8-inch (1.5 cm) from your body when the phone is switched on. 104 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 105 Friday, April 23, 2004 4:40 PM Reference Information
*In the United States and Canada, the SAR limit for mobile phones used by the public is 1.6 watts/kilogram (W/kg) averaged over one gram of tissue. The standard incorporates a substantial margin of safety to give additional protection for the public and to account for any variations in measurements. SAR values may vary depending on national reporting requirements and the network band. For SAR information in other regions please look under product information at www.nokia.com. Nokia 6560 User Guide
105 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 106 Friday, April 23, 2004 4:40 PM
BATTERY This section provides information about the phone battery. Be aware that the information in this section is subject to change. Consult your service provider for more information. Note: The charging times listed in the next section are approximate. Charging times The following table shows battery charging times for the specified charger:
Battery Option ACP-7 Charger ACP-12 Charger BLD-3 Li-Ion 780 mAh 2 h, 45 min 1 h, 35 min Standby and talk times The times shown in the following table are estimates only and represent a range for either standby or talk times (not a combination of both). Warning: Battery talk and standby times are estimates only and depend on signal strength, network conditions, features used, battery age and condition (including the effect of charging habits), temperatures to which battery is exposed, use in digital mode, and many other factors. Please note that the amount of time a phone is used for calls will affect its standby time. Likewise, the amount of time that the phone is turned on and in standby mode will affect its talk time. The following table shows talk-time and standby times in both digital and analog networks:
Battery option Digital talk time Analog talk-time BLD-3 Li-Ion 780 mAh up to 4 hours up to 115 min Standby time Digital up to 11 days Analog up to 47 hours 106 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 107 Friday, April 23, 2004 4:40 PM
TECHNICAL INFORMATION Reference Information Weight Size Frequency range 88.36 g (3.11 oz) with BLD-3 780-mAh Li-Ion Battery 105.8 x 44 x 19.1 mm (hxwxd) Lowband 824.04848.97 MHz (TX) 869.04893.97 MHz (RX) Highband 1850.041909.92 MHz (TX) 1930.081989.96 MHz (RX) Transmitter output power Up to 600 mW Battery voltage (Nominal) 3.7 V Operating temperature
-4F to +104F (-20C to +40C) Number of channels 832 lowband 1997 highband Phone numbers 3 Memory locations Up to 500 contacts, with multiple phone numbers and text entries per contact. Nokia 6560 User Guide
107 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 108 Friday, April 23, 2004 4:40 PM 23 Nokia One-Year Limited Warranty Nokia Inc. (Nokia) warrants that this cellular phone (Product) is free from defects in material and workmanship that result in Product failure during normal usage, according to the following terms and conditions:
1 The limited warranty for the Product extends for ONE (1) year beginning on the date of the purchase of the Product. This one year period is extended by each whole day that the Product is out of your possession for repair under this warranty. The limited warranty extends only to the original purchaser (Consumer) of the Product and is not assignable or transferable to any subsequent purchaser/
end-user. The limited warranty extends only to Consumers who purchase the Product in the United States of America. During the limited warranty period, Nokia will repair, or replace, at Nokias sole option, any defective parts, or any parts that will not properly operate for their intended use with new or refurbished replacement items if such repair or replacement is needed because of product malfunction or failure during normal usage. No charge will be made to the Consumer for any such parts. Nokia will also pay for the labor charges incurred by Nokia in repairing or replacing the defective parts. The limited warranty does not cover defects in appearance, cosmetic, decorative or structural items, including framing, and any non-operative parts. Nokias limit of liability under the limited warranty shall be the actual cash value of the Product at the time the Consumer returns the Product for repair, determined by the price paid by the Consumer for the Product less a reasonable amount for usage. Nokia shall not be liable for any other losses or damages. These remedies are the Consumers exclusive remedies for breach of warranty. Upon request from Nokia, the Consumer must prove the date of the original purchase of the Product by a dated bill of sale or dated itemized receipt. The Consumer shall bear the cost of shipping the Product to Nokia in Melbourne, Florida. Nokia shall bear the cost of shipping the Product back to the Consumer after the completion of service under this limited warranty. 2 3 4 5 6 108 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 109 Friday, April 23, 2004 4:40 PM Nokia One-Year Limited Warranty 7 8 The Consumer shall have no coverage or benefits under this limited warranty if any of the following conditions are applicable:
a) The Product has been subjected to abnormal use, abnormal conditions, improper storage, exposure to moisture or dampness, unauthorized modifications, unauthorized connections, unauthorized repair, misuse, neglect, abuse, accident, alteration, improper installation, or other acts which are not the fault of Nokia, including damage caused by shipping. The Product has been damaged from external causes such as collision with an object, or from fire, flooding, sand, dirt, windstorm, lightning, earthquake or damage from exposure to weather conditions, an Act of God, or battery leakage, theft, blown fuse, or improper use of any electrical source, damage caused by computer or internet viruses, bugs, worms, Trojan Horses, cancelbots or damage caused by the connection to other products not recommended for interconnection by Nokia. b) d) c) Nokia was not advised in writing by the Consumer of the alleged defect or malfunction of the Product within fourteen (14) days after the expiration of the applicable limited warranty period. The Product serial number plate or the accessory data code has been removed, defaced or altered. The defect or damage was caused by the defective function of the cellular system or by inadequate signal reception by the external antenna, or viruses or other software problems introduced into the Product. e) Nokia does not warrant uninterrupted or error-free operation of the Product. If a problem develops during the limited warranty period, the Consumer shall take the following step-by-step procedure:
a) The Consumer shall return the Product to the place of purchase for repair or replacement processing. If a is not convenient because of distance (more than 50 miles) or for other good cause, the Consumer shall ship the Product prepaid and insured to:
Nokia Inc., Attn: Repair Department 795 West Nasa Blvd. Melbourne, FL 32901 The Consumer shall include a return address, daytime phone number and/
or fax number, complete description of the problem, proof of purchase and service agreement (if applicable). Expenses related to removing the Product from an installation are not covered under this limited warranty. The Consumer will be billed for any parts or labor charges not covered by this limited warranty. The Consumer will be responsible for any expenses related to reinstallation of the Product. b) c) d) Nokia 6560 User Guide
109 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 110 Friday, April 23, 2004 4:40 PM e) Nokia will repair the Product under the limited warranty within 30 days after receipt of the Product. If Nokia cannot perform repairs covered under this limited warranty within 30 days, or after a reasonable number of attempts to repair the same defect, Nokia at its option, will provide a replacement Product or refund the purchase price of the Product less a reasonable amount for usage. In some states the Consumer may have the right to a loaner if the repair of the Product takes more than ten (10) days. Please contact the Customer Service Center at Nokia at the telephone number listed at the end of this warranty if you need a loaner and the repair of the Product has taken or is estimated to take more than ten (10) days. If the Product is returned during the limited warranty period, but the problem with the Product is not covered under the terms and conditions of this limited warranty, the Consumer will be notified and given an estimate of the charges the Consumer must pay to have the Product repaired, with all shipping charges billed to the Consumer. If the estimate is refused, the Product will be returned freight collect. If the Product is returned after the expiration of the limited warranty period, Nokias normal service policies shall apply and the Consumer will be responsible for all shipping charges. f) 9 You (the Consumer) understand that the product may consist of refurbished equipment that contains used components, some of which have been reprocessed. The used components comply with Product performance and reliability specifications. 10 ANY IMPLIED WARRANTY OF MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE OR USE, SHALL BE LIMITED TO THE DURATION OF THE FOREGOING LIMITED WRITTEN WARRANTY. OTHERWISE, THE FOREGOING LIMITED WARRANTY IS THE CONSUMERS SOLE AND EXCLUSIVE REMEDY AND IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESS OR IMPLIED. NOKIA SHALL NOT BE LIABLE FOR SPECIAL, INCIDENTAL, PUNITIVE OR CONSEQUENTIAL DAMAGES, INCLUDING BUT NOT LIMITED TO LOSS OF ANTICIPATED BENEFITS OR PROFITS, LOSS OF SAVINGS OR REVENUE, LOSS OF DATA, PUNITIVE DAMAGES, LOSS OF USE OF THE PRODUCT OR ANY ASSOCIATED EQUIPMENT, COST OF CAPITAL, COST OF ANY SUBSTITUTE EQUIPMENT OR FACILITIES, DOWNTIME, THE CLAIMS OF ANY THIRD PARTIES, INCLUDING CUSTOMERS, AND INJURY TO PROPERTY, RESULTING FROM THE PURCHASE OR USE OF THE PRODUCT OR ARISING FROM BREACH OF THE WARRANTY, BREACH OF CONTRACT, NEGLIGENCE, STRICT TORT, OR ANY OTHER LEGAL OR EQUITABLE THEORY, EVEN IF NOKIA KNEW OF THE LIKELIHOOD OF SUCH DAMAGES. NOKIA SHALL NOT BE LIABLE FOR DELAY IN RENDERING SERVICE UNDER THE LIMITED WARRANTY, OR LOSS OF USE DURING THE PERIOD THAT THE PRODUCT IS BEING REPAIRED. 110 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 111 Friday, April 23, 2004 4:40 PM Nokia One-Year Limited Warranty 11 Some states do not allow limitation of how long an implied warranty lasts, so the one year warranty limitation may not apply to you (the Consumer). Some states do not allow the exclusion or limitation of incidental and consequential damages, so certain of the above limitations or exclusions may not apply to you
(the Consumer). This limited warranty gives the Consumer specific legal rights and the Consumer may also have other rights which vary from state to state. 12 Nokia neither assumes nor authorizes any authorized service center or any other person or entity to assume for it any other obligation or liability beyond that which is expressly provided for in this limited warranty including the provider or seller of any extended warranty or service agreement. 13 This is the entire warranty between Nokia and the Consumer, and supersedes all prior and contemporaneous agreements or understandings, oral or written, relating to the Product, and no representation, promise or condition not contained herein shall modify these terms. 14 This limited warranty allocates the risk of failure of the Product between the Consumer and Nokia. The allocation is recognized by the Consumer and is reflected in the purchase price. 15 Any action or lawsuit for breach of warranty must be commenced within eighteen (18) months following purchase of the Product. 16 Questions concerning this limited warranty may be directed to:
Nokia Inc. Attn: Customer Service 7725 Woodland Center Blvd., Ste. 150 Tampa, FL 33614 Telephone: 1-888-NOKIA-2U (1-888-665-4228) Facsimile: (813) 287-6612 TTY/TDD Users Only: 1-800-24-NOKIA (1-800-246-6542) 17 The limited warranty period for Nokia supplied attachments and accessories is specifically defined within their own warranty cards and packaging. Nokia 6560 User Guide
111 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 112 Friday, April 23, 2004 4:40 PM NOTES 112 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 113 Friday, April 23, 2004 4:40 PM Appendix A Appendix A Message from the CTIA
(Cellular Telecommunications
& Internet Association) to all users of mobile phones.
&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ$OO5LJKWV
5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
Nokia 6560 User Guide
113 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 114 Friday, April 23, 2004 4:40 PM 6DIHW\LVWKHPRVWLPSRUWDQWFDOO\RXZLOOHYHUPDNH
A Guide to Safe and Responsible Wireless Phone Use 7HQVRIPLOOLRQVRISHRSOHLQWKH86WRGD\WDNHDGYDQWDJHRIWKHXQLTXH
FRPELQDWLRQRIFRQYHQLHQFHVDIHW\DQGYDOXHGHOLYHUHGE\WKHZLUHOHVVWHOHSKRQH
4XLWHVLPSO\WKHZLUHOHVVSKRQHJLYHVSHRSOHWKHSRZHUIXODELOLW\WRFRPPXQLFDWH
E\YRLFHDOPRVWDQ\ZKHUHDQ\WLPHZLWKWKHERVVZLWKDFOLHQWZLWKWKHNLGV
ZLWKHPHUJHQF\SHUVRQQHORUHYHQZLWKWKHSROLFH(DFK\HDU$PHULFDQVPDNH
ELOOLRQVRIFDOOVIURPWKHLUZLUHOHVVSKRQHVDQGWKHQXPEHUVDUHUDSLGO\JURZLQJ
%XWDQLPSRUWDQWUHVSRQVLELOLW\DFFRPSDQLHVWKRVHEHQHILWVRQHWKDWHYHU\ZLUHOHVV
SKRQHXVHUPXVWXSKROG:KHQGULYLQJDFDUGULYLQJLV\RXUILUVWUHVSRQVLELOLW\
$ZLUHOHVVSKRQHFDQEHDQLQYDOXDEOHWRROEXWJRRGMXGJPHQWPXVWEHH[HUFLVHG
DWDOOWLPHVZKLOHGULYLQJDPRWRUYHKLFOHZKHWKHURQWKHSKRQHRUQRW
7KHEDVLFOHVVRQVDUHRQHVZHDOOOHDUQHGDVWHHQDJHUV'ULYLQJUHTXLUHVDOHUWQHVV
FDXWLRQDQGFRXUWHV\,WUHTXLUHVDKHDY\GRVHRIEDVLFFRPPRQVHQVHNHHS\RXU
KHDGXSNHHS\RXUH\HVRQWKHURDGFKHFN\RXUPLUURUVIUHTXHQWO\DQGZDWFKRXW
IRURWKHUGULYHUV,WUHTXLUHVREH\LQJDOOWUDIILFVLJQVDQGVLJQDOVDQGVWD\LQJZLWKLQ
WKHVSHHGOLPLW,WPHDQVXVLQJVHDWEHOWVDQGUHTXLULQJRWKHUSDVVHQJHUVWRGRWKH
VDPH
%XWZLWKZLUHOHVVSKRQHXVHGULYLQJVDIHO\PHDQVDOLWWOHPRUH7KLVEURFKXUHLVD
FDOOWRZLUHOHVVSKRQHXVHUVHYHU\ZKHUHWRPDNHVDIHW\WKHLUILUVWSULRULW\ZKHQ
EHKLQGWKHZKHHORIDFDU:LUHOHVVWHOHFRPPXQLFDWLRQVLVNHHSLQJXVLQWRXFK
VLPSOLI\LQJRXUOLYHVSURWHFWLQJXVLQHPHUJHQFLHVDQGSURYLGLQJRSSRUWXQLWLHVWR
KHOSRWKHUVLQQHHG
:KHQLWFRPHVWRWKHXVHRIZLUHOHVVSKRQHVVDIHW\LV\RXUPRVWLPSRUWDQWFDOO
Wireless Phone "Safety Tips"
%HORZDUHVDIHW\WLSVWRIROORZZKLOHGULYLQJDQGXVLQJDZLUHOHVVSKRQHZKLFK
VKRXOGEHHDV\WRUHPHPEHU
*HWWRNQRZ\RXUZLUHOHVVSKRQHDQGLWVIHDWXUHVVXFKDVVSHHGGLDODQGUHGLDO
&DUHIXOO\UHDG\RXULQVWUXFWLRQPDQXDODQGOHDUQWRWDNHDGYDQWDJHRIYDOXDEOH
IHDWXUHVPRVWSKRQHVRIIHULQFOXGLQJDXWRPDWLFUHGLDODQGPHPRU\$OVRZRUN
WRPHPRUL]HWKHSKRQHNH\SDGVR\RXFDQXVHWKHVSHHGGLDOIXQFWLRQZLWKRXW
WDNLQJ\RXUDWWHQWLRQRIIWKHURDG
:KHQDYDLODEOHXVHDKDQGVIUHHGHYLFH$QXPEHURIKDQGVIUHHZLUHOHVVSKRQH
HQKDQFHPHQWVDUHUHDGLO\DYDLODEOHWRGD\:KHWKHU\RXFKRRVHDQLQVWDOOHG
PRXQWHGGHYLFHIRU\RXUZLUHOHVVSKRQHRUDVSHDNHUSKRQHDFFHVVRU\WDNH
DGYDQWDJHRIWKHVHGHYLFHVLIDYDLODEOHWR\RX
3RVLWLRQ\RXUZLUHOHVVSKRQHZLWKLQHDV\UHDFK0DNHVXUH\RXSODFH\RXU
ZLUHOHVVSKRQHZLWKLQHDV\UHDFKDQGZKHUH\RXFDQJUDELWZLWKRXWUHPRYLQJ
\RXUH\HVIURPWKHURDG,I\RXJHWDQLQFRPLQJFDOODWDQLQFRQYHQLHQWWLPHLI
SRVVLEOHOHW\RXUYRLFHPDLODQVZHULWIRU\RX
114 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 115 Friday, April 23, 2004 4:40 PM Appendix A
6XVSHQGFRQYHUVDWLRQVGXULQJKD]DUGRXVGULYLQJFRQGLWLRQVRUVLWXDWLRQV/HW
WKHSHUVRQ\RXDUHVSHDNLQJZLWKNQRZ\RXDUHGULYLQJLIQHFHVVDU\VXVSHQGWKH
FDOOLQKHDY\WUDIILFRUKD]DUGRXVZHDWKHUFRQGLWLRQV5DLQVOHHWVQRZDQGLFH
FDQEHKD]DUGRXVEXWVRLVKHDY\WUDIILF$VDGULYHU\RXUILUVWUHVSRQVLELOLW\LV
WRSD\DWWHQWLRQWRWKHURDG
'RQRWWDNHQRWHVRUORRNXSSKRQHQXPEHUVZKLOHGULYLQJ,I\RXDUHUHDGLQJDQ
DGGUHVVERRNRUEXVLQHVVFDUGRUZULWLQJDWRGROLVWZKLOHGULYLQJDFDU\RX
DUHQRWZDWFKLQJZKHUH\RXDUHJRLQJ,WVFRPPRQVHQVH'RQWJHWFDXJKWLQD
GDQJHURXVVLWXDWLRQEHFDXVH\RXDUHUHDGLQJRUZULWLQJDQGQRWSD\LQJDWWHQWLRQ
WRWKHURDGRUQHDUE\YHKLFOHV
'LDOVHQVLEO\DQGDVVHVVWKHWUDIILFLISRVVLEOHSODFHFDOOVZKHQ\RXDUHQRW
PRYLQJRUEHIRUHSXOOLQJLQWRWUDIILF7U\WRSODQ\RXUFDOOVEHIRUH\RXEHJLQ\RXU
WULSRUDWWHPSWWRFRLQFLGH\RXUFDOOVZLWKWLPHV\RXPD\EHVWRSSHGDWDVWRS
VLJQUHGOLJKWRURWKHUZLVHVWDWLRQDU\%XWLI\RXQHHGWRGLDOZKLOHGULYLQJ
IROORZWKLVVLPSOHWLSGLDORQO\DIHZQXPEHUVFKHFNWKHURDGDQG\RXUPLUURUV
WKHQFRQWLQXH
'RQRWHQJDJHLQVWUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVWKDWPD\EHGLVWUDFWLQJ
6WUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVDQGGULYLQJGRQRWPL[WKH\DUH
GLVWUDFWLQJDQGHYHQGDQJHURXVZKHQ\RXDUHEHKLQGWKHZKHHORIDFDU0DNH
SHRSOH\RXDUHWDONLQJZLWKDZDUH\RXDUHGULYLQJDQGLIQHFHVVDU\VXVSHQG
FRQYHUVDWLRQVZKLFKKDYHWKHSRWHQWLDOWRGLYHUW\RXUDWWHQWLRQIURPWKHURDG
8VH\RXUZLUHOHVVSKRQHWRFDOOIRUKHOS<RXUZLUHOHVVSKRQHLVRQHRIWKH
JUHDWHVWWRROV\RXFDQRZQWRSURWHFW\RXUVHOIDQG\RXUIDPLO\LQGDQJHURXV
VLWXDWLRQVZLWK\RXUSKRQHDW\RXUVLGHKHOSLVRQO\WKUHHQXPEHUVDZD\'LDO
RURWKHUORFDOHPHUJHQF\QXPEHULQWKHFDVHRIILUHWUDIILFDFFLGHQWURDG
KD]DUGRUPHGLFDOHPHUJHQF\5HPHPEHULWLVDIUHHFDOORQ\RXUZLUHOHVVSKRQH
8VH\RXUZLUHOHVVSKRQHWRKHOSRWKHUVLQHPHUJHQFLHV<RXUZLUHOHVVSKRQH
SURYLGHV\RXDSHUIHFWRSSRUWXQLW\WREHD*RRG6DPDULWDQLQ\RXUFRPPXQLW\
,I\RXVHHDQDXWRDFFLGHQWFULPHLQSURJUHVVRURWKHUVHULRXVHPHUJHQF\ZKHUH
OLYHVDUHLQGDQJHUFDOORURWKHUORFDOHPHUJHQF\QXPEHUDV\RXZRXOG
ZDQWRWKHUVWRGRIRU\RX
&DOOURDGVLGHDVVLVWDQFHRUDVSHFLDOZLUHOHVVQRQHPHUJHQF\DVVLVWDQFHQXPEHU
ZKHQQHFHVVDU\&HUWDLQVLWXDWLRQV\RXHQFRXQWHUZKLOHGULYLQJPD\UHTXLUH
DWWHQWLRQEXWDUHQRWXUJHQWHQRXJKWRPHULWDFDOOIRUHPHUJHQF\VHUYLFHV%XW
\RXVWLOOFDQXVH\RXUZLUHOHVVSKRQHWROHQGDKDQG,I\RXVHHDEURNHQGRZQ
YHKLFOHSRVLQJQRVHULRXVKD]DUGDEURNHQWUDIILFVLJQDODPLQRUWUDIILFDFFLGHQW
ZKHUHQRRQHDSSHDUVLQMXUHGRUDYHKLFOH\RXNQRZWREHVWROHQFDOOURDGVLGH
DVVLVWDQFHRURWKHUVSHFLDOQRQHPHUJHQF\ZLUHOHVVQXPEHU
&DUHOHVVGLVWUDFWHGLQGLYLGXDOVDQGSHRSOHGULYLQJLUUHVSRQVLEO\UHSUHVHQWDKD]DUG
WRHYHU\RQHRQWKHURDG6LQFHWKH&HOOXODU7HOHFRPPXQLFDWLRQV,QGXVWU\
$VVRFLDWLRQDQGWKHZLUHOHVVLQGXVWU\KDYHFRQGXFWHGHGXFDWLRQDORXWUHDFKWR
LQIRUPZLUHOHVVSKRQHXVHUVRIWKHLUUHVSRQVLELOLWLHVDVVDIHGULYHUVDQGJRRG
FLWL]HQV$VZHDSSURDFKDQHZFHQWXU\PRUHDQGPRUHRIXVZLOOWDNHDGYDQWDJH
RIWKHEHQHILWVRIZLUHOHVVWHOHSKRQHV$QGDVZHWDNHWRWKHURDGVZHDOOKDYHD
UHVSRQVLELOLW\WRGULYHVDIHO\
Nokia 6560 User Guide
115 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 116 Friday, April 23, 2004 4:40 PM 7KHZLUHOHVVLQGXVWU\UHPLQGV\RXWRXVH\RXUSKRQHVDIHO\ZKHQGULYLQJ
)RUPRUHLQIRUPDWLRQSOHDVHFDOO6$)(
)RUXSGDWHVKWWSZZZZRZFRPFRPFRQVXPHULVVXHVGULYLQJ
DUWLFOHVFIP",'
&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ
$OO5LJKWV5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
116 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 117 Friday, April 23, 2004 4:40 PM Appendix B Appendix B Message from the FDA
(U.S. Food and Drug Administration) to all users of mobile phones.
-XO\
)RUXSGDWHVKWWSZZZIGDJRYFGUKSKRQHV Nokia 6560 User Guide
117 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 118 Friday, April 23, 2004 4:40 PM Consumer Update on Wireless Phones U.S. Food and Drug Administration 1. Do wireless phones pose a health hazard?
7KHDYDLODEOHVFLHQWLILFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPVDUH
DVVRFLDWHGZLWKXVLQJZLUHOHVVSKRQHV7KHUHLVQRSURRIKRZHYHUWKDWZLUHOHVV
SKRQHVDUHDEVROXWHO\VDIH:LUHOHVVSKRQHVHPLWORZOHYHOVRIUDGLRIUHTXHQF\
HQHUJ\5)LQWKHPLFURZDYHUDQJHZKLOHEHLQJXVHG7KH\DOVRHPLWYHU\ORZOHYHOV
RI5)ZKHQLQWKHVWDQGE\PRGH:KHUHDVKLJKOHYHOVRI5)FDQSURGXFHKHDOWK
HIIHFWVE\KHDWLQJWLVVXHH[SRVXUHWRORZOHYHO5)WKDWGRHVQRWSURGXFHKHDWLQJ
HIIHFWVFDXVHVQRNQRZQDGYHUVHKHDOWKHIIHFWV0DQ\VWXGLHVRIORZOHYHO5)
H[SRVXUHVKDYHQRWIRXQGDQ\ELRORJLFDOHIIHFWV6RPHVWXGLHVKDYHVXJJHVWHGWKDW
VRPHELRORJLFDOHIIHFWVPD\RFFXUEXWVXFKILQGLQJVKDYHQRWEHHQFRQILUPHGE\
DGGLWLRQDOUHVHDUFK,QVRPHFDVHVRWKHUUHVHDUFKHUVKDYHKDGGLIILFXOW\LQ
UHSURGXFLQJWKRVHVWXGLHVRULQGHWHUPLQLQJWKHUHDVRQVIRULQFRQVLVWHQWUHVXOWV
2. What is FDAs role concerning the safety of wireless phones?
8QGHUWKHODZ)'$GRHVQRWUHYLHZWKHVDIHW\RIUDGLDWLRQHPLWWLQJFRQVXPHU
SURGXFWVVXFKDVZLUHOHVVSKRQHVEHIRUHWKH\FDQEHVROGDVLWGRHVZLWKQHZGUXJV
RUPHGLFDOGHYLFHV+RZHYHUWKHDJHQF\KDVDXWKRULW\WRWDNHDFWLRQLIZLUHOHVV
SKRQHVDUHVKRZQWRHPLWUDGLRIUHTXHQF\HQHUJ\5)DWDOHYHOWKDWLVKD]DUGRXVWR
WKHXVHU,QVXFKDFDVH)'$FRXOGUHTXLUHWKHPDQXIDFWXUHUVRIZLUHOHVVSKRQHVWR
QRWLI\XVHUVRIWKHKHDOWKKD]DUGDQGWRUHSDLUUHSODFHRUUHFDOOWKHSKRQHVVRWKDW
WKHKD]DUGQRORQJHUH[LVWV
$OWKRXJKWKHH[LVWLQJVFLHQWLILFGDWDGRQRWMXVWLI\)'$UHJXODWRU\DFWLRQV)'$KDV
XUJHGWKHZLUHOHVVSKRQHLQGXVWU\WRWDNHDQXPEHURIVWHSVLQFOXGLQJWKHIROORZLQJ
6XSSRUWQHHGHGUHVHDUFKLQWRSRVVLEOHELRORJLFDOHIIHFWVRI5)RIWKHW\SH
HPLWWHGE\ZLUHOHVVSKRQHV
'HVLJQZLUHOHVVSKRQHVLQDZD\WKDWPLQLPL]HVDQ\5)H[SRVXUHWRWKHXVHU
WKDWLVQRWQHFHVVDU\IRUGHYLFHIXQFWLRQDQG
&RRSHUDWHLQSURYLGLQJXVHUVRIZLUHOHVVSKRQHVZLWKWKHEHVWSRVVLEOH
LQIRUPDWLRQRQSRVVLEOHHIIHFWVRIZLUHOHVVSKRQHXVHRQKXPDQKHDOWK
)'$EHORQJVWRDQLQWHUDJHQF\ZRUNLQJJURXSRIWKHIHGHUDODJHQFLHVWKDWKDYH
UHVSRQVLELOLW\IRUGLIIHUHQWDVSHFWVRI5)VDIHW\WRHQVXUHFRRUGLQDWHGHIIRUWVDWWKH
IHGHUDOOHYHO7KHIROORZLQJDJHQFLHVEHORQJWRWKLVZRUNLQJJURXS
1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK
(QYLURQPHQWDO3URWHFWLRQ$JHQF\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ 1DWLRQDO7HOHFRPPXQLFDWLRQVDQG,QIRUPDWLRQ$GPLQLVWUDWLRQ 7KH1DWLRQDO,QVWLWXWHVRI+HDOWKSDUWLFLSDWHVLQVRPHLQWHUDJHQF\ZRUNLQJJURXS
DFWLYLWLHVDVZHOO
118 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 119 Friday, April 23, 2004 4:40 PM Appendix B
)'$VKDUHVUHJXODWRU\UHVSRQVLELOLWLHVIRUZLUHOHVVSKRQHVZLWKWKH)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQ)&&$OOSKRQHVWKDWDUHVROGLQWKH8QLWHG6WDWHV
PXVWFRPSO\ZLWK)&&VDIHW\JXLGHOLQHVWKDWOLPLW5)H[SRVXUH)&&UHOLHVRQ)'$
DQGRWKHUKHDOWKDJHQFLHVIRUVDIHW\TXHVWLRQVDERXWZLUHOHVVSKRQHV)&&DOVR
UHJXODWHVWKHEDVHVWDWLRQVWKDWWKHZLUHOHVVSKRQHQHWZRUNVUHO\XSRQ:KLOHWKHVH
EDVHVWDWLRQVRSHUDWHDWKLJKHUSRZHUWKDQGRWKHZLUHOHVVSKRQHVWKHPVHOYHVWKH
5)H[SRVXUHVWKDWSHRSOHJHWIURPWKHVHEDVHVWDWLRQVDUHW\SLFDOO\WKRXVDQGVRI
WLPHVORZHUWKDQWKRVHWKH\FDQJHWIURPZLUHOHVVSKRQHV%DVHVWDWLRQVDUHWKXVQRW
WKHVXEMHFWRIWKHVDIHW\TXHVWLRQVGLVFXVVHGLQWKLVGRFXPHQW
3. What kinds of phones are the subject of this update?
7KHWHUPZLUHOHVVSKRQHUHIHUVKHUHWRKDQGKHOGZLUHOHVVSKRQHVZLWKEXLOWLQ
DQWHQQDVRIWHQFDOOHGFHOOPRELOHRU3&6SKRQHV7KHVHW\SHVRIZLUHOHVVSKRQHV
FDQH[SRVHWKHXVHUWRPHDVXUDEOHUDGLRIUHTXHQF\HQHUJ\5)EHFDXVHRIWKHVKRUW
GLVWDQFHEHWZHHQWKHSKRQHDQGWKHXVHUVKHDG7KHVH5)H[SRVXUHVDUHOLPLWHGE\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQVDIHW\JXLGHOLQHVWKDWZHUHGHYHORSHGZLWK
WKHDGYLFHRI)'$DQGRWKHUIHGHUDOKHDOWKDQGVDIHW\DJHQFLHV:KHQWKHSKRQHLV
ORFDWHGDWJUHDWHUGLVWDQFHVIURPWKHXVHUWKHH[SRVXUHWR5)LVGUDVWLFDOO\ORZHU
EHFDXVHDSHUVRQ V5)H[SRVXUHGHFUHDVHVUDSLGO\ZLWKLQFUHDVLQJGLVWDQFHIURPWKH
VRXUFH7KHVRFDOOHGFRUGOHVVSKRQHVZKLFKKDYHDEDVHXQLWFRQQHFWHGWRWKH
WHOHSKRQHZLULQJLQDKRXVHW\SLFDOO\RSHUDWHDWIDUORZHUSRZHUOHYHOVDQGWKXV
SURGXFH5)H[SRVXUHVIDUEHORZWKH)&&VDIHW\OLPLWV
4. What are the results of the research done already?
7KHUHVHDUFKGRQHWKXVIDUKDVSURGXFHGFRQIOLFWLQJUHVXOWVDQGPDQ\VWXGLHVKDYH
VXIIHUHGIURPIODZVLQWKHLUUHVHDUFKPHWKRGV$QLPDOH[SHULPHQWVLQYHVWLJDWLQJWKH
HIIHFWVRIUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHVFKDUDFWHULVWLFRIZLUHOHVVSKRQHV
KDYH\LHOGHGFRQIOLFWLQJUHVXOWVWKDWRIWHQFDQQRWEHUHSHDWHGLQRWKHUODERUDWRULHV
$IHZDQLPDOVWXGLHVKRZHYHUKDYHVXJJHVWHGWKDWORZOHYHOVRI5)FRXOGDFFHOHUDWH
WKHGHYHORSPHQWRIFDQFHULQODERUDWRU\DQLPDOV+RZHYHUPDQ\RIWKHVWXGLHVWKDW
VKRZHGLQFUHDVHGWXPRUGHYHORSPHQWXVHGDQLPDOVWKDWKDGEHHQJHQHWLFDOO\
HQJLQHHUHGRUWUHDWHGZLWKFDQFHUFDXVLQJFKHPLFDOVVRDVWREHSUHGLVSRVHGWR
GHYHORSFDQFHULQWKHDEVHQFHRI5)H[SRVXUH2WKHUVWXGLHVH[SRVHGWKHDQLPDOVWR
5)IRUXSWRKRXUVSHUGD\7KHVHFRQGLWLRQVDUHQRWVLPLODUWRWKHFRQGLWLRQV
XQGHUZKLFKSHRSOHXVHZLUHOHVVSKRQHVVRZHGRQWNQRZZLWKFHUWDLQW\ZKDWWKH
UHVXOWVRIVXFKVWXGLHVPHDQIRUKXPDQKHDOWK
7KUHHODUJHHSLGHPLRORJ\VWXGLHVKDYHEHHQSXEOLVKHGVLQFH'HFHPEHU
%HWZHHQWKHPWKHVWXGLHVLQYHVWLJDWHGDQ\SRVVLEOHDVVRFLDWLRQEHWZHHQWKHXVH
RIZLUHOHVVSKRQHVDQGSULPDU\EUDLQFDQFHUJOLRPDPHQLQJLRPDRUDFRXVWLF
QHXURPDWXPRUVRIWKHEUDLQRUVDOLYDU\JODQGOHXNHPLDRURWKHUFDQFHUV
1RQHRIWKHVWXGLHVGHPRQVWUDWHGWKHH[LVWHQFHRIDQ\KDUPIXOKHDOWKHIIHFWVIURP
ZLUHOHVVSKRQH5)H[SRVXUHV+RZHYHUQRQHRIWKHVWXGLHVFDQDQVZHUTXHVWLRQV
DERXWORQJWHUPH[SRVXUHVVLQFHWKHDYHUDJHSHULRGRISKRQHXVHLQWKHVHVWXGLHV
ZDVDURXQGWKUHH\HDUV
Nokia 6560 User Guide
119 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 120 Friday, April 23, 2004 4:40 PM 5. What research is needed to decide whether RF exposure from wireless phones poses a health risk?
$FRPELQDWLRQRIODERUDWRU\VWXGLHVDQGHSLGHPLRORJLFDOVWXGLHVRISHRSOHDFWXDOO\
XVLQJZLUHOHVVSKRQHVZRXOGSURYLGHVRPHRIWKHGDWDWKDWDUHQHHGHG/LIHWLPH
DQLPDOH[SRVXUHVWXGLHVFRXOGEHFRPSOHWHGLQDIHZ\HDUV+RZHYHUYHU\ODUJH
QXPEHUVRIDQLPDOVZRXOGEHQHHGHGWRSURYLGHUHOLDEOHSURRIRIDFDQFHU
SURPRWLQJHIIHFWLIRQHH[LVWV(SLGHPLRORJLFDOVWXGLHVFDQSURYLGHGDWDWKDWLV
GLUHFWO\DSSOLFDEOHWRKXPDQSRSXODWLRQVEXWRUPRUH\HDUVIROORZXSPD\EH
QHHGHGWRSURYLGHDQVZHUVDERXWVRPHKHDOWKHIIHFWVVXFKDVFDQFHU7KLVLVEHFDXVH
WKHLQWHUYDOEHWZHHQWKHWLPHRIH[SRVXUHWRDFDQFHUFDXVLQJDJHQWDQGWKHWLPH
WXPRUVGHYHORSLIWKH\GRPD\EHPDQ\PDQ\\HDUV7KHLQWHUSUHWDWLRQRI
HSLGHPLRORJLFDOVWXGLHVLVKDPSHUHGE\GLIILFXOWLHVLQPHDVXULQJDFWXDO5)H[SRVXUH
GXULQJGD\WRGD\XVHRIZLUHOHVVSKRQHV0DQ\IDFWRUVDIIHFWWKLVPHDVXUHPHQW
VXFKDVWKHDQJOHDWZKLFKWKHSKRQHLVKHOGRUZKLFKPRGHORISKRQHLVXVHG
6. What is FDA doing to find out more about the possible health effects of wireless phone RF?
)'$LVZRUNLQJZLWKWKH861DWLRQDO7R[LFRORJ\3URJUDPDQGZLWKJURXSVRI
LQYHVWLJDWRUVDURXQGWKHZRUOGWRHQVXUHWKDWKLJKSULRULW\DQLPDOVWXGLHVDUH
FRQGXFWHGWRDGGUHVVLPSRUWDQWTXHVWLRQVDERXWWKHHIIHFWVRIH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)
)'$KDVEHHQDOHDGLQJSDUWLFLSDQWLQWKH:RUOG+HDOWK2UJDQL]DWLRQ,QWHUQDWLRQDO
(OHFWURPDJQHWLF)LHOGV(0)3URMHFWVLQFHLWVLQFHSWLRQLQ$QLQIOXHQWLDOUHVXOW
RIWKLVZRUNKDVEHHQWKHGHYHORSPHQWRIDGHWDLOHGDJHQGDRIUHVHDUFKQHHGVWKDW
KDVGULYHQWKHHVWDEOLVKPHQWRIQHZUHVHDUFKSURJUDPVDURXQGWKHZRUOG7KH3URMHFW
KDVDOVRKHOSHGGHYHORSDVHULHVRISXEOLFLQIRUPDWLRQGRFXPHQWVRQ(0)LVVXHV
)'$DQGWKH&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ&7,$KDYHD
IRUPDO&RRSHUDWLYH5HVHDUFKDQG'HYHORSPHQW$JUHHPHQW&5$'$WRGRUHVHDUFK
RQZLUHOHVVSKRQHVDIHW\)'$SURYLGHVWKHVFLHQWLILFRYHUVLJKWREWDLQLQJLQSXWIURP
H[SHUWVLQJRYHUQPHQWLQGXVWU\DQGDFDGHPLFRUJDQL]DWLRQV&7,$IXQGHGUHVHDUFK
LVFRQGXFWHGWKURXJKFRQWUDFWVWRLQGHSHQGHQWLQYHVWLJDWRUV7KHLQLWLDOUHVHDUFKZLOO
LQFOXGHERWKODERUDWRU\VWXGLHVDQGVWXGLHVRIZLUHOHVVSKRQHXVHUV7KH&5$'$ZLOO
DOVRLQFOXGHDEURDGDVVHVVPHQWRIDGGLWLRQDOUHVHDUFKQHHGVLQWKHFRQWH[WRIWKH
ODWHVWUHVHDUFKGHYHORSPHQWVDURXQGWKHZRUOG
7. How can I find out how much radiofrequency energy exposure I can get by using my wireless phone?
$OOSKRQHVVROGLQWKH8QLWHG6WDWHVPXVWFRPSO\ZLWK)HGHUDO&RPPXQLFDWLRQV
&RPPLVVLRQ)&&JXLGHOLQHVWKDWOLPLWUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHV
)&&HVWDEOLVKHGWKHVHJXLGHOLQHVLQFRQVXOWDWLRQZLWK)'$DQGWKHRWKHUIHGHUDO
KHDOWKDQGVDIHW\DJHQFLHV7KH)&&OLPLWIRU5)H[SRVXUHIURPZLUHOHVVWHOHSKRQHV
LVVHWDWD6SHFLILF$EVRUSWLRQ5DWH6$5RIZDWWVSHUNLORJUDP:NJ
7KH)&&OLPLWLVFRQVLVWHQWZLWKWKHVDIHW\VWDQGDUGVGHYHORSHGE\WKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLF(QJLQHHULQJ,(((DQGWKH1DWLRQDO&RXQFLORQ5DGLDWLRQ
3URWHFWLRQDQG0HDVXUHPHQW7KHH[SRVXUHOLPLWWDNHVLQWRFRQVLGHUDWLRQWKH
ERG\VDELOLW\WRUHPRYHKHDWIURPWKHWLVVXHVWKDWDEVRUEHQHUJ\IURPWKHZLUHOHVV
SKRQHDQGLVVHWZHOOEHORZOHYHOVNQRZQWRKDYHHIIHFWV
120 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 121 Friday, April 23, 2004 4:40 PM Appendix B 0DQXIDFWXUHUVRIZLUHOHVVSKRQHVPXVWUHSRUWWKH5)H[SRVXUHOHYHOIRUHDFKPRGHO
RISKRQHWRWKH)&&7KH)&&ZHEVLWHKWWSZZZIFFJRYRHWUIVDIHW\JLYHV
GLUHFWLRQVIRUORFDWLQJWKH)&&LGHQWLILFDWLRQQXPEHURQ\RXUSKRQHVR\RXFDQILQG
\RXUSKRQHV5)H[SRVXUHOHYHOLQWKHRQOLQHOLVWLQJ
8. What has FDA done to measure the radiofrequency energy coming from wireless phones?
7KH,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((LVGHYHORSLQJDWHFKQLFDO
VWDQGDUGIRUPHDVXULQJWKHUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHIURPZLUHOHVV
SKRQHVDQGRWKHUZLUHOHVVKDQGVHWVZLWKWKHSDUWLFLSDWLRQDQGOHDGHUVKLSRI)'$
VFLHQWLVWVDQGHQJLQHHUV7KHVWDQGDUG5HFRPPHQGHG3UDFWLFHIRU'HWHUPLQLQJWKH
6SDWLDO3HDN6SHFLILF$EVRUSWLRQ5DWH6$5LQWKH+XPDQ%RG\'XHWR:LUHOHVV
&RPPXQLFDWLRQV'HYLFHV([SHULPHQWDO7HFKQLTXHVVHWVIRUWKWKHILUVWFRQVLVWHQW
WHVWPHWKRGRORJ\IRUPHDVXULQJWKHUDWHDWZKLFK5)LVGHSRVLWHGLQWKHKHDGVRI
ZLUHOHVVSKRQHXVHUV7KHWHVWPHWKRGXVHVDWLVVXHVLPXODWLQJPRGHORIWKHKXPDQ
KHDG6WDQGDUGL]HG6$5WHVWPHWKRGRORJ\LVH[SHFWHGWRJUHDWO\LPSURYHWKH
FRQVLVWHQF\RIPHDVXUHPHQWVPDGHDWGLIIHUHQWODERUDWRULHVRQWKHVDPHSKRQH
6$5LVWKHPHDVXUHPHQWRIWKHDPRXQWRIHQHUJ\DEVRUEHGLQWLVVXHHLWKHUE\WKH
ZKROHERG\RUDVPDOOSDUWRIWKHERG\,WLVPHDVXUHGLQZDWWVNJRUPLOOLZDWWVJ
RIPDWWHU7KLVPHDVXUHPHQWLVXVHGWRGHWHUPLQHZKHWKHUDZLUHOHVVSKRQH
FRPSOLHVZLWKVDIHW\JXLGHOLQHV
9. What steps can I take to reduce my exposure to radiofrequency energy from my wireless phone?
,IWKHUHLVDULVNIURPWKHVHSURGXFWVDQGDWWKLVSRLQWZHGRQRWNQRZWKDWWKHUH
LVLWLVSUREDEO\YHU\VPDOO%XWLI\RXDUHFRQFHUQHGDERXWDYRLGLQJHYHQSRWHQWLDO
ULVNV\RXFDQWDNHDIHZVLPSOHVWHSVWRPLQLPL]H\RXUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\5)6LQFHWLPHLVDNH\IDFWRULQKRZPXFKH[SRVXUHDSHUVRQUHFHLYHV
UHGXFLQJWKHDPRXQWRIWLPHVSHQWXVLQJDZLUHOHVVSKRQHZLOOUHGXFH5)H[SRVXUH
,I\RXPXVWFRQGXFWH[WHQGHGFRQYHUVDWLRQVE\ZLUHOHVVSKRQHHYHU\GD\\RXFRXOG
SODFHPRUHGLVWDQFHEHWZHHQ\RXUERG\DQGWKHVRXUFHRIWKH5)VLQFHWKHH[SRVXUH
OHYHOGURSVRIIGUDPDWLFDOO\ZLWKGLVWDQFH)RUH[DPSOH\RXFRXOGXVHDKHDGVHWDQG
FDUU\WKHZLUHOHVVSKRQHDZD\IURP\RXUERG\RUXVHDZLUHOHVVSKRQHFRQQHFWHGWR
DUHPRWHDQWHQQD
$JDLQWKHVFLHQWLILFGDWDGRQRWGHPRQVWUDWHWKDWZLUHOHVVSKRQHVDUHKDUPIXO
%XWLI\RXDUHFRQFHUQHGDERXWWKH5)H[SRVXUHIURPWKHVHSURGXFWV\RXFDQXVH
PHDVXUHVOLNHWKRVHGHVFULEHGDERYHWRUHGXFH\RXU5)H[SRVXUHIURPZLUHOHVV
SKRQHXVH
10. What about children using wireless phones?
7KHVFLHQWLILFHYLGHQFHGRHVQRWVKRZDGDQJHUWRXVHUVRIZLUHOHVVSKRQHV
LQFOXGLQJFKLOGUHQDQGWHHQDJHUV,I\RXZDQWWRWDNHVWHSVWRORZHUH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)WKHPHDVXUHVGHVFULEHGDERYHZRXOGDSSO\WRFKLOGUHQ
DQGWHHQDJHUVXVLQJZLUHOHVVSKRQHV5HGXFLQJWKHWLPHRIZLUHOHVVSKRQHXVHDQG
LQFUHDVLQJWKHGLVWDQFHEHWZHHQWKHXVHUDQGWKH5)VRXUFHZLOOUHGXFH5)H[SRVXUH
6RPHJURXSVVSRQVRUHGE\RWKHUQDWLRQDOJRYHUQPHQWVKDYHDGYLVHGWKDWFKLOGUHQ
EHGLVFRXUDJHGIURPXVLQJZLUHOHVVSKRQHVDWDOO)RUH[DPSOHWKHJRYHUQPHQWLQ
Nokia 6560 User Guide
121 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 122 Friday, April 23, 2004 4:40 PM WKH8QLWHG.LQJGRPGLVWULEXWHGOHDIOHWVFRQWDLQLQJVXFKDUHFRPPHQGDWLRQLQ
'HFHPEHU7KH\QRWHGWKDWQRHYLGHQFHH[LVWVWKDWXVLQJDZLUHOHVVSKRQH
FDXVHVEUDLQWXPRUVRURWKHULOOHIIHFWV7KHLUUHFRPPHQGDWLRQWROLPLWZLUHOHVV
SKRQHXVHE\FKLOGUHQZDVVWULFWO\SUHFDXWLRQDU\LWZDVQRWEDVHGRQVFLHQWLILF
HYLGHQFHWKDWDQ\KHDOWKKD]DUGH[LVWV
11. What about wireless phone interference with medical equipment?
5DGLRIUHTXHQF\HQHUJ\5)IURPZLUHOHVVSKRQHVFDQLQWHUDFWZLWKVRPHHOHFWURQLF
GHYLFHV)RUWKLVUHDVRQ)'$KHOSHGGHYHORSDGHWDLOHGWHVWPHWKRGWRPHDVXUH
HOHFWURPDJQHWLFLQWHUIHUHQFH(0,RILPSODQWHGFDUGLDFSDFHPDNHUVDQG
GHILEULOODWRUVIURPZLUHOHVVWHOHSKRQHV7KLVWHVWPHWKRGLVQRZSDUWRIDVWDQGDUG
VSRQVRUHGE\WKH$VVRFLDWLRQIRUWKH$GYDQFHPHQWRI0HGLFDOLQVWUXPHQWDWLRQ
$$0,7KHILQDOGUDIWDMRLQWHIIRUWE\)'$PHGLFDOGHYLFHPDQXIDFWXUHUV
DQGPDQ\RWKHUJURXSVZDVFRPSOHWHGLQODWH7KLVVWDQGDUGZLOODOORZ
PDQXIDFWXUHUVWRHQVXUHWKDWFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVDUHVDIHIURP
ZLUHOHVVSKRQH(0,)'$KDVWHVWHGKHDULQJDLGVIRULQWHUIHUHQFHIURPKDQGKHOG
ZLUHOHVVSKRQHVDQGKHOSHGGHYHORSDYROXQWDU\VWDQGDUGVSRQVRUHGE\WKH,QVWLWXWH
RI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((7KLVVWDQGDUGVSHFLILHVWHVWPHWKRGV
DQGSHUIRUPDQFHUHTXLUHPHQWVIRUKHDULQJDLGVDQGZLUHOHVVSKRQHVVRWKDWQR
LQWHUIHUHQFHRFFXUVZKHQDSHUVRQXVHVDFRPSDWLEOHSKRQHDQGDDFFRPSDQLHG
KHDULQJDLGDWWKHVDPHWLPH7KLVVWDQGDUGZDVDSSURYHGE\WKH,(((LQ
)'$FRQWLQXHVWRPRQLWRUWKHXVHRIZLUHOHVVSKRQHVIRUSRVVLEOHLQWHUDFWLRQVZLWK
RWKHUPHGLFDOGHYLFHV6KRXOGKDUPIXOLQWHUIHUHQFHEHIRXQGWRRFFXU)'$ZLOO
FRQGXFWWHVWLQJWRDVVHVVWKHLQWHUIHUHQFHDQGZRUNWRUHVROYHWKHSUREOHP
12. Where can I find additional information?
)RUDGGLWLRQDOLQIRUPDWLRQSOHDVHUHIHUWRWKHIROORZLQJUHVRXUFHV
)'$ZHESDJHRQZLUHOHVVSKRQHV KWWSZZZIGDJRYFGUKSKRQHVLQGH[KWPO
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&5)6DIHW\3URJUDP
KWWSZZZIFFJRYRHWUIVDIHW\
,QWHUQDWLRQDO&RPPLVVLRQRQ1RQ,RQL]LQJ5DGLDWLRQ3URWHFWLRQ KWWSZZZLFQLUSGH
:RUOG+HDOWK2UJDQL]DWLRQ:+2,QWHUQDWLRQDO(0)3URMHFW KWWSZZZZKRLQWHPI 1DWLRQDO5DGLRORJLFDO3URWHFWLRQ%RDUG8. KWWSZZZQUSERUJXN
July 18, 2001 For updates: http://www.fda.gov/cdrh/phones 122 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 123 Friday, April 23, 2004 4:40 PM Index Index A activate alarm clock 89 call forwarding 40 adjust the volume 15 alarm clock 89 antenna 9 applications 87 automatic redial 40 B basic operation 15 battery charging 10, 99 indicator 10 installing 9 removal 10 voltage 107 bookmarks entering manually 95 returning to 96 saving 95 using 95 browse internet 93 phone menus 19 browser options 94 set up 93 business cards 71 C calculator 69 calendar 68 call forwarding 39 history 34 lists 35 timers 36 waiting 37 caller feature code 46 groups 32 ID 45 calling calls card 40 features 37 conference 38 make and answer 17 restricting 66 channels 107 characters, entering 23 charge battery 10 times 106 chargers 98 chat 84 clock network update 56 set the format 56 show 55 color schemes 59 conference calls 38 contact Nokia 7 your service provider 8 contrast, adjusting 16 covers removing 11 replacing 12 currency calculations 71 D data entry, internet 95 date change the format 56 show/hide 56 dialed calls 34 dictionary 26 Nokia 6560 User Guide
123 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 124 Friday, April 23, 2004 4:40 PM digital talk times 106 display brightness 60 display settings 59 downloads applications 87 ringing tones 89 E edit a name or number 30 e-mail messages 81 enhancement settings 60 enhancements 98 enter characters 23 numbers 22 punctuation 23 spaces 23 equalizer 16 erase mistakes 23 names and numbers 30 text messages 80 ESN number 7 exchange rate 70 F factory settings 60 folders archive 77 delete messages 80 inbox 77 templates 77 text messages 77 frequency range 107 G gallery 86 games 97 H headset connect 15 use 15 hearing impaired solutions 61 help text 19 home network 76 I information adding 21 recalling 29 internet, connecting to 94 IR 91 K keyguard 63 keypad avoid accidental key presses 63 lock 63 tones, setting 53 keys selection 19 keys, learning 16 L label 8 language setting 55 letter case, changing 23 letters, entering 22 loopset 61 loudspeaker 17 M make and answer calls 17 memory checking 33 full 80 locations 107 status 33 menu, phone 19 message alert tone 53 messages checking 49 text 77 missed calls 34 mistakes, erasing 23 124 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 125 Friday, April 23, 2004 4:40 PM Index mobile inductive loopset 61 model number 7 N names and numbers add second number 31 delete 31 edit 30 save 28 network number search 75 service features 75 add to message 27 changing type 32 entering 22 selection 46 types 31 O options, in a call 37 P personalize phone settings 55 phone dimensions 107 help 19 lock 64 memory full 80 menus 19 numbers 107 security, managing 63 size 107 symbols 18 weight 107 phone book caller groups 32 menus 29 save an entry 28 save text entry 29 views 30 picture messages 84 play games 97 power on 13 power output 107 predictive text 24 tips for 26 turning off 25 prepaid 73 primary number 32 punctuation, entering 23 Q quick save 28 R received calls 34 redial 40 remove the battery 10 reply to a text message 81 restrict calls 66 ring volume 52 ringing tones discarding 89 downloading 89 options 52 receiving 89 volume 52 S screen saver 59 search for network 75 security changing 64 default 63 features 63 selection keys 19 sending e-mail 81 serial number 7 service provider 8 differences 7 signing up 7 services menu 94 set the ring volume and tone 52 Nokia 6560 User Guide
125 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 126 Friday, April 23, 2004 4:40 PM settings personal shortcuts 58 personalizing 55 tone settings 60 shortcuts 58 spaces, entering 23 speaker phone 17 special characters 24 features 86 speed dial 57 standby time 106 start screen 13 stopwatch 71 switch between calls 38 on your phone 13 symbols displayed on your phone 18 symbols, inserting 27 T talk time 106 technical information 107 templates 82 terms 4 text entry 29 text messages as e-mail 81 communicating 77 erasing 80 forwarding 81 length 77 recipients 77 replying 81 To-do list 69 touch tones 47 transmit power 107 TTY 61 turn on your phone 13 U updates to this guide 7 V vibrating alert 53 view date 56 voice mail 49 messages 50 voice commands 44 activate 45 add 45 voice tag change 43 erase 43 play back 43 volume, adjusting 15 W warning tones 53 web address 97 weight 107 X Xpress-on covers 11 126 Copyright 2003 Nokia 6560.ENv1a_9355907.book Page 127 Friday, April 23, 2004 4:40 PM NOTES Index Nokia 6560 User Guide
127 Copyright 2003 Nokia 02/04 6560.ENv1a_9355907.book Page 115 Friday, April 23, 2004 4:40 PM Para obtener un manual del usuario en espaol favor de llamar o enviar un fax al telfono 1-888-NOKIA-2U, fax 813-249-9619. 1RNLD8VHU*XLGH
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2004-06-24 | 1850.04 ~ 1909.92 | PCE - PCS Licensed Transmitter held to ear | Class II permissive change or modification of presently authorized equipment |
2 | 2004-04-05 | 1850.04 ~ 1909.92 | PCE - PCS Licensed Transmitter held to ear | |
3 | 2003-10-16 | 1850.04 ~ 1909.92 | PCE - PCS Licensed Transmitter held to ear | |
4 | 2003-09-11 | 1850.04 ~ 1909.92 | PCE - PCS Licensed Transmitter held to ear | Original Equipment |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 3 4 | Effective |
2004-06-24
|
||||
1 2 3 4 |
2004-04-05
|
|||||
1 2 3 4 |
2003-10-16
|
|||||
1 2 3 4 |
2003-09-11
|
|||||
1 2 3 4 | Applicant's complete, legal business name |
Microsoft Corporation
|
||||
1 2 3 4 | FCC Registration Number (FRN) |
0005087978
|
||||
1 2 3 4 | Physical Address |
1 Microsoft Way
|
||||
1 2 3 4 |
Redmond, Washington 98052
|
|||||
1 2 3 4 |
United States
|
|||||
app s | TCB Information | |||||
1 2 3 4 | TCB Application Email Address |
h******@americantcb.com
|
||||
1 2 3 4 |
h******@AmericanTCB.com
|
|||||
1 2 3 4 | TCB Scope |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
||||
app s | FCC ID | |||||
1 2 3 4 | Grantee Code |
GML
|
||||
1 2 3 4 | Equipment Product Code |
RH-25
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 3 4 | Name |
H**** S******
|
||||
1 2 3 4 | Title |
Director, EMC, SI and RF Compliance
|
||||
1 2 3 4 | Telephone Number |
425-7********
|
||||
1 2 3 4 | Fax Number |
425-7********
|
||||
1 2 3 4 |
h******@microsoft.com
|
|||||
app s | Technical Contact | |||||
1 2 3 4 | Firm Name |
Nokia Mobile Phones
|
||||
1 2 3 4 |
Nokia Mobile Phones, Inc.
|
|||||
1 2 3 4 | Name |
N******** W****
|
||||
1 2 3 4 | Physical Address |
6000 Connection Drive, M/S 2:200
|
||||
1 2 3 4 |
60000 Connection Drive, M/S 2:200
|
|||||
1 2 3 4 |
Irving, Texas 75039
|
|||||
1 2 3 4 |
United States
|
|||||
1 2 3 4 | Telephone Number |
972-8********
|
||||
1 2 3 4 | Fax Number |
972-8********
|
||||
1 2 3 4 |
n******@nokia.com
|
|||||
app s | Non Technical Contact | |||||
1 2 3 4 | Firm Name |
Nokia Mobile Phones
|
||||
1 2 3 4 | Name |
A**** E******
|
||||
1 2 3 4 | Physical Address |
6000 Connection Dive, M/S 2:200
|
||||
1 2 3 4 |
Irving, Texas 75039
|
|||||
1 2 3 4 |
United States
|
|||||
1 2 3 4 | Telephone Number |
972-8********
|
||||
1 2 3 4 | Fax Number |
972-8********
|
||||
1 2 3 4 |
a******@nokia.com
|
|||||
app s | Confidentiality (long or short term) | |||||
1 2 3 4 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 4 | No | |||||
1 2 3 4 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 3 4 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 3 4 | Equipment Class | PCE - PCS Licensed Transmitter held to ear | ||||
1 2 3 4 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | Tri mode Dual Band Cellular Phone | ||||
1 2 3 4 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 2 3 4 | Modular Equipment Type | Does not apply | ||||
1 2 3 4 | Purpose / Application is for | Class II permissive change or modification of presently authorized equipment | ||||
1 2 3 4 | Original Equipment | |||||
1 2 3 4 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | No | ||||
1 2 3 4 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 3 4 | Grant Comments | Power Output is ERP for Part 22 and EIRP for Part 24. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and must provide at least 1.5cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Part 22 Head: 1.18W/kg; Body-worn 1.02W/kg; PCS Band Head: 1.25W/kg; Body-worn 1.19W/kg | ||||
1 2 3 4 | Power Output is ERP for Part 22 and EIRP for Part 24. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and must provide at least 1.5cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Part 22 Head: 1.13W/kg; Body-worn 1.02W/kg; PCS Band Head: 1.14W/kg; Bodyworn .96W/kg | |||||
1 2 3 4 | Power Output is ERP for Part 22 and EIRP for Part 24. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and must provide at least 1.5cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Part 22 Head: 1.13W/kg; Body-worn 1.02W/kg; PCS Band Head: 1.14W/kg; Body-worn .96W/kg | |||||
1 2 3 4 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 3 4 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
n/a | ||||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 24E | BC | 1850.04 | 1909.92 | 0.794 | 0.009 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
1 | 2 | 22H | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
1 | 3 | 22H | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
1 | 4 | 22H | BC | 824.04 | 848.97 | 0.479 | 0.024 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 24E | BC | 1850.04 | 1909.92 | 0.794 | 0.009 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
2 | 2 | 22H | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
2 | 3 | 22H | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
2 | 4 | 22H | BC | 824.04 | 848.97 | 0.479 | 0.024 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
3 | 1 | 22 | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
3 | 2 | 22 | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
3 | 3 | 22 | BC | 824.04 | 848.97 | 0.479 | 0.024 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
3 | 4 | 24E | BC | 1850.04 | 1909.92 | 0.794 | 0.009 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
4 | 1 | 22 | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F1D | |||||||||||||||||||||||||||||||||
4 | 2 | 22 | BC | 824.04 | 848.97 | 0.2 | 0.342 ppm | 40K0F8W | |||||||||||||||||||||||||||||||||
4 | 3 | 22 | BC | 824.04 | 848.97 | 0.479 | 0.024 ppm | 30K0DXW | |||||||||||||||||||||||||||||||||
4 | 4 | 24E | BC | 1850.04 | 1909.92 | 0.794 | 0.009 ppm | 30K0DXW |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC