all | frequencies |
|
|
exhibits | applications |
---|---|---|---|---|---|
manuals |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 |
|
Manual 1 | Users Manual | 2.61 MiB | July 11 2003 | |||
1 2 |
|
Manual 2 | Users Manual | 3.11 MiB | July 11 2003 | |||
1 2 | Cover Letter(s) | July 11 2003 | ||||||
1 2 | Cover Letter(s) | October 11 2003 / July 11 2003 | ||||||
1 2 | External Photos | July 11 2003 | ||||||
1 2 | ID Label/Location Info | July 11 2003 | ||||||
1 2 | Internal Photos | July 11 2003 | ||||||
1 2 | Cover Letter(s) | July 11 2003 | ||||||
1 2 | Cover Letter(s) | July 11 2003 | ||||||
1 2 | RF Exposure Info | July 11 2003 | ||||||
1 2 | RF Exposure Info | July 11 2003 | ||||||
1 2 | Test Report | July 11 2003 | ||||||
1 2 | Cover Letter(s) | July 11 2003 | ||||||
1 2 | RF Exposure Info | July 11 2003 | ||||||
1 2 | Test Setup Photos | July 11 2003 | ||||||
1 2 | Test Setup Photos | July 11 2003 | ||||||
1 2 | Test Report | July 11 2003 |
1 2 | Manual 1 | Users Manual | 2.61 MiB | July 11 2003 |
6820.ENv1_9310322.book Page i Wednesday, October 15, 2003 1:43 PM Nokia 6820 User Guide What information is needed?
Numbers Where is the number?
My number Voice mail number Wireless providers number Providers customer care Model number Phone type IMEI number Wireless service provider Wireless service provider Wireless service provider Wireless service provider
. Back of title page
. 6820.ENv1_9310322.book Page ii Wednesday, October 15, 2003 1:43 PM LEGAL INFORMATION PART NO. 9310322, ISSUE NO. 1 Copyright 2003 Nokia. All rights reserved. Nokia, Nokia Connecting People, Nokia 6820a, Nokia 6820b, Pop-Port, and the Nokia Original Enhancements logos are trademarks or registered trademarks of Nokia Corporation. Other company and product names mentioned herein may be trademarks or trade names of their respective owners. Printed in Canada 12/2003. Nokia tune is a sound mark of Nokia Corporation. Bluetooth is a registered trademark of Bluetooth SIG, Inc. US Patent No 5818437 and other pending patents. T9 text input software Copyright (C) 1997-2003. Tegic Communications, Inc. All rights reserved. Includes RSA BSAFE cryptographic or security protocol software from RSA Security. Java is a trademark of Sun Microsystems, Inc. The information contained in this user guide was written for the Nokia 6820 product. Nokia operates a policy of ongoing development. Nokia reserves the right to make changes to any of the products described in this document without prior notice. UNDER NO CIRCUMSTANCES SHALL NOKIA BE RESPONSIBLE FOR ANY LOSS OF DATA OR INCOME OR ANY SPECIAL, INCIDENTAL, AND CONSEQUENTIAL OR INDIRECT DAMAGES HOWSOEVER CAUSED. THE CONTENTS OF THIS DOCUMENT ARE PROVIDED "AS IS." EXCEPT AS REQUIRED BY APPLICABLE LAW, NO WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE MADE IN RELATION TO THE ACCURACY AND RELIABILITY OR CONTENTS OF THIS DOCUMENT. NOKIA RESERVES THE RIGHT TO REVISE THIS DOCUMENT OR WITHDRAW IT AT ANY TIME WITHOUT PRIOR NOTICE. EXPORT CONTROLS This device contains commodities, technology, or software exported from the United States in accordance with the Export Administration regulations. Diversion contrary to U.S. or Canadian law is prohibited. FCC/INDUSTRY CANADA NOTICE Your device may cause TV or radio interference (for example, when using a telephone in close proximity to receiving equipment). The FCC or Industry Canada can require you to stop using your telephone if such interference cannot be eliminated. If you require assistance, contact your local service facility. This device complies with part 15 of the FCC rules. Operation is subject to the condition that this device does not cause harmful interference. 6820.ENv1_9310322.book Page i Wednesday, October 15, 2003 1:43 PM 2 For your safety . 1 Quick Guide. 4 1 Welcome to Nokia . 5 About your phone . 5 Overview of phone functions . 5 Register your phone . 6 Network services . 6 Accessibility solutions . 7 Shared memory . 7 Phone setup. 8 Connectors . 8 Install SIM card and battery . 8 Charge the battery. 10 Switch the phone on and off . 10 How to hold your phone . 11 How to get help . 11 Phone basics . 13 Open the keyboard. 13 Key functions (keyboard closed). 15 Key functions (keyboard open) . 16 About the four-way joystick . 17 The standby mode . 17 Customize the Go to menu . 18 Switch the keyboard lights on or off . 18 Keypad lock (keyguard) . 21 Over-the-air settings service . 22 Call functions . 23 Make a call. 23 Answer or reject an incoming call . 24 Active call options . 25 Text Entry . 26 5 3 4
[ i ]
6820.ENv1_9310322.book Page ii Wednesday, October 15, 2003 1:43 PM 6 Write text with keyboard open . 26 Write text with keyboard closed. 27 The menu . 29 Scroll to a menu function . 29 Use a shortcut to access a menu function. 29 7 Messages . 30 Text messages (SMS) . 30 Archive folder and custom folders . 33 Text and picture templates . 33 Manage distribution lists . 33 Text message counter . 34 Multimedia messages . 34 Delete messages. 37 E-mail messages . 38 Instant messaging . 40 Voice messages . 44 Info messages. 45 Message settings . 45 Settings for e-mail. 46 Font size setting. 47 Service commands . 48 Call register . 49 Recent calls lists . 49 Timers and counters. 49 Contacts . 51 Contacts settings . 51 Add contacts . 51 Search for a contact . 52 Delete contacts . 53 Edit or delete details in contacts . 53 My presence . 54 Copy contacts. 56 8 9
[ ii ]
6820.ENv1_9310322.book Page iii Wednesday, October 15, 2003 1:43 PM Send and receive business cards . 56 Speed dial. 57 Voice dial . 57 save numbers on the SIM card . 58 Caller groups . 59 10 Settings. 60 Profiles . 60 Chat and my presence settings . 60 Tone settings . 61 Display settings . 61 Time and date settings . 62 Personal shortcuts . 63 Connectivity . 63 EGPRS modem settings . 67 Call settings . 67 Phone settings . 68 Enhancement settings. 69 Security settings . 69 Restore factory settings . 71 11 Gallery. 72 12 Camera . 74 Camera settings . 74 Take a photo. 74 Record a video clip . 75 13 Organizer. 76 Alarm clock . 76 Calendar . 76 To-do list . 78 Notes . 78 Wallet . 79 Synchronization . 81 14 Applications . 84
[ iii ]
6820.ENv1_9310322.book Page iv Wednesday, October 15, 2003 1:43 PM Games . 84 Applications . 85 Extras . 86 15 Services . 89 Main steps for using services . 89 How to set up the phone for a service. 89 16 SIM services . 95 17 PC Connectivity. 96 PC Suite . 96 Data communications applications . 97 18 Enhancements. 98 Safety . 98 Enhancements for your phone . 98 19 Reference Information. 100 Battery information . 100 Care and maintenance. 101 Traffic safety. 101 Operating environment . 101 Electronic devices . 102 Potentially explosive environments . 103 Vehicles. 103 Emergency calls . 104 20 Technical information . 106 21 Nokia One-Year Limited Warranty. 107 Appendix A Message from the CTIA. 113 Appendix B Message from the FDA . 117 Index . 123
[ iv ]
6820.ENv1_9310322.book Page 1 Wednesday, October 15, 2003 1:43 PM For your safety Read these simple guidelines. Not following them may be dangerous or illegal. Read the complete user guide for further information. SWITCH ON SAFELY Do not switch the phone on when wireless phone use is prohibited or when it may cause interference or danger. ROAD SAFETY COMES FIRST Obey all local laws. Always keep your hands free to operate the vehicle while driving. Your first consideration while driving should be road safety. INTERFERENCE All wireless phones may be susceptible to interference, which could affect performance. SWITCH OFF IN HOSPITALS Follow any restrictions. Switch the phone off near medical equipment. SWITCH OFF IN AIRCRAFT Follow any restrictions. Wireless devices can cause interference in aircraft. SWITCH OFF WHEN REFUELING Dont use the phone at a refueling point. Dont use near fuel or chemicals. SWITCH OFF NEAR BLASTING Follow any restrictions. Dont use the phone where blasting is in progress. USE SENSIBLY Use only in the normal position as explained in the product documentation. Dont touch the antenna unnecessarily. QUALIFIED SERVICE Only qualified personnel may install or repair this product. ENHANCEMENTS AND BATTERIES Use only approved enhancements and batteries. Do not connect incompatible products. ENHANCEMENTS Use only approved enhancements. Do not connect incompatible products. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 2 Wednesday, October 15, 2003 1:43 PM WATER-RESISTANCE Your phone is not water-resistant. Keep it dry. BACK-UP COPIES Remember to make back-up copies or keep a written record of all important information stored in your phone. CONNECTING TO OTHER DEVICES When connecting to any other device, read its user guide for detailed safety instructions. Do not connect incompatible products. EMERGENCY CALLS Ensure the phone is switched on and in service. Select End as many times as needed to clear the display and return to the main screen. Enter the emergency number; then select Send. Give your location. Do not end the call until given permission to do so.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 3 Wednesday, October 15, 2003 1:43 PM Nokia 6820 phone at a glance Earpiece Earpiece Power key Power key Camera lens Camera lens Loudspeaker Loudspeaker Display screen Display screen Left Left selection key selection key Four-way joystick Talk key Talk key Charger port Charger port Infrared (IR) port Infrared (IR) port Right selection key Right selection key End key End key Keypad Keypad Microphone Microphone Pop-Port connector Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 4 Wednesday, October 15, 2003 1:43 PM Quick Guide Make a call Answer a call Answer call during call End a call Decline a call Mute a call Redial Adjust call volume Use the in-call menu Save a name and number Use 1-touch dialing Look up a name Check voice mail Write and Send a text message Send a picture, video, or audio file Read a new message Reply to a message Press Press and hold Enter a phone number, and press the Talk key. Press the Talk key, or select Answer. Press the Talk key. Press the End key. Press the End key (sends the call to voice mail, if available). Select Mute during a call. Press the Talk key twice. Press the joy stick to the left or the right. Select Options during a call. Enter a number, select Save, enter a name, and select OK. Press and hold a key (28). You must first assign a key to a number in the phone book. Select Names > Search. Press and hold the 1 key (contact your service provider for details). Select Menu > Messages > Text Message > Create Message. Write the message, select Send, enter the phone number, and select OK. Select Menu > Gallery. Select a folder and locate the item you wish to send. Select Options > Send. Enter the number and select OK. If New Message appears, select Read, highlight the message, and select Read again. While viewing a message, select Options > Reply. Write a reply, and select Options > Send. Press a key briefly and release it. Press a key, hold it for two to three seconds, and release it.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 5 Wednesday, October 15, 2003 1:43 PM Welcome to Nokia 1 Welcome to Nokia Congratulations on your purchase of the Nokia 6820 mobile phone.
ABOUT YOUR PHONE The Nokia 6820 phone comes in two model typesthe Nokia 6820a phone and the Nokia 6820b phone. The Nokia 6820a phone is approved for use in use in GSM 900, 1800, and 1900 networks. The Nokia 6820b phone is approved for use in GSM 850, 1800, and 1900 networks. To view your model type, refer to the information label under the battery. For for more information about where this label is located, see Find the information label on page 11.
OVERVIEW OF PHONE FUNCTIONS Your Nokia 6820 phone provides many useful functions, such as the calendar, clock, alarm clock, and built-in camera. Your phone also has the following features:
Messaging keyboardprovides a complete keyboard designed for easy text writing. With the keyboard closed, you can use all of the phone functions. When you open the keyboard, you have a full messaging keyboard. Speakerphoneallows you to activate the loudspeaker during a call. To activate the speakerphone, select Loudsp. To deactivate the speakerphone during a call, select Handset. EDGE (enhanced data rates for GSM evolution)allows you to use EDGE packet transmission networks for faster connections than GPRS. XHTML browserallows you to retrieve and view colorful and rich graphical content from web servers. Instant messaginglets you send short text messages that are immediately delivered to online users. Presence-enhanced messaginglets you share your availability information with colleagues, family, and friends. E-maillets you write, send, and retrieve e-mail from your e-mail account. MMS (multimedia messaging service)lets you send and receive multimedia messages containing text, pictures, sound or video clips to and from compatible devices. You can save the pictures and ringing tones for your phone. GPRS (general packet radio service)allows your phone to send and receive data over a mobile network. Applications such as WAP, MMS and SMS messaging, and Java may use GPRS. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 6 Wednesday, October 15, 2003 1:43 PM Polyphonic soundconsists of several sound components that are played at the same time. The phone has sound components from over 40 instruments and can play up to 16 instruments at the same time. The phone supports scalable polyphonic MIDI (SP-MIDI) format. J2METM (Java 2 Micro Edition) supportlets you play the included Java applications and games and supports many applications and games that you can download. OTA (over-the-air) settings serviceallows you to receive WAP, MMS, GPRS and other wireless service settings directly as an OTA message. You only need to save the settings on your phone. For more information on the availability of the settings, contact your network operator, service provider or the nearest authorized Nokia dealer.
REGISTER YOUR PHONE Make sure to register your phone at www.warranty.nokiausa.com or 1-888-NOKIA-2U
(1-888-665-4228). From time to time, Nokia updates this user guide to reflect changes. The latest version may be available at www.nokia.com/us. Also, an interactive tutorial may be available at www.nokiahowto.com.
NETWORK SERVICES The Nokia 6820 phone supports WAP 2.0 protocols (HTTP and SSL) that run on TCP/IP protocols. Some features of this phone, such as MMS, browsing, e-mail, IM (instant messaging), presence-enhanced contacts, remote SyncML, and content downloading using the browser or over MMS, require network support for these technologies. Note: Only devices that offer compatible multimedia message or e-mail features can receive and display multimedia messages. Multimedia message objects may contain viruses or otherwise be harmful to your device or PC. Do not open any attachment if you are not sure of the trustworthiness of the sender. A number of features included in this guide are network services. These are special services that you arrange through your wireless service provider. Before you can take advantage of these network services, you must subscribe to them through your service provider and obtain instructions for their use from your service provider. Note: Some networks may not support all language-dependent characters and/or services.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 7 Wednesday, October 15, 2003 1:43 PM Welcome to Nokia
ACCESSIBILITY SOLUTIONS Nokia is committed to making mobile phones easy to use for all individuals. Nokia maintains an Internet site that is dedicated to accessibility solutions. For more information about phone features, enhancements, alternate format user guides, and other Nokia products designed with your needs in mind, visit the Website at www.nokiaaccessibility.com or call 1-888-665-4228. This user guide is available in alternate formats, such as braille, large print, audiocassette, and e-text (documents on disk, in Microsoft Word or WordPerfect format).
SHARED MEMORY The following features in this phone may share memory: contacts, text, IM and multimedia messages, e-mails, voice tags and SMS distribution lists, images, ringing tones, video and sound clips in gallery, camera, calendar, to-do notes, Java games, applications, and the notes feature. Using these features may reduce the memory available for other features sharing memory. This is especially true with heavy use of any of the features (although some of the features may have a certain amount memory specially allotted to them in addition to the amount of memory shared with other features). For example, saving many images may take all of the shared memory and your phone may display a message that the memory is full. In this case, delete some of the information or entries stored in the shared memory features before continuing. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 8 Wednesday, October 15, 2003 1:43 PM 2 Phone setup
CONNECTORS 1 2 3 Connector for battery charger Pop-PortTM connector for headsets, data cable and other accessories. Connector for microphone
INSTALL SIM CARD AND BATTERY Keep all SIM cards out of the reach of small children. For availability and information on using SIM card services, contact your SIM card vendor. This may be the service provider, network operator, or other vendor. The SIM card and its contacts can be easily damaged by scratches or bending, so be careful when handling, inserting, or removing the card. Before installing the SIM card, always make sure that the phone is switched off and disconnected from any enhancement; then remove the battery. 1 With the back of the phone facing you, push the back cover release button (1) and, at the same time, lift the back cover off the phone
(2). 2 Slide the battery into the cover (3) until you hear it click into place.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 9 Wednesday, October 15, 2003 1:43 PM Phone setup 3 4 5 To release the SIM card holder, slide the card holder backwards (4), and open it by lifting it up (5). Insert the SIM card into the SIM card holder (6). Make sure that the SIM card is properly inserted and that the golden contact area on the card is facing downwards. Close the SIM card holder (7) and slide it back into place (8). 6 Direct the back cover towards the locking catches on the front cover (9), and slide the back cover until it locks into place (10). Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 10 Wednesday, October 15, 2003 1:43 PM
CHARGE THE BATTERY 1 2 Connect the lead from the charger to the socket on the bottom of your phone. Connect the charger to a wall socket. Charging is displayed briefly if the phone is switched on. If the battery is completely discharged, it may take a few moments before the charging indicator appears on the display or before any calls can be made. You can use the phone while the charger is connected. Charging time depends on the charger and the battery used. For example, charging a BL-5C battery with the ACP-12 travel charger takes about 1hour and 26 minutes while the phone is in the standby mode.
SWITCH THE PHONE ON AND OFF Warning: Do not switch the phone on when wireless phone use is prohibited or when it may cause interference or danger.
To switch on the phone, select and hold the Power key.
If the phone prompts you for a PIN code or a security code, key in the code and select OK. If the phone displays Insert SIM card, even though the SIM card is properly inserted, or SIM card not supported, contact your network operator or service provider. Your phone does not support 5-V SIM cards and the card may need to be changed.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 11 Wednesday, October 15, 2003 1:43 PM Phone setup
HOW TO HOLD YOUR PHONE Hold the phone as shown. TIPS ON EFFICIENT OPERATION: Your phone has a built-in antenna. As with any other radio transmitting device, do not touch the antenna unnecessarily when the phone is switched on. Contact with the antenna affects call quality and may cause the phone to operate at a higher power level than otherwise needed. Not touching the antenna area during a phone call optimizes the antenna performance and the talk time of your phone.
HOW TO GET HELP If you need help, Nokia Customer Care is available for assistance. Find the information label We recommend that you obtain the label information so it can be available if you call. This information is on the back of the phone, beneath the battery.
The international mobile equipment identity
(IMEI) The phone model type.
Information label Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 12 Wednesday, October 15, 2003 1:43 PM Contact Nokia Please have your phone or enhancement with you when place the call. Nokia Customer Care Center, USA Nokia Inc. 7725 Woodland Center Boulevard Suite 150 Tampa, Florida 33614 Tel:1-888-NOKIA-2U
(1-888-665-4228) Fax: 1-813-249-9619 TTY: 1-800-24-NOKIA (hearing impaired only) (1-800-246-6542) Customer Care Center, Canada Nokia Products Ltd. 601 Westney Road South Ajax, Ontario L1S 4N7 Tel:
Fax: 1-905-427-1070 1-888-22-NOKIA
(1-888-226-6542)
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 13 Wednesday, October 15, 2003 1:43 PM Phone basics 3 Phone basics Your phone can be used with the keyboard closed or the keyboard open.
OPEN THE KEYBOARD 1 Hold the phone with both hands, and open the keyboard as shown. 2 Extend the keyboard until you hear it click into place. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 14 Wednesday, October 15, 2003 1:43 PM 3 Turn the phone to a horizontal position and hold is as shown.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 15 Wednesday, October 15, 2003 1:43 PM
KEY FUNCTIONS (KEYBOARD CLOSED) Phone basics 1 2 3 4 5 6 7
) and right
)becomes Left selection key when Power key (
)switches the phone on and off. When the keypad is locked, it turns the phone display lights on for about 15 seconds. Left selection keyKeyboard open
the keyboard is open. This key has no function when the keyboard is closed. Left selection key (
selection key (
)provides a variety of functions that are indicated in guiding text on the display above the keys. Four-way joystick (
)moves in four directions and selects the active menu option when pressed. For details, see About the four-way joystick on page 17. Send key (
)Dials a phone number and answers a call. In the standby mode it accesses the list of most recently called numbers. End key (
exits from the current function. Typing keysenters numbers and characters.
)ends an active call or Note: Some phones may not display the Internet symbol on the (0) key. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 16 Wednesday, October 15, 2003 1:43 PM
KEY FUNCTIONS (KEYBOARD OPEN) When the keyboard is opened, the display graphics rotate 90 degrees and the Left, Middle, and Right selection keys change positions. The guiding text above the Left and Right selection keys does not change.
)switches the keyboard light on or off to provide additional 1 2 3 4 5 6 7 8 9
)switches the phone on and off.
)deletes characters.
)opens a set of characters and Keyboard light key (
lighting. Power key (
Four-way joystick (
)moves in four directions and selects the displayed menu option. (See illustration.) Backspace key (
Character key (
symbols during text writing. Shift keys (
letters and symbols. You can either press the Shift key first and then the desired key or press both keys at the same time. Space bar keys (
Send key (
the list of most recently called numbers. Left selection key (
in the guiding text displayed above the key.
) and Right selection key (
)enters upper case
)enters a space. and and
)dials a phone number and answers a call. In the standby mode it shows
)selects the menu option shown 10 End key (
11 Enter key (
)ends an active call or exits from a function.
)starts a new line when writing text.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 17 Wednesday, October 15, 2003 1:43 PM
ABOUT THE FOUR-WAY JOYSTICK Phone basics The four-way joystick provides a variety of functions:
Moves the cursor up and down, right and left when writing text, using the calendar, Allows you to scroll through lists. and in some game applications. Selects the active menu item when pressed briefly (or confirms a selection). Adjusts the volume when moved to the left (to decrease volume) or to the right (to increase volume) during a call. Activates the camera when pressed moved up in the standby mode. Opens the text editing screen to write a text message when moved to the left in the standby mode. Opens the calendar when moved to the right in the standby mode. Opens the contacts list when moved down in the standby mode.
THE STANDBY MODE When the phone is ready for use (the keyboard can be either closed or open), and you have not keyed in any characters, the phone is in the standby mode. Note: For descriptions of the screen icons, see Icons in the standby mode on page 19. 1 Networkshows the name of the network or the operator logo to indicate in which cellular network the phone is currently being used. Signal strengthshows the signal strength of the cellular network at the current location. The higher the bar, the stronger the signal. Battery chargeshows the battery charge level. The higher the bar, the more power in the battery Go to optionshows the Left selection key menu option. 5 Menu optionshows the joystick menu option. 6 Names optionshows the Right selection key menu option. The default is Names, which accesses the Contacts menu. This option may also be an operator specific key or an option you have set up for the Right selection key. For more information see Personal shortcuts on page 63.
2 3 4 Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 18 Wednesday, October 15, 2003 1:43 PM
CUSTOMIZE THE GO TO MENU Use these steps to customize the Go to menu. 1 select Go to to view the list of available functions that you can add to your personal shortcut list. select Options and select from the following options:
Select optionsto view the list of functions you can add. Scroll to the desired function and select Mark to add it to the shortcut list. To remove a function from the list, select Unmark. Organizeto rearrange the functions on the list. Select the desired function and select Move; then select the location where you want to move the function. If you unintentionally deleted content from the Go to menu, select Add to add a function. 2 3
SWITCH THE KEYBOARD LIGHTS ON OR OFF When you open the keyboard, the main display is lit, but the keyboard lights do not automatically illuminate. To turn on the keyboard lights, press the Keyboard light key
, located on the top left corner of the keyboard. The keyboard lights are switched off after a certain time, but they are turned on again as soon as you press any key. To switch the keyboard lights off, press the Keyboard light key or close the keyboard. Screensaver With the keyboard closed, the phone automatically activates a screensaver while in the standby mode. This occurs after a certain length of time when none of the phone functions have been used. For more information on the display, see Display settings on page 61. Wallpaper You can set your phone to display a background picture as wallpaper when the phone is in the standby mode. For information on customizing your wallpaper, see Display settings on page 61.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 19 Wednesday, October 15, 2003 1:43 PM Icons in the standby mode Icon Indicates... Icon Indicates... Phone basics You have one or more new text or picture messages. The EGPRS connection is suspended (on hold). You have one or more new multimedia messages. There is an active IR connection. or Your phone is connected to the IM service and the availability status is online or offline, respectively. Your calls are diverted to another number. If you have two phone lines, the divert icon for the first line is and for the second line is
. You have one or more IM messages and you are connected to the IM service. or The selected phone line (only appears if you have two phone lines). The phone keypad is locked. The loudspeaker is activated. The phone will not ring for an incoming call or a text message because Incoming call alert and Message alert tone are set to Off. Calls are limited to a closed user group. See Security settings on page 69. The alarm clock is set to On. The timed profile is selected. The countdown timer is running. The stopwatch is running in the background. The EGPRS connection mode is set to Always online and EGPRS service is available. An EGPRS connection is active. A headset enhancement is connected to the phone. A hands-free enhancement is connected to the phone. A loopset enhancement is connected to the phone. A music stand enhancement is connected to the phone. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 20 Wednesday, October 15, 2003 1:43 PM Icons in the standby mode Icon Indicates... You have one or more new text or picture messages. You have one or more new multimedia messages. or Your phone is connected to the IM service and the availability status is online or offline, respectively. You have one or more IM messages and you are connected to the IM service. The phone keypad is locked. The phone will not ring for an incoming call or a text message because Incoming call alert and Message alert tone are set to Off. The alarm clock is set to On. The countdown timer is running. The stopwatch is running in the background. The EGPRS connection mode is set to Always online and EGPRS service is available. An EGPRS connection is active. The EGPRS connection is suspended (on hold). There is an active IR connection. Your calls are diverted to another number. If you have two phone lines, the divert icon for the first line is and for the second line is
. or The selected phone line (only appears if you have two phone lines). The loudspeaker is activated.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 21 Wednesday, October 15, 2003 1:43 PM Icon Indicates... Calls are limited to a closed user group. See Security settings on page 69. Phone basics The timed profile is selected. A headset enhancement is connected to the phone. A hands-free enhancement is connected to the phone. A loopset enhancement is connected to the phone. A music stand enhancement is connected to the phone.
KEYPAD LOCK (KEYGUARD) The keyguard feature locks the keypad to prevent the keys from being accidentally pressed. You can lock the keypad only when the keyboard is closed. Security keyguard is an additional feature that allows you to set up a code to unlock your phone before use. For information on security keyguard, see Phone settings on page 68. Note: When keyguard is on, calls may be possible to the emergency number programmed into your phone. Key in the emergency number and press the Send key
. The number is displayed only after you have keyed in its last digit. LOCK THE KEYPAD
In the standby mode, select Menu; then press the * key within 1.5 seconds. To lock the keypad during a call, select Options > Lock Keypad. To answer a call when keyguard is on, press the End key. During the call, the phone can be operated normally. When you end or reject the call, the keypad automatically locks. UNLOCK THE KEYPAD Select Unlock; then press the * key within 1.5 seconds, or open the keyboard. The keyguard does not automatically reactivate when you close the keyboard. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 22 Wednesday, October 15, 2003 1:43 PM
OVER-THE-AIR SETTINGS SERVICE To use wireless services such as MMS and EGPRS, you need to have proper connection settings on your phone. You may obtain the settings directly as an OTA message, and save them on your phone. For more information on the availability of the settings, contact your network operator, service provider, or the nearest authorized Nokia dealer. You may be able to receive the connection settings for EGPRS, multimedia messages, synchronization, IM and presence, e-mail, and multi-mode browser. When you have received the connection settings as an OTA message, Connection settings received is displayed.
To save the settings, select Options > Save. If the phone prompts you to enter the PIN code for the settings, key in the PIN code and select OK. To obtain the PIN code, contact the service provider that supplies the settings. If no settings have been saved yet, the settings are saved under the first free connection set. To view the received settings first, select Options > View. To save the settings, select Save. To discard the received settings, select Options > Discard.
To activate the settings, see Connect to a service on page 90.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 23 Wednesday, October 15, 2003 1:43 PM Call functions 4 Call functions
MAKE A CALL You can make a call with the keyboard open or closed. If you open the keyboard, the louspeaker automatically activates. Enter the phone number 1 Key in the phone number, including the area code. If you key in an incorrect character, select Clear to delete it. To make a call when the keyboard is open, key in the phone number using the number keys. For international calls, press the * key twice for the international prefix or, if the keyboard is open, press +. (The + character replaces the international access code.) Then key in the country code, the area code (without the leading 0), if necessary, and the phone number. Press the Send key to call the number. Press the End key to end the call or to cancel the call attempt. 2 3 Note: To adjust the volume during a call, move the joystick to the right to increase the volume or to the left to decrease the volume. Select Names > Search and select a name from the list. Choose a phone number for the contact and press the Send key. Press the End key to end the call or to cancel the call attempt. For more information, see Active call options on page 25. Use the contact list 1 2 3 To search for a name/phone number that you have saved in Contacts, see Search for a contact on page 52. Last number redial In the standby mode, press the Send key once to access the list of the last 20 numbers you called or attempted to call. Scroll to the number or name that you want, and press the Send key to call the number. Call your voice mailbox In the standby mode when the keyboard is closed, press and hold the 1 key, or press the 1 key, then the Send key. When the keyboard is open, press and hold the corresponding number key on the keyboard. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 24 Wednesday, October 15, 2003 1:43 PM If you are prompted to supply a voice mailbox number, key it in and select OK. See also Voice messages on page 44. Speed dial a phone number Before you can use speed dialing you need to assign speed dial numbers. For more information, see Speed dial on page 57. If Speed dialing is set to off, press the speed dialing number and then press the Send key. If Speed dialing is set to on, press and hold a speed dialing key until the call is started. Note: To activate speed dialing, select Menu > Settings > More Settings > Call settings > Speed dialing > On.
ANSWER OR REJECT AN INCOMING CALL Press the Send key to answer an incoming call, and press the End key to end the call. Press the End key to reject an incoming call. If you select Silence, only the ringing tone is muted. Then, either answer or reject the call. If a compatible headset with the headset key is connected to the phone, you can answer and end a call by pressing the headset key. If the Divert if busy function has been activated to divert the calls, for example to your voice mailbox, rejecting an incoming call will also divert the call. See Call settings on page 67 Caller ID When there is an incoming call, the phone shows the callers name, phone number, or the text Private number or Call. If more than one name is found in Contacts with the same seven last digits of the phone number as the callers number, only the phone number will be displayed (if it is available). If the callers number has not been saved in Contacts, but there is another name saved with the same seven last digits in the phone number as in the phone number of the caller, the phone may display an incorrect name. Call waiting During a call, press the Send key to answer the waiting call. The first call is put on hold. Press the End key to end the active call. To activate call waiting, see Call settings on page 67.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 25 Wednesday, October 15, 2003 1:43 PM
ACTIVE CALL OPTIONS Call functions Many of the options during a call are dependent on network services. For availability, contact your network operator or service provider. When you select Options during a call, you can select one of the following basic options:
Lock keypad, Record, End call, New call, End all calls, Contacts, Menu, Mute or Unmute, Hold or Unhold, Private, Answer and Reject. The following options are also available:
Conferenceallows you to make a conference call that allows up to five people to take part in a conference call. During a call, make a call to a new participant (New call). The first call is put on hold. When you have answered the new call, select Conference to include the first participant in the call. To have a private conversation with one of the participants, select Private and select the participant. To rejoin the conference call after a private conversation, select Conference. Send DTMFsends DTMF (dual tone multifrequency) tone strings, such as passwords or bank account numbers. The DTMF system is used by all touch-tone telephones. Key in the DTMF string, or search for it in contacts. You can key in the wait character (w) and the pause character (p) by repeatedly pressing the * key. Swapswitches between the active call and the call on hold, Transfer to connect a call on hold to an active call and to disconnect yourself from the calls. Loudspeakeractivates the loudspeaker during a call. Do not hold the phone to your ear during loudspeaker operation. To activate the loudspeaker, open the keyboard or, if the keyboard is closed, select Options > Loudspeaker or select Loudsp., if available. During a call with the keyboard open, you can select Handset to deactivate the loudspeaker or close the keyboard. When the keyboard is closed, select Options > Handset or select Handset, if available to deactivate the loudspeaker. The loudspeaker is deactivated automatically when you end a call (or a call attempt), when you connect a compatible hands-free unit or a headset to the phone, or when you close the keyboard. If you have connected a compatible hands-free unit or a headset to the phone, the Handset option is replaced with Handsfree or Headset and the selection key Handset is replaces with Handsfr. or Headset respectively. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 26 Wednesday, October 15, 2003 1:43 PM 5 Text Entry Your phone is specifically designed for easy and comfortable text writing. The easiest way is to write with your thumbs using the messaging keyboard. You can, for example, start writing a message using the keyboard, close the keyboard and continue writing with either traditional or predictive text input. Predictive text input is not available when the keyboard is open.
WRITE TEXT WITH KEYBOARD OPEN When the keyboard is open, you can start to write a message in several ways.
Select Menu > Messages > Text messages > Create message. To quickly start writing a message, move the joystick to the left in the standby mode. Press any of the letter keys in the standby mode (except the pause character p or the waiting character w) to open Notes.
, or
AVAILABLE FUNCTIONS The following functions are available when writing text with the keyboard open:
To insert a number, press a number key. (If you pressing a number key in the standby mode, it initiates a normal call procedure.) To switch between the lower and upper case, indicated by on the top left of the display, or to key in symbols, press the Shift keys on the keyboard. You can either press a Shift key and the desired character consecutively, or press and hold a Shift key and the desired letter key at the same time. To write in upper case only, press one of the Shift keys twice. To delete characters from the display, press the Backspace key or select Clear. Press the Backspace key briefly to clear one character at a time. Use a longer keypress to delete characters more quickly. To add a space, press one of the Space keys at the bottom of the keyboard. To create a line break, press the Enter key.
TYPING ACCENTED CHARACTERS The characters available depend on the language selected in the Phone language menu. To type accented characters or symbols that are not printed on the keyboard, do one of the following:
To access a set of punctuation marks, accented characters, and symbols, press the Character key. Scroll through the character set by moving the joystick, and select Use to enter the selected character. To type an accented character that is not included in the list of special characters under the Character key, such as , press and hold the Character key and simultaneously
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 27 Wednesday, October 15, 2003 1:43 PM press a repeatedly until the desired accented variant of a appears on the display.
WRITE TEXT WITH KEYBOARD CLOSED Text Entry and traditional text input by
, You can use predictive or traditional text input when the keyboard is closed. During writing, predictive text input is indicated by on the top left of the display. You can change the character case, indicated by or
, by pressing the # key. The number mode is indicated by
, and you can change between the letter and number modes by pressing and holding the # key. Set predictive text on or off When writing text, select Options > Dictionary. To set the predictive text input on, select a language from the dictionary options list. Predictive text input is only available for the languages on the list. To revert to traditional text input, select Dictionary off. To quickly set the predictive text input on or off when writing text, press the # key twice, or press and hold Options. Predictive text You can key in any letter with a single keypress. Predictive text is based on a built-in dictionary to which you can also add new words. For more instructions for writing text, see Tips for writing text on page 28. 1 Start writing a word using the 29 keys. Press each key once for one letter. The word may change after each keystroke. For example, to write Nokia with the English dictionary selected, press the 6 key once for N, the 6 key once for o, the 5 key once for k, the 4 key once for i, and the 2 key once for a. To insert a number while in letter mode, press and hold the desired number key. 2 When you have finished writing the word and it is correct, confirm it by pressing the 0 key to add a space or by moving the joystick to the right. If the word is not the one you are looking for, press the * key repeatedly or select Options > Matches. 4 When the word you want appears, confirm it. If the ? character appears after the word, the word that you intended to write is not in the dictionary. To add a word to the dictionary, select Spell, key in the word (traditional text input is used) and select Save. When the dictionary becomes full, the new word replaces the oldest one that was added. Start writing the next word. 3 5 6 Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 28 Wednesday, October 15, 2003 1:43 PM COMPOUND WORDS Key in the first part of the word and confirm it by moving the joystick to the right. Write the last part of the word and confirm it by moving the joystick to the right. Traditional text input Press a number key 19, repeatedly until the desired character appears. Not all characters available under a number key are printed on the key. The characters available depend on the language selected in the Phone language menu. To insert a number while in letter mode, press and hold the desired number key.
If the next letter you want is located on the same key as the present one, wait until the cursor appears, or move the joystick to the right, and then key in the letter. The most common punctuation marks and special characters are available under the 1 key.
Tips for writing text The following functions may also be available for writing text in predictive or traditional input:
To insert a space, press the 0 key. To move the cursor to the right, left, up or down, move the joystick respectively. To delete a character from the display, select Clear. Press and hold Clear to delete the characters more quickly. To delete all the characters simultaneously when writing a message, select Options >
Clear text. To insert a word that is not in the dictionary when using predictive text input, select Options > Insert word. Write the word using traditional text input and select Save. The word is also added to the dictionary. To insert a special character when using traditional text input, press the * key or when using predictive text input, press and hold the * key, or select Options > Insert symbol. Move the cursor with the joystick to a character, and select Use to select it. You can also scroll to a character by pressing the 2, 4, 6, and 8 keys, and select it by pressing the 5 key.
The following options are available when writing text messages:
To insert a phone number while in letter mode, select Options > Insert number. Key in the number or select Search to search for it in Contacts. When done, select OK. To insert a name from Contacts, select Options > Insert contact. To insert a phone number or a text item attached to the contact name, select Options > View details.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 29 Wednesday, October 15, 2003 1:43 PM The menu 6 The menu Your phone offers you an extensive range of functions that are grouped into menus. Most of the menu functions include Help text. To view the Help text, scroll to the menu function you want and wait 15 seconds. To exit the help text, select Back. You can view the main menu as a grid of icons or in list view. To change the menu view, see Display settings on page 61
SCROLL TO A MENU FUNCTION 1 2 3 4 5 6 To access the menu, select Menu. Scroll through the menu by moving the joystick up or down (or right and left if the grid menu is selected), and press the joystick to select a highlighted menu item. If the menu contains submenus, select the one you want. If the selected submenu contains further submenus, repeat step 3. Select the setting of your choice. Select Back to return to the previous menu level, and Exit to exit the menu.
USE A SHORTCUT TO ACCESS A MENU FUNCTION The menus, submenus, and setting options are numbered, and you can access most of them by using their shortcut numbers. The shortcut numbers are located in the upper corner of each menu. Select Menu; then within 2 seconds, press the number key or keys associated with the numbered menu function youd like to view or activate. To access menu functions in menu 1, press Menu-1 and then key in the rest of the desired shortcut number. select Back to return to the previous menu level, and Exit to exit the menu. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 30 Wednesday, October 15, 2003 1:43 PM 7 Messages You can read, write, send, and save text, multimedia, and e-mail messages. All messages are organized in folders. Before you can send any text, picture or text (SMS) e-mail messages, you need to save your message centre number, see Message settings on page 45. The default setting of the multimedia message service is generally on. Note: When sending messages using the SMS network service, your phone may display Message sent. This is an indication that the message has been sent by your phone to the message centre number programmed into your phone. This is not an indication that the message has been received at the intended destination. For more details about SMS services, check with your service provider. The appearance of a multimedia message may vary depending on the receiving device.
TEXT MESSAGES (SMS) You can use SMS (Short Message Service) to send and receive multi-part messages that consist of several ordinary text messages. Invoicing is typically based on the number of ordinary messages that are required for a multi-part message. This feature requires network services. See your service provider for more information. Your phone allows you to send text messages beyond the normal 160-character limit. If your message exceeds 160 characters, it is sent as a series of two or more messages. In the navigation bar, you can see the message length indicator counting backwards from 160. For example, 10 (2) means that you can still add 10 characters for the text to be sent as two messages. Using special (Unicode) characters, such as , , , , takes up more space. If there are special characters in your message, the indicator may not show the message length correctly. Before the message is sent, the device tells you if the message exceeds the maximum length allowed for one message. You can cancel sending by pressing Cancel or you can save the message in the inbox You can also send and receive text messages that contain pictures. This feature must be supported by your network services or service provider. Only phones that offer picture message features can receive and display picture message. The text messages function uses shared memory. For more information, see Shared memory on page 7.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 31 Wednesday, October 15, 2003 1:43 PM Messages Select Menu > Messages > Text messages > Create message. Key in your message. To send the message, press the Send key. Enter the recipients phone number or search for it in Contacts, and select OK. Write and send a message In the standby mode, you can move the joystick to the left to start writing a message quickly. The number of available characters /the current part number of a multi-part message are shown on the top right of the display (such as 120/2). 1 2 3 4 Options when sending a message After you have written a message, select Options > Sending options to choose from the following options:
Send to manyto send a message to several recipients. When you have sent the message to all the intended recipients, select Done. Send to listto send a message using a distribution list. Sending profileto send a message using a message profile. Write and send SMS e-mail Before you can send an e-mail using SMS, you need to save the settings for sending e-mail. For availability and subscription to the e-mail service, contact your network operator or service provider. 1 2 3 4 Select Menu > Messages > Text messages > Create SMS e-mail. Key in the recipients e-mail address or search for it in Contacts, and select OK. If you wish, you can key in a subject for the e-mail and select OK. Key in the e-mail message. The total number of characters that you can key in is shown on the top right of the display. The e-mail address and subject are included in the total number of characters. Also see Text and picture templates on page 33. Pictures cannot be inserted. To send the e-mail, press the Send key. If you have not saved the settings for sending e-mails, the phone asks for the number of the e-mail server. select OK to send the e-mail. 5 Note: When sending e-mails using the SMS network service, your phone may display the words Message sent. This is an indication that the e-mail has been sent by your phone to the e-mail server. This is not an indication that the e-
mail has been received at the intended destination. For more details about e-
mail services, check with your service provider. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 32 Wednesday, October 15, 2003 1:43 PM and the indicates that the message memory is full. Before you can receive Read and reply to SMS messages or SMS e-mail When you have received a message or an e-mail, the new message icon number of new messages followed by message(s) received is shown. The blinking icon new messages, delete some of your old messages from the Inbox folder. 1 2 Select Show to view the new message. You can also select Exit to view it later. Later, you can view the message by selecting Menu > Messages > Text messages > Inbox. If more than one message has been received, select the one that you want to read. An unread text message is indicated by in front of it. 3 While reading or viewing the message, you can select from a series of basic options, such as Delete, Forward, Edit (as a text message or an e-mail), Rename, or Move. You can also select one of the following options:
Copy to calendarto copy text from the beginning of the message to your calendar as a memo for the current day. Message detailsto view, if available, the senders name and phone number, the message centre used, and the date and time of receipt. Use detailto extract numbers, e-mail and Website addresses from the current message. Save picture(when viewing a picture message), to save the picture in the Templates folder. Select Reply to reply to a message. Select Original text to include the original message in the reply, or select a standard answer to be included in the reply, or select Empty screen. When replying to an e-mail, confirm or edit the e-mail address and subject first. Then write your reply message. Press the Send key to send the message to the displayed number. 5 Inbox and sent items folders The phone saves incoming text messages in the Inbox folder and sent messages in the Sent items folder of the Text messages submenu. Text messages that you wish to send later can be saved in the Archive, My folders or Templates folder. 4
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 33 Wednesday, October 15, 2003 1:43 PM
ARCHIVE FOLDER AND CUSTOM FOLDERS Messages To organize your messages, move them to the Archive folder or add new folders for your messages. While reading a message, select Options > Move and select the folder to which you want to move the message. To add or delete a folder, select Menu > Messages > Text messages > My folders.
To add a folder, select Options > Add folder. If you have not saved any folders, select Add to create one. To delete a folder, locate the folder that you want to delete and select Options > Delete folder.
TEXT AND PICTURE TEMPLATES Your phone includes text templates, indicated by
, and picture templates, indicated by
To access the template list, select Menu > Messages > Text messages > Templates.
To insert a text template into a message or an e-mail, select Options > Use template and select the template you want to insert. To insert a picture into a text message, select Options > Insert picture and select a picture to view it. Select Insert to insert the picture into your message. The icon in the header of the message indicates that a picture has been attached. The number of characters allowed in the message depends on the size of the picture. To view the text and the picture together before sending the message, select Options >
Preview.
MANAGE DISTRIBUTION LISTS If you send messages frequently to a fixed group of people, you can define and save distribution lists. The phone sends the message separately to each recipient on the list, so sending a message using a distribution list may cost more than sending a message to one recipient. Distribution lists use shared memory. For more information, see Shared memory on page 7. Make sure that each contact you want to add to the distribution lists is already set up in your phone. Use these steps to set up and name distribution lists. 1 In the standby mode, select Menu > Messages > Text messages > Distribution lists. If you have created distribution lists, the current list appears. If you have not yet created a list, Add appears. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 34 Wednesday, October 15, 2003 1:43 PM 2 3 4 2 To create a distribution list, select Add if its the first list, or select Options > Add for a new list. Key in a name for the list and select OK. To add names to the list, select the list; then select View > Add to open Contacts list. Select the desired contact. Use these steps to manage and edit lists. 1 Add Listto create a new list. Rename Listto change the name of a list. Clear Listto empty the list of names. Delete Listto delete the list entirely. To work with a list, select the list name and select Options; then choose from the following options:
To view the names on a list, locate the desired list and select View. Then choose from the following options:
To view the contact information for a recipient, locate the desired name, select Options > View details. To delete a recipient from the list, locate the desired name, select Options >
Delete contact.
If a message fails to be sent to one or more recipients in a distribution list, it is placed in the Undelivered folder. To view the messages, select Undelivered > Options > View list >
Delete list (to delete the Undelivered folder) > View message.
TEXT MESSAGE COUNTER The text message counter shows the number of sent and received text and picture messages. Picture messages may consist of more than one message. You can, for example, view the recipient or sender of the message or view the details of the message.
MULTIMEDIA MESSAGES A multimedia message can contain text, one image, sound clip, video clip or a slide. The phone supports multimedia messages that are up to 100 kB in size. If the maximum size is exceeded, the phone may not be able to receive the message. Depending on the network, you may receive a text message that includes an Internet address where you can view the multimedia message. If the message contains an image, the phone scales it down to fit the display area. Note: This function can be used only if it is supported by your network operator or service provider. Only phones that offer compatible multimedia message features can receive and display multimedia messages.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 35 Wednesday, October 15, 2003 1:43 PM The multimedia function uses shared memory. For more information, see Shared memory on page 7. Note: If Allow multimedia reception is set to Yes or In home network, your operator or service provider may charge you for each message you receive. Messages Multimedia messaging works with the following formats:
Picture: JPEG, GIF, WBMP, BMP, PNG, and OTA-BMP.
Sound: Scalable Polyphonic MIDI (SP-MIDI), AMR audio and monophonic ringing tones
Video clips in H.263 format with SubQCIF image size and AMR audio. The phone does not necessarily support all variations of the listed file formats. If a received message contains any unsupported elements, they may be replaced with the file name and the text Object format not supported. You cannot receive any multimedia messages if you have a call in progress, a game or another Java application running, or if you have an active browsing session over GSM data. Because delivery of multimedia messages can fail for a variety of reasons, do not rely solely upon them for essential communications. Your phone allows you to send and receive multimedia messages that contain several pages, or slides. To insert a slide into a message, select Options > Insert > Slide. Each slide can contain text, one image and one sound clip. To move the text part tot he top or bottom of the message, select Options > Text on top or Options > Text on bottom. Copyright protections may prevent some images, ringing tones, or other content from being copied, modified, transferred or forwarded. Write and send a multimedia message To define the settings for multimedia messaging, see Settings for multimedia messages on page 46. For information about subscribing to multimedia messaging services, contact your service provider. Copyright protections may prevent some images, ringing tones or other content from being copied, modified, transferred or forwarded. 1 2 Select Menu > Messages > Multimedia msgs. > Create message. Key in a message.
To add a file to the message, select Options > Insert. Select Image, Sound clip, Video clip, or Slide. The list of available folders in the Gallery menu is shown. Open the folder that contains the item you want to add to the message, locate the desired file, and select Options > Insert. You can also insert a slide to the message by selecting Options > Insert > Slide.
An attached file is indicated by the file name in the message. To insert a name from Contacts, select Options > More options > Insert contact, and 3 Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 36 Wednesday, October 15, 2003 1:43 PM 4 5 6 7 8 select the desired name. To insert a number, select Options > More options > Insert number. Key in the number or search for it in Contacts, and select OK. To view the message before sending it, select Options > Preview. Press the Send key to send the message, or select Options > Send to e-mail or Send to many. Enter the recipients phone number (or e-mail address) or search for it in Contacts. Select OK. It takes more time to send a multimedia message than a text message. While the multimedia message is being sent, the animated icon other functions on the phone. If there is an interruption while the message is being sent, the phone makes a few more attempts to send it. If this fails, the message remains in the Outbox folder and you can try to send it later. Sent messages are saved in the Sent items folder if the setting Save sent messages is set to Yes. (See Settings for multimedia messages on page 46.) This is not, however, a confirmation that the message has been received at the intended destination. is displayed and you can use is displayed. Read and reply to a multimedia message When your phone is receiving a multimedia message, the animated icon When the message has been received, the icon received are shown. The blinking icon Multimedia messages memory full on page 37. The multimedia message function uses shared memory. For more information, see Shared memory on page 7. 1 indicates that the memory for multimedia messages is full, see and the text Multimedia message Select Show to view the message, or select Exit to view it later.
(To read the message later, select Menu > Messages > Multimedia msgs. > Inbox.) The function of the middle selection key changes according to the displayed object. Choose from the following:
To reply to the message, select Reply. To delete an object contained in the message, select Delete. Otherwise, select Options > Delete message. To listen to a sound clip or view a video clip contained in the message, select Play. To zoom in on an attached image, select Zoom.
If you select Options, some of the following options are available:
Delete messagedeletes a saved message. Reply or Reply to alllets you reply to the message. Use detailextracts phone numbers, e-mail or web addresses from the message. 2
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 37 Wednesday, October 15, 2003 1:43 PM Messages Forward to no., Forward to e-mail or Send to manyforwards the message. Editedits a message that you have written. Message detailsdisplays the subject, size and class of the message. Detailsdisplays the details of the attached image or sound. Play presentationdisplays the presentation attached in the message. Save image, Save sound clip or Save video clipsaves the file in the Gallery. Inbox, Outbox, Saved and Sent items folders The phone saves multimedia messages that have been received in the Inbox folder of the Multimedia msgs. submenu. Multimedia messages that are waiting to be sent are stored in the Outbox folder of the Multimedia msgs. submenu. Multimedia messages that you wish to save and send later can be saved in the Saved items folder of the Multimedia msgs. submenu. Multimedia messages that have been sent are saved in the Sent items folder of the Multimedia msgs. submenu, if the setting Save sent messages is set to Yes. (For for information see Settings for multimedia messages on page 46.) MULTIMEDIA MESSAGES MEMORY FULL When you have a new multimedia message waiting and the memory for the messages is blinks and Multimedia memory full, view waiting msg. is shown. To view full, the icon the waiting message, select Show. To save the message, select Save and delete old messages by first selecting the folder and then the message to be deleted. To discard the waiting message, select Exit > Yes. If you select No, you can view the message.
DELETE MESSAGES To delete text messages, select Menu > Messages > Text messages > Delete messages. Then choose from the following options:
All messagesto delete all messages from all folders. If there are unread messages, the phone prompts you to confirm yo want to delete these also. Inboxto delete all messages in the Inbox. Sent itemsto delete all messages in the Sent folder. Archiveto delete all messages in the Archive folder. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 38 Wednesday, October 15, 2003 1:43 PM
E-MAIL MESSAGES The e-mail features allow you to access your e-mail account using your phone. The compatible e-mail application that you use in the office or at home may be supported by the e-mail function on your phone. Your phone supports POP3 and IMAP4 e-mail servers. The e-mail function uses shared memory. For more information, see Shared memory on page 7. Note: When sending e-mail, your phone may display the words Message sent. This is an indication that the e-mail has been sent by your phone to the e-mail server. This is not an indication that the e-mail has been received at the intended destination. For more details about e-mail services, check with your service provider. Before you can send and retrieve any e-mails, you may need to do the following:
Obtain an e-mail account. For availability of your e-mail account contact your e-mail service provider. For the settings required for e-mail, contact your network operator or e-mail service provider. For receiving the e-mail settings over the air, see Over-the-air settings service on page 22. Activate the e-mail service settings that you have obtained from your network operator or e-mail service provider. To activate the settings, select Menu > Messages >
Settings > E-mail settings. To set the e-mail settings on your phone, select Menu > Message settings > Java e-
mail settings. See Settings for e-mail on page 46.
Write and send e-mail You can write your e-mail message before connecting to the e-mail service, or connect to the service first, and then write and send your e-mail. 1 2 Select Menu > Messages > E-mail > Create e-mail. Key in the recipients e-mail address and select Options > OK. To search for the e-mail address in Contacts, select Options > Search > OK. Key in a subject for the e-mail, and then select Options > OK. Key in the e-mail message. The number of characters that you can key in is shown on the top right of the display. To send the e-mail message, select Options > Send e-mail and then select one of these options:
Send nowsends the e-mail immediately. If you are connected to the e-mail account, your phone establishes the connection and then sends the e-mail. Send latersaves your e-mail in the Outbox folder to send later. To edit or continue writing your e-mail later, you can save it in Drafts by selecting Save draft msg. When you are ready to send the e-mail, select Menu > Messages > E-mail > Send now or 3 4 5
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 39 Wednesday, October 15, 2003 1:43 PM Send and retrieve. The other options in the options list let you edit the e-mail or subject, add a copy recipient or a hidden copy recipient, exit the editor or use the dictionary. Messages Download e-mail from your e-mail account If message memory is full, delete some of your older messages before you start to download new messages. 1 Do one of the following:
To download new messages, select Menu > Messages > E-mail > Retrieve. To send messages that are in your Outbox folder at the same time you download new messages, select Menu > Messages > E-mail > Send and retrieve. 2 Select any messages you want to view in the Inbox, or press Back to view it later. Unread text messages are indicated by
. Read and reply to an e-mail message 1 2 3 Select Menu > Messages > E-mail > Inbox. Display the desire message and select Options. Select Reply to reply to an e-mail. Select Original text to include the original message in the reply or select Empty screen. When replying to an e-mail, first confirm or edit the e-mail address and subject; then write your reply. Select Options > Send e-mail > Send now to send the message. 4 Inbox, Outbox, Deleted items, Sent items, Drafts and Archive folders Your phone has the following folders in the E-mail menu:
Inbox for saving e-mails that you have downloaded from your e-mail account. Outbox for saving e-mails that have not been sent if you have selected Send later (see Write and send e-mail on page 38. Deleted items for e-mails that have been deleted.
Sent items for saving e-mails that have been sent.
Drafts for saving unfinished e-mails.
Archive for organizing and saving your e-mails.
Options for an e-mail application Select Menu > Messages > E-mail, and then select one of the following options:
Connect viaactivates the network connection settings for your e-mail function. Select Application to activate the settings that are used for the e-mail application or select Default to confirm that your e-mail function uses the same settings as your Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 40 Wednesday, October 15, 2003 1:43 PM browser. See Key in the service settings manually on page 89. Contact your e-mail service provider, if in doubt. Detailsdisplays additional information about the application.
INSTANT MESSAGING Instant messaging (sometimes referred to as Chat) is a way of sending short text messages that are delivered over TCP/IP protocols to online users. You can send and receive instant messages with friends and family through different instant messaging services. You can use either ICQ (I Seek You) or America Online Instant Messaging (AIM). Note: This feature can be used only if it is supported by your network operator or service provider. Only phones that offer compatible instant messaging features can receive and display instant messages. Your IM contact list shows you when the contacts on the list are online and available to participate in an instant messaging conversation. When write and send your message, it stays on the display. The reply message appears above your original message. You can start an IM session and still the other functions of the phone while it is running in the background. Before you can use instant messaging on you phone, you must first subscribe to your wireless service providers text messaging service and then register with the IM service you want to use. If instant messaging is not available from your wireless service provider, the IM screen many not appear. Contact your service provider for more information. To set up the IM service, see Chat and my presence settings on page 60. Instant messaging uses shared memory. For more information, see Shared memory on page 7. To begin using IM, you must obtain a user name and password. You can do this by registering over the Internet with the IM service provider you have selected. Information on the ICQ or AIM Web sites guides you through the registration process. The Chat menu To access the Chat menu, select Menu > Messages > Chat. You can then select one of the following options:
Loginto connect you to the instant messaging service. To set the phone to automatically connect to the instant messaging service when you enter the Chat menu, see Connect to and disconnect from IM service on page 41.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 41 Wednesday, October 15, 2003 1:43 PM Messages Saved convers.to view, erase, or rename the instant messaging conversations you have saved. You can also select Saved convers. when you have connected to the instant messaging service. Connect settingsto edit the settings needed for instant messaging and presence connection. See Chat and my presence settings on page 60. You can also select Connect settings when you have connected to the IM service. Connect to and disconnect from IM service To connect to the IM service, enter the Chat menu, and select Login. When the phone has successfully connected, Logged in is displayed. To set the phone to automatically connect to the IM service each time you enter the Chat menu, connect to the IM service, select My information, Automatic login and On Chat start-up. To disconnect from the IM service, select Logout. Start a chat Enter the Chat menu and connect to the chat service. You can then select from the following:
Conversationsto view the list of new and read messages or invitations to IM during the active IM session. Locate the desired message or invitation and select Open to read the message. indicates new and indicates new and indicates invitations. read messages. read group messages.
Chat contactsto view the contacts that you have added from the phone contacts memory. Scroll to the desired contact and select Chat. If you have received a new message from a contact, it is indicated by indicates the online and indicates a blocked contact. (See Block and unblock messages on page 43. the offline contacts in the phone memory. To add contacts to the list, see Contacts for the chat on page 43. Groups and Public groups.to view the list of bookmarks to public groups provided by the network operator or service provider. To start a chat with a group, highlight the group name and select Join. Enter your screen name that you want to use in the conversation. When you have successfully joined the group conversation, the phone shows Joined group: and the group name. To create a private group, see Caller groups on page 59. Search and select Users or Groupsto search for other chat users or public groups on the network.
If you select Users, you can search for a user by phone number, screen name, e-mail address or name. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 42 Wednesday, October 15, 2003 1:43 PM
If you select Groups, you can search for a group by a member in the group or by group name, topic or ID. To start the chat when you have found the user or the group, scroll to the user or a group that you want, select Options > Chat or Join group. To start a chat from Contacts, see View subscribed contacts on page 55. Accept or reject an IM invitation In the standby mode, when you have connected to the chat service and you receive an invitation, New invitation received is displayed. Select Read to read it. If you receive more than one invitation, the number of messages followed by new invitations received is displayed. Select Read, scroll to the invitation you want, and select Open.
To join the private group conversation, select Accept. Enter the screen name that you want to use as a nickname. When you have successfully joined the group, the phone shows Joined group: and the group name. To reject or delete the invitation, select Options > Reject or Delete.
Read a chat message In the standby mode, when you have connected to the chat service and you receive a message from a person who is not taking part in the conversation, New instant message is displayed. Select Read to read it. If you receive more than one message, the number of messages followed by new instant messages is displayed. Select Read, scroll to the message, and select Open. New messages received during an active chat are held in the Conversations of the Chat menu. If the message is from a person whose contact information is missing in the contact list in Chat contacts, the senders ID is shown. If the contact information can be found in the phone memory for contacts and the phone recognizes it, the senders name is shown. To save a new contact in the phone memory, select Options, and select one of the following options:
Participate in an IM conversation Join or start chat by selecting Write. If you receive a new message during a chat from a person who is not taking a part in the current chat, the icon Write your message and press the Send key to send it. If you select Options, some of the following options are available. Choose from the following list:
Save contactto enter the name of the person. Add to contactto add details to a contact name. is shown on the top of the display.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 43 Wednesday, October 15, 2003 1:43 PM Messages View conversationto view the ongoing chat. To save the chat, select Save and enter the name for the conversation. Save contactto save the contact. Add to contactto add details to a contact Group membersto view the members of the selected private group. (This option only appears if you have created the group.) End conversationto close the ongoing conversation. Dictionaryto turn the predictive text feature on or off. (See Set predictive text on or off on page 27.) Edit your own IM information Enter the Chat menu and connect to the chat service. Select My information to view or edit your own availability status or screen name. Select Availability and either Available for all or Avail. for contacts (or Appear offline) to let all chat users or only the contacts on your chat contact list to see whether you are online or offline when you have connected to the chat service. The icon that your online status is not visible to others. Contacts for the chat You can add contacts from the phone memory to the chat contacts list. 1 Connect to the chat service, select Chat contacts > Options and select Add contact
(or Add if you have no contacts added)to select a contact name to add to the list of IM contacts. Scroll to a contact, and select Chat to start to chat, or select Options and select:
shows that you are online and Contact infoto view the details of the selected contact. To edit the details, see Edit or delete details in contacts on page 53. Block contact (or Unblock contact)to block (or unblock) the messages from the selected contact. Add contactto add a contact from the contact memory in the phone. Remove contactto remove a contact from the chat contact list.
2 Block and unblock messages Connect to the chat service and select Conversations or Chat contacts. Highlight the contact in the contacts list from whom you want to block incoming messages. Select Options > Block contact > OK. To unblock the messages, connect to the chat service and select Blocked list. Scroll to the contact from whom you want to unblock the messages and select Unblock. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 44 Wednesday, October 15, 2003 1:43 PM Groups You can create your own private groups for a chat session, or use the public groups provided by the service provider. The private groups exist only during an active chat session. You can add to a private group only the contacts that are in your contact list and thus in the phone memory. Bookmark Public groups You can bookmark public groups that your service provider may maintain. Connect to the chat service, select Groups and Public groups. Scroll to a group that you want to chat with and select Join. If you are not in the group, key in your screen name as your nickname for the group. If you select Options, you can select Delete group to delete a group from your group list. Create private groups Connect to the chat service, select Groups and Create group. Key in the name for the group and the screen name for yourself that you want to use for the group. You can use another screen name in another group. Select Add to view the list of contacts. Select a name from the contacts list to add it to the private group list. To add more names to the list, select Options > Add member, and select a new name. To remove a name from the private group list, scroll to it and select Options > Remove member. To send an invitation to the new members that you have added to the group, select Options > Send invitation. Then write your invitation. You can only select online contacts, indicated by Offline contacts are indicated by
VOICE MESSAGES from the phone contacts memory. The voice mailbox is a network service and you may need to subscribe to it. For more information and for the voice mailbox number, contact your service provider. Select Menu > Messages > Voice messages, and select one of the following options:
Listen to voice messages to call your voice mailbox at the phone number that you have saved in the Voice mailbox number menu. If you have two phone lines available through your network service, each phone line may have its own voice mailbox number. For more information, see Call settings on page 67. Voice mailbox number to key in, search for or edit your voice mailbox number and select OK to save it.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 45 Wednesday, October 15, 2003 1:43 PM If supported by the network, the icon Listen to call your voice mailbox number. Pressing and holding the 1 key calls your voice mailbox, when the keyboard is closed. When the keyboard is open, press and hold the corresponding number key. indicates there are new voice messages. Select Messages
INFO MESSAGES With the info message network service you can receive messages on various topics from your service provider, for example weather or traffic conditions. For availability, topics and the relevant topic numbers, contact your service provider.
MESSAGE SETTINGS The message settings affect the sending, receiving and viewing of messages. Settings for SMS text and e-mail messages 1 2 Select Menu > Messages > Message settings > Text messages > Sending profile. If more than one message profile set is supported by your SIM card, select the set that you want to change. Select Message centre number to save the phone number of the message centre that is required for sending text messages. You will receive this number from your service provider. Select Messages sent via to select the message type: Text, E-mail, Paging or Fax. Select Message validity to select the length of time for which the network should attempt to deliver your message. For message type Text, select Default recipient number to save a default number for sending messages for this message profile. For message type E-mail, select E-mail server to save the e-mail server number. Select Delivery reports to ask the network to send delivery reports about your messages
(network service). Select Use GPRS and select Yes to set GPRS as the preferred SMS bearer. Set also the GPRS connection setting to Always online, see EGPRS on page 65. Select Reply via same centre to allow the message recipient to send you a reply by way of your message centre (network service). Select Rename sending profile to change the name of the selected message profile. The message profile sets are only displayed if your SIM card supports more than one set.
Overwrite settings When the text message memory is full, the phone cannot receive or send any new messages. However, you can set the phone to automatically replace old text messages in the Inbox and Sent items folders with new ones. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 46 Wednesday, October 15, 2003 1:43 PM Select Menu > Messages > Message settings > Text messages, and select either Overwriting in inbox or Overwriting in sent items and Allowed. Settings for multimedia messages You may receive the multimedia connection settings as an over the air message from the network operator or service provider. To receive the settings over the air, see Over-the-air settings service on page 22. To key in the settings manually, select Menu > Messages > Message settings > Multimedia msgs., and then set up the following items:
Save sent messages. Select Yes to set the phone to save sent multimedia messages in the Sent items folder. If you select No, the sent messages are not saved. Delivery reports to ask the network to send delivery reports about your messages
(network service). Scale image down to define the image size when you insert the image to the multimedia message. Default slide timing to set the timing for slides in multimedia messages. Allow multimedia reception. Select No, Yes or In home network to use the multimedia service. If you select In home network, you cannot receive multimedia messages outside your home network. Incoming multimedia messages. Select Retrieve to set the phone to automatically fetch newly received multimedia messages, or select Reject if you do not wish to receive multimedia messages. Connection settings. Define connection settings for retrieving multimedia messages. First select Active multimedia settings, and activate the set in which you want to save the settings. Select Edit active multimedia settings and edit the active settings. Select each of the settings one by one and key in all the required settings. Contact your network operator or service provider for the settings. Allow adverts. You can receive or reject advertisements. The setting is not shown if Allow multimedia reception is set to No.
SETTINGS FOR E-MAIL You may receive the e-mail connection settings as an over the air message from the network operator or service provider. For receiving the settings over the air, see Over-the-air settings service on page 22. For keying in the settings manually, select Menu >
Messages > Message settings > Java e-mail settings. First select Active e-mail settings and activate the set in which you want to save the settings. Select Edit active e-mail settings and edit the active settings. Select each of the settings one by one and key in all the required settings. Contact your network operator or e-mail service provider for the settings.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 47 Wednesday, October 15, 2003 1:43 PM Messages E-mail address. Key in your e-mail address.
Mailbox name. Key in the name that you want to use for the mailbox.
My name. Key in your name or nickname if you want the recipient to see it.
Outgoing (SMTP) server. Key in the address of the e-mail server. Outgoing (SMTP) port. Key in the number of the e-mail server port for outgoing e-
mail. The most common default value is 25. Use SMTP authorization. If your e-mail service provider requires authentication for sending e-mails, set the setting to on. You must also define your SMTP user name and SMTP password. SMTP user name. Key in the user name for outgoing mails that you have obtained from your e-mail service provider. SMTP password. Key in the password that you want to use for outgoing mails. If you have not defined a password, you may be asked to define one when your phone connects to your e-mail account. Include signature. Confirm your selection if you want to add a predefined signature to your e-mail. Incoming (POP3/IMAP) server. Key in the e-mail server address for incoming e-mail
(either POP3 or IMAP4) Incoming (POP3/IMAP) port. Key in the port number that you have obtained from your e-mail service provider. POP3/IMAP user name Key in the user name to access the mailbox. If you have not defined your SMTP user name, the e-mail server uses this user name instead. POP3/IMAP password. Key in the password to access the mailbox. If you have not defined your SMTP password, the e-mail server uses POP3/IMAP password instead. Reply-to address. Key in the e-mail address to which you want the replies to be sent, if it differs from your e-mail address. Incoming server type. Select either POP3 or IMAP4. If both types are supported, select IMAP4. Changing the server type also changes the incoming port number. Secure login APOP. Select On if your connection requires an encrypted login, otherwise leave it to Off. Contact your service provider if in doubt. This option is only shown, if you have selected POP3 as your mailbox type. Using encrypted login enables increased security for user names and passwords. It does not increase security for the connection itself Retrieve mails. Key in the number of e-mails that you want to retrieve at a time.
FONT SIZE SETTING To select the font size for reading and writing messages, select Menu > Messages >
Message settings > Other settings > Font size. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 48 Wednesday, October 15, 2003 1:43 PM
SERVICE COMMANDS Select Menu > Messages > Service commands. Key in and send service requests (also known as USSD commands), such as activation commands for network services, to your service provider.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 49 Wednesday, October 15, 2003 1:43 PM Call register 8 Call register The phone registers the phone numbers of missed, received and dialed calls, and the approximate length of your calls. The phone registers missed and received calls only if the network supports these functions, and the phone is switched on and within the networks service area. When you select Options in the Missed calls, Received calls, and Dialed numbers menu, you can, for example, view the date and the time of the call, edit or delete the phone number from the list, save the number in Contacts, or send a message to the number.
RECENT CALLS LISTS Select Menu > Call register, and then select:
Missed calls to view the list of the last 20 phone numbers from which somebody has tried to call you (network service). The number in front of the (name or) phone number indicates the number of call attempts from that caller. When a note about missed calls is displayed, select List to access the list of phone numbers. Scroll to the number you would like to call back and press the Send key. Received calls to view the list of the last 20 phone numbers from which you have most recently accepted calls (network service). Dialed numbers to view the list of the last 20 phone numbers that you have most recently called or attempted to call. See also Last number redial on page 23. Delete recent call lists to delete the recent calls lists. Select whether you want to delete all the phone numbers in the recent calls lists, or only the numbers in the missed calls, received calls or dialed numbers lists. You cannot undo the operation.
TIMERS AND COUNTERS Note: The actual invoice for calls and services from your service provider may vary, depending upon network features, rounding-off for billing, taxes and so forth. Select Menu > Call register > Timers and counters, and then select:
Call duration. Scroll to view the approximate duration of your incoming and outgoing calls in hours, minutes, and seconds. The security code is required to clear the timers. If you have two phone lines available (network service), each phone line has its own call duration timers. The timers of the selected line are displayed. GPRS data counter. Scroll to check the size of data that were sent or received in bytes, sent and received data in total, and to clear the counters. The security code is required to clear the counters. GPRS connection timer. Scroll to check the duration of the last GPRS connection or
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 50 Wednesday, October 15, 2003 1:43 PM
the total GPRS connection time. You can also clear the timers. The security code is required to clear the timers. Text message counter. Scroll to view the number of received or sent text and picture messages. You can also, for example view the details or the recipient/sender of the message respectively. To clear the text message counters, select Clear counters.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 51 Wednesday, October 15, 2003 1:43 PM 9 Contacts Contacts You can save names and phone numbers (contacts) in both the phone memory and in the SIM card memory.
You may save up to 500 names with numbers and text notes for each name in the phone memory. You can also save an image for a certain number of names. The number of names that can be saved depends on both the length of the names, and the number and length of the phone numbers and text items. Contacts use shared memory. For more information, see Shared memory on page 7. The phone supports SIM cards that can save up to 250 names and phone numbers. Names and numbers that are saved in the SIM card memory, are indicated by
. In dynamic contacts (Presence) you can publish your current availability status to communicate to anyone who has access to this service and who is requesting this information. You can view the availability status of any of the contacts that you have subscribed to in the Subscribed names menu and in the detailed view of a name in Contacts.
CONTACTS SETTINGS Select Menu > Contacts > Settings, and then select:
Memory in use to select the memory, either SIM card or phone, that you want to use for your contacts. To recall names and numbers from both memories for contacts, select Phone and SIM. In this case, the names and numbers will be saved in the phone memory. Contacts view to select how the names, numbers and images in contacts are displayed.
Memory status to view how much free memory is available for both memories for contacts.
ADD CONTACTS Names and numbers will be saved in the memory in use. 1 2 3 4 When the name and number have been saved, select Done. Select Menu > Contacts > Add contact. Key in the name and select OK. Key in the phone number, and select OK. Note: To quick save in the standby mode, key in the phone number and select Save. Key in the name, select OK > Done. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 52 Wednesday, October 15, 2003 1:43 PM 3 4 5
. When you select a name from Save multiple numbers and text items per contact You can save different types of phone numbers and short text items for each name in the phone memory that is allocated for contacts. The first number saved is automatically set as the default number and it is indicated by a frame around the number type icon, for example contacts, for example to make a call, the default number is used unless you select another number. 1 Make sure that the memory in use is either Phone or Phone and SIM. 2 To access the list of names and phone numbers, move the joystick down in the standby mode. Select the desired name and select Details. Select Options > Add number or Add detail. To add a number or detail, select one of the number types or text types, respectively.
If you select the text type User ID:
Select Search to search for an ID by a mobile phone number or an e-mail address in the server of the operator or service provider if you have connected to the presence service. If only one ID is found, it is automatically saved. Otherwise, to save the ID, select Options > Save. To key in the ID, select Enter ID manually. Key in the ID and select OK to save it. To change the number or text type, select Change type in the options list. (You cannot change the type of an ID when it is on the Chat contacts or in the Subscribed names list.) To set the selected number as the default number, select Set as default. Key in the number or text item and select OK to save it. Select Back and then Exit to return to the standby mode. 6 7 Add an image to a name or number in contacts You can add an image to a name or number saved in the phone memory. The image must be one of the supported formats. Move the joystick down in the standby mode, scroll to the name (and number) and select Details. Select Options > Add image. The phone opens the list of folders in the Gallery. Scroll to the desired image, select Options > Save to contacts.
SEARCH FOR A CONTACT 1 2 Select Menu > Contacts > Search, or move the joystick down in the standby mode. You can key in the first characters of the name that you are searching for in the pop-
up window. Move the joystick up or down to scroll through the names in the list, and right or left
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 53 Wednesday, October 15, 2003 1:43 PM Contacts 3 to move the cursor in the pop-up window Scroll to the contact that you want, and select Details. Scroll to view the details of the selected contact. Depending on the Contacts view selection in Contacts settings on page 51, the subscribed contacts are shown differently. Either only the availability icon or the availability icon, personal logo and the status message are shown. Select Details to view all dynamic information. To quickly view a specific name with the default number, when the keyboard is closed, press and hold the * key at the name while scrolling through contacts. To view the status message in full, select Details and press and hold the * key at the dynamic contact while scrolling through the contact names.
DELETE CONTACTS Select Menu > Contacts > Delete to delete a contact and all the details attached to it. If the contact has an ID on the Chat contacts or in the Subscribed names list, the note Presence information will be deleted is shown before the contact is deleted.
To delete names and numbers one by one, select One by one and scroll to the name
(and number) that you want to delete. Select Delete > Yes. To delete contacts all at once, select Delete all and then scroll to either of the memories, Phone or SIM card and select Delete. Select Yes and confirm with the security code.
EDIT OR DELETE DETAILS IN CONTACTS Move the joystick down in the standby mode, scroll to the contact that you want to edit or delete and select Details. Scroll to the name, number, text item or image that you want to edit or delete, and select Options.
To edit a name, number or text item or to change an image, select Edit name, Edit number, Edit detail, or Change image. (You cannot edit or delete an ID when it is on the Chat contacts or in the Subscribed names list.) To delete a number or text item, select Delete number or Delete detail. To delete an image which is attached to the contact, select Delete image. Deleting an image from contacts does not delete it from Gallery.
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 54 Wednesday, October 15, 2003 1:43 PM
MY PRESENCE My presence (network service) provides enhanced communication services that you can share with others, such as your family, friends and colleagues. You can share your current presence status with those who have access to the service and request it. The requested information is shown in Subscribed names in the viewers Contacts menu. You can control and personalize the information that you want to share with others, and control the list of persons who can view your presence status. For the availability of the presence service, contact your network operator or service provider. You need to access the presence service before you can share your presence status with others. Other viewers need access to the presence service and a compatible phone to share your presence status. Select Menu > Contacts > My presence, and then select:
Connect to My presence service (or Disconnect)connects to or disconnects from the service. My current presencechanges your presence status, and select:
View current presence and select Private presence or Public presence to view your current private or public status.
My availability to set your availability status to Available indicated by Busy indicated by
, or to Not available indicated by
, or to
My presence message and key in the text to be shown to other persons or select Options > Previous msgs. and select an old message as the status message.
My presence logo to select the default logo of the availability status or personalize one from the Graphics folder in the gallery. Show to to select the groups with whom want to share or not to share your presence status. Select Private and public, Private viewers or No one. Current viewers and select:
Current viewers to view all the persons who have subscribed to your presence information Private list to view the list of the persons who are allowed to view your personalized presence information. Blocked list to view all the persons you have blocked from viewing your presence information. Settings and select
Show current presence in idle to show the current status icon in the standby mode. Synchronize with profiles to select whether you want to link My presence message and My availability manually or automatically to the currently active
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 55 Wednesday, October 15, 2003 1:43 PM
profile. (You cannot link a personalized status logo to a Profile.) Connection type to set the phone to automatically connect to the service when the phone is switched on. Contacts Network settings, see Chat and my presence settings on page 60.
Subscribed contacts You can create a list for contacts whose presence status you want to be aware of. You can view the information if the contacts allow you to view it and if it is not prevented by the contact or network. You can view subscribed contacts either by scrolling through the contacts or by viewing the Subscribed names menu. Make sure that the memory in use is either Phone or Phone and SIM. See Contacts settings on page 51. To connect to the Presence service, select Menu > Contacts > My presence > Connect to My presence service. You can also view the subscribed contacts when you are not connected to the presence service. but you cannot see the presence stats of the contact. Add contacts to the subscribed contacts 1 Select Menu > Contacts > Subscribed names. If you have not connected to the Presence service, the phone asks if you want to connect now. If you have no contacts on your list, select Add. Otherwise, select Options > Subscribe new. The list of contacts is shown. Select a contact from the list and if the contact has an ID saved, the contact is added to the subscribed contacts list. If there are more than one ID, select one of them. After subscription to the contact, Subscription activated is shown. To subscribe to a contact from Contacts list, move the joystick down in the standby mode and scroll to the contact that you want to subscribe to. Select Details > Options. To subscribe, select Request presence > As subscription. If you only want to view the presence information without subscribing to a contact, select Request presence and One time only. View subscribed contacts See also Search for a contact on page 52 to view the presence information. 1 Select Menu > Contacts > Subscribed names. The status information of the first contact on the dynamic contacts list is shown and it may include text and some of the following icons:
2 3 or indicate that the person is either available, busy or not available.
, indicates that the persons presence information is not available. 2 Scroll to the desired contact and select Details to view the details of the selected contact. If you select Options, you can select Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 56 Wednesday, October 15, 2003 1:43 PM
Subscribe new to add a new contact to the list of subscribed contacts. Chat to start a chat conversation. Send message to send a text message to the selected contact. Send e-mail to send an e-mail to the selected contact. Send bus. card to send a business card from the selected contact. Unsubscribe to remove the selected contact from the list of subscribed contact. Unsubscribe a contact
To unsubscribe a contact from the Contacts list, move the joystick down in the standby mode and scroll to the contact that you want to unsubscribe. Select Details, select the ID, and select Options. To unsubscribe, select Unsubscribe and select OK to confirm. To unsubscribe using the Subscribed names menu, see View subscribed contacts on page 55.
COPY CONTACTS You can copy names and phone numbers from the phone memory to your SIM card memory and vice versa. Any text items saved in the phone memory, such as e-mail addresses, will not be copied to the SIM card. 1 2 3 Select Menu > Contacts > Copy. Select the copying direction, From phone to SIM card or From SIM card to phone. Select One by one, All or Default numbers. Default numbers is shown if you copy from the phone to the SIM card. Only the default numbers will be copied. To choose whether you want to keep or delete the original names and numbers, select Keep original or Move original. 4
SEND AND RECEIVE BUSINESS CARDS You can send and receive a persons contact information from a compatible device as a business card. When you have received a business card, select Show > Save to save the business card in the phone memory. To discard the business card, select Exit > OK. To send a business card, search for the name and phone number you want to send from contacts, select Details > Options > Send bus. card. Select Via infrared, Via text message
(network service), or Via Bluetooth.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 57 Wednesday, October 15, 2003 1:43 PM
SPEED DIAL Contacts To assign a number to a speed dialing key, use the following steps:
1 Select Menu > Contacts > Speed dials and scroll to the desired speed dialing key number. 2 To change a speed dial assignment To delete a speed dial assignment 3 Select Assign, or if a number has already been assigned to the key, select Options >
Change. Select Search, and select first the name and then the number you want to assign. If the Speed dialing function is off, the phone gives you the option to activate it. To make a call using the speed dialing keys, see Speed dial a phone number on page 24.
VOICE DIAL You can make a phone call by saying a voice tag that has been added to a phone number. Any spoken word or words, such as a persons name, can be a voice tag. You can add up to ten voice tags. Note: Using voice tags may be difficult in a noisy environment or during an emergency, so you should not rely solely upon voice dialing in all circumstances Before using voice dialing, review the following:
Voice tags are not language dependent. They are dependent on the speaker's voice. Voice tags are sensitive to background noise. Record them and make calls in a quiet environment.
When recording a voice tag or making a call by saying a voice tag, hold the phone in the normal position near to your ear. Very short names are not accepted. Use long names and avoid similar names for different numbers. Note: You must say the name exactly as you said it when you recorded it. This may be difficult in, for example, a noisy environment or during an emergency, so you should not rely solely upon voice dialing in all circumstances. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 58 Wednesday, October 15, 2003 1:43 PM Add and manage voice tags Before you begin, make sure you have the contact names you intend to save with voice tags set up in the phone memory. You can also add voice tags to the names in the SIM card, but if you replace your SIM card with a new one, you first need to delete the old voice tags before you can add new ones. Voice tags use shared memory. For more information, see Shared memory on page 7. 1 In the standby mode, select Menu > Contacts, scroll to the desired contact, and select Details. Select Options > Add voice tag. Select Start, and say clearly the word(s) you want to record as a voice tag. After recording, the phone plays the recorded tag. 4 When the voice tag has been successfully saved, Voice tag saved is displayed, a beep 2 3 sounds and a symbol appears after the phone number with a voice tag. To check the voice tags, select Menu > Contacts > Voice tags. Scroll to the contact, select Options, and select the function you want. Make a call using a voice tag If the phone has an application using the GPRS connection that is sending or receiving data, first end the application to make a call by using voice dialing. 1 In the standby mode, press the Right selection key or press and hold Names. A short tone is heard and Speak now is displayed. Say the voice tag clearly. The phone plays the recognized voice tag and then dials the phone number of the voice tag after 1.5 seconds. If you are using a compatible headset, press and hold the headset key to start the voice dialing. Info numbers and service numbers Your service provider may have included information numbers or service on your SIM card. Select Menu > Contacts > Info numbers or Service numbers. Scroll through a category to an information number, or to a service number and press the Send key to call the number. 2
SAVE NUMBERS ON THE SIM CARD The phone numbers assigned to your SIM card are saved in My numbers if this is allowed by the card. To view the numbers select Menu > Contacts > My numbers. Scroll to the desired name or number, and select View.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 59 Wednesday, October 15, 2003 1:43 PM Contacts
CALLER GROUPS You can arrange the names and phone numbers saved in Contacts into caller groups. For each caller group, you can select a ringing tone and a logo that is shown on the display when you receive a call from a phone number in the group. To set the phone to ring only upon calls from phone numbers belonging to a selected caller group, see Alert for in Tone settings on page 61. Select Menu > Contacts > Caller groups and select the desired caller group. You can select from the following functions: Group name, Group ringing tone, Group logo, and Group members. If you select Group members, select Add, to add a name to the group, if there are no names in the group. Otherwise, select Options > Add contact. To remove a name from a caller group, scroll to the desired name, and select Remove. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003
1 2 | Manual 2 | Users Manual | 3.11 MiB | July 11 2003 |
6820.ENv1_9310322.book Page 60 Wednesday, October 15, 2003 1:43 PM 10 Settings
PROFILES Your phone has a group of profiles that allow you to personalize the tone settings of your phone and to activate a profile for different events and environments. Available profiles are General, Silent, Meeting, Outdoor, My style 1 and My style 2. Select Menu > Settings > Profiles and select a profile. Choose from the following options:
To activate the selected profile, select Activate. To activate the profile for a certain amount of time up to 24 hours, select Timed and set the end time. When the timed profile expires, the previous profile that was not timed, becomes active. To personalize the profile, select Personalize. Select the setting that you want to change and make the changes. The settings can also be changed in the Tone settings menu, see Tone settings on page 61 on. To rename a profile, select Profile name. The General profile cannot be renamed. To change your presence status, select My presence. The menu is available if you have set Synchronize with profiles to On, see My presence on page 54. Select My availability to change your availability status and My presence message to edit your status message.
Note: To quickly change the profile in the standby mode, press the Power key, scroll to the profile that you want to activate and press Select.
CHAT AND MY PRESENCE SETTINGS For the settings required for IM, contact your network operator or service provider. To receive the IM and presence settings over the air, see Over-the-air settings service on page 22. KEYING IN THE SETTINGS MANUALLY 1 Select Menu > Settings > Chat and my presence settings > Active chat and presence settings. Scroll to the set you would like to activate and select Activate. You need to activate the connection set where you want to save the settings. A connection set is a collection of settings required to make a connection to the chat and presence services. Select Edit active chat and presence sett.. 2 3
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 61 Wednesday, October 15, 2003 1:43 PM Select each of the settings one by one and key in all the required information that you have received from your network operator or service provider. Note: The connection settings are in the Connection settings menu. Settings
TONE SETTINGS You can find the same settings in the Profiles menu. The settings you make change the settings in the active profile Select Menu > Settings > Tone settings, and select:
Incoming call alert and select how the phone notifies you of an incoming voice call. Ringing tone to select a tone for incoming voice calls. To select ringing tones that have been saved in the Gallery, select Open gallery from the ringing tone list. Ringing volume to set the tone level for incoming voice calls and incoming messages. Note: If you download a ringing tone or receive one using OTA, you can save it in the Gallery. Vibrating alert to set the phone to vibrate for incoming voice calls and incoming messages. The vibrating alert does not work when the phone is connected to a charger, a desktop stand, or a car kit.
Message alert tone to set the alert tone for incoming messages.
Warning tones to set the phone to sound tones, for example when the battery is Keypad tones to adjust the tone level of keypad. running out of power. Alert for to set the phone to ring only on calls from phone numbers that belong to a selected caller group. Scroll to the caller group that you want or All calls and select Mark.
DISPLAY SETTINGS Select Menu > Settings > Display settings, and select
Wallpaper to set the phone to display a background image, known as wallpaper, when the phone is in the standby mode. Some images are provided in the Gallery menu. You can also receive images, for example through a multimedia message, or use PC Suite to transfer them from your PC and then save them in Gallery. Your phone supports JPEG, GIF, WBMP, BMP and PNG formats, but not necessarily all variations of these formats. Select:
Select image to open an image folder. Scroll to the desired image you want to set as wallpaper, select Options > Set as wallpaper. On or Off to activate/deactivate the wallpaper. (The wallpaper is not displayed
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 62 Wednesday, October 15, 2003 1:43 PM when the phone activates the screen saver.)
Color schemes to change the color of some display components, for example icons and signal bars.
Menu view to select how the main menu items are displayed on the phone. Select List or Grid. Operator logo to set the phone to show or hide the operator logo. If you have not saved any operator logos, the Operator logo menu is dimmed. The operator logo is not displayed when the phone activates the screen saver. Screen saver timeout and select the timeout after which the screen saver will be activated. The length of the timeout can vary from 5 seconds to 60 minutes. The digital clock screen saver is used for power saving in the standby mode. It is activated when no function of the phone has been used for a certain length of time while the keyboard is closed. Press any key to deactivate the screen saver or open the keyboard. The screen saver is also deactivated when the phone is out of the network coverage area. The screen saver overrides graphics and texts on the display in the standby mode. Display brightness to change the brightness level of the phone display. Move the joystick to the left to decrease and to the right to increase the brightness level, and select OK to accept it
TIME AND DATE SETTINGS Select Menu > Settings > Time and date settings, and select:
Clock > Show clock or Hide clock to show or hide the time on the top right of the display in the standby mode. Select Set the time to adjust the clock to the correct time, and Time format to select 12-hour or 24-hour time format. The clock is also used for the functions Messages, Call register, Alarm clock, timed Profiles, Calendar, Notes, and screen saver for example. If the battery is removed from the phone for a long time, you may need to reset the time. Date > Show date or Hide date to show or hide the date on the display in the standby mode. Select Set the date to adjust the date. You can also select the date format. Auto-update of date & time (network service) to set the phone to automatically update the time and date according to the current time zone, select On. To set the phone to ask for confirmation before the update, select Confirm first. The automatic update of date and time does not change the time you have set for the alarm clock, calendar or the alarm notes. They are in local time. Updating may cause some alarms that you have set to expire.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 63 Wednesday, October 15, 2003 1:43 PM
PERSONAL SHORTCUTS Settings You can select the function for the Right selection key displayed in the standby mode. You have also a list of phone functions which can be activated by saying a voice tag. Up to five voice tags for the voice commands can be added. Select Menu > Settings > Personal shortcuts, and select:
Right selection key to view the list of available functions for the Right selection key. Scroll to the function that you want and select it. Voice commands and select the command folder you want, scroll to the command to which you want to add a voice tag. Select Options > Add command. If the command already has a voice tag, the icon command, see Voice dial on page 57. During a call or when an application using the EGPRS connection is sending or receiving data, you cannot activate or add a voice command. is shown. For adding and activating a voice
CONNECTIVITY You can connect the phone to a compatible device using an IR or Bluetooth connection. You can also define the settings for EGPRS dial-up connections. Bluetooth connections and infrared connections cannot be active at the same time. Bluetooth technology(technical reviewers-plse check profiles over carefully) The phone supports Bluetooth wireless technology which allows you to connect the phone to a compatible Bluetooth device within 10 meters. The Bluetooth connection can be subject to interference from obstructions such as walls or other electronic devices. Note: There may be restrictions on using Bluetooth devices in some locations. Check with your local authorities or service provider. The Nokia 6820 phone is designed to be compliant with and adapt to Bluetooth Specification 1.1. Compatibility between the phone and other products with Bluetooth wireless technology depends also on the profiles and protocols used by the devices. The current profiles supported by the Nokia 6820 are:
SAP (Sim Access Profile) OPP (Object Push Profile) as a client and server FTP (File Transfer Profile) as a server DUN (Dial-up Networking Profile) as a gateway HSP (Headset Profile) HFP (Hands-free Profile) as an audio gateway SDP (Service Discovery Profile) Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 64 Wednesday, October 15, 2003 1:43 PM GAP (Generic Access Profile) SPP (Serial Port Profile) with the PC connectivity software GOEP (Generic Access Exchange Profile)
When a profile is active, the profile is shown on the phone display, such as Remote SIM, to indicate that the phone is disconnected from the GSM network, thereby deactivating all phone functions. For compatibility between your phone and another Bluetooth device, consult the documentation for the device and your Nokia dealer. In some countries, there may be restrictions on using Bluetooth devices. Check with your local authorities. Note: Using Bluetooth features, or allowing them to run in the background while using other features, increases the demand on battery power and reduces the battery life. Set up a Bluetooth connection When you activate the Bluetooth application for the first time, you are asked to provide a Bluetooth name for your phone. This is the name that will be seen by other Bluetooth users. Use the following steps to activate your Bluetooth connection. 1 2 Select Menu > Settings > Connectivity > Bluetooth. Select Bluetooth > On. The active Bluetooth connection is indicated by at the top of the display. Note: If you do not plan to use the Bluetooth feature for an extended time period, deactivate it to save power. 3 4 5 Select Search for audio enhancements to search for compatible Bluetooth devices. Select the device that you want to connect to the phone. Enter the Bluetooth passcode of the device to associate (or pair) and connect the device. (You only need to give this passcode when you connect to the device for the first time.) Set up Bluetooth name and visibility Select Menu > Settings > Connectivity > Bluetooth > Bluetooth settings to define how your phone is shown to other Bluetooth devices. Select:
My phones visibility and Shown to all to show the phone to all other Bluetooth devices or Hidden to show the phone only to the paired devices.
My phones name to change the Bluetooth device name for your phone. Start a Bluetooth connection Select Menu > Settings > Connectivity > Bluetooth, and select:
View active device to check which Bluetooth connection is currently active. If you want to close the connection to the selected device, select Disconnect.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 65 Wednesday, October 15, 2003 1:43 PM Settings
View paired devices to view a list of Bluetooth devices that are currently paired with the phone. Scroll to the desired device. If you want to delete the pairing to the device, select Delete. Select Options to access some of the following functions. (This list may change depending on the status of the device and the Bluetooth connection.) Connectto connect to the selected device. Assign short nameto give a nickname (visible to you only) to the selected device. Request conn. authorizationto set up authorization. Select No if you want the phone to connect to the selected device automatically, or select Yes if you want the phone to ask for your permission first. Infrared The phone has an IR port that you can use for connecting your phone to another IrDA compliant device. You can send or receive data such as business cards and calendar notes to or from a compatible phone or data device, such as a computer. Warning:Do not point the IR (infrared) beam at anyone's eye or allow it to interfere with other IR devices. This device is a Class 1 Laser product. Send and receive data using IR
Ensure that the IR ports of the sending and receiving devices are pointing at each other and that there are no obstructions between the devices. The preferable distance between the two devices in an infrared connection should be one meter at most. To activate the IR port of your phone, select Menu > Settings > Connectivity >
Infrared. The user of the sending phone selects the desired IR function to start data transfer.
If the data transfer is not started within two minutes after the activation of the IR port, the connection is cancelled and has to be started again. IR connection icon
When appears continuously, the IR connection has been activated and your phone is ready to send or receive data using its IR port.
When blinks, your phone is trying to connect to the other device or a connection has been lost. The IR connection deactivates automatically. EGPRS GPRS (general packet radio service) is a network service that allows mobile phones to be used for sending and receiving data over an Internet Protocol (IP)-based network GPRS is a data bearer that enables wireless access to data networks as the Internet. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 66 Wednesday, October 15, 2003 1:43 PM EGPRS (enhanced GPRS), also known as EDGE (enhanced data rates for global evolution) is similar to GPRS but the connection is faster. For more information on availability of EGPRS and data transfer speed, contact your network operator or service provider. Note: The Nokia 6820 is 3GPP GSM Release 99 terminal supporting EGPRS service, and is designed to support also Release 97 GPRS networks. However, proper functionality in all Release 97 GPRS networks cannot be guaranteed. For more information, contact your service provider or local Nokia dealer. The applications that may use EGPRS are multimedia, chat and text messaging, browsing sessions, e-mail, remote SyncML, Java application downloading and the PC dial-up (for example, Internet and e-mail). Before you can use EGPRS technology:
Contact your network operator or service provider for availability and subscription to the EGPRS service. Save the EGPRS settings for each of the applications used over EGPRS.
For information on pricing, contact your network operator or service provider. Note: When you select GPRS as a data bearer, the phone uses EGPRS instead of GPRS, if this is available in the network. You cannot select between EGPRS and GPRS but for some applications you may be able to select either GPRS or GSM data
(CSD, Circuit Switched Data). EGPRS CONNECTION Your phone supports three simultaneous EGPRS connections. For example, you can at the same time browse XHTML pages, receive multimedia messages and have an ongoing PC dial-up connection. Select Menu > Settings > Connectivity > GPRS > GPRS connection.
Select Always online to set the phone to automatically register to an EGPRS network when you switch the phone on. When the GPRS connection is established, the icon is shown on the top left of the display When you start an application using EGPRS, the connection between the phone and the network is established, and data transfer is possible. When you end the application, the EGPRS connection is ended but the registration with the EGPRS network remains. If you receive a call or a text message, or make a call during a GPRS connection, the icon connection has been suspended (on hold). The GPRS and EGPRS connection are indicated by the same icons. If you select When needed, the EGPRS registration and connection are established when required by an application using GPRS and closed when you end the application. will be shown on the top right of the display to indicate that the EGPRS
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 67 Wednesday, October 15, 2003 1:43 PM
EGPRS MODEM SETTINGS Settings You can connect the phone to a compatible PC using infrared, Bluetooth or a data cable connection and use the phone as a modem to enable EGPRS connectivity from the PC. Select Menu > Settings > Connectivity > GPRS > GPRS modem settings. Select Active access point to activate the desired access point. Select Edit active access point to change the access point settings.
Select Alias for access point. Key in the name that you would like for the activated access point and select OK. Select GPRS access point.. Key in the Access Point Name (APN) to establish a connection to an EGPRS network. Contact your network operator for the APN. You can also set the (E) GPRS dial-up service settings (Access Point Name) on your PC using the Nokia Modem Options software. See PC Suite on page 96. If you have set the settings on both your PC and on your phone, the settings for the PC are used.
CALL SETTINGS Select Menu > Settings > More settings > Call settings, and select
Call divert (network service) to direct your incoming calls, for example to your voice mailbox number. Divert options that are not supported by your SIM card or your network operator may not be shown. Contact your service provider for details. For example, select Divert if busy to divert your voice calls when your number is busy or when you reject an incoming call. To set the divert setting to on, select Activate and then select the timeout after which the call is diverted, if this is available for the call divert option. To set the call divert to off, select Cancel. To check whether the call divert is activated or not, select Check status if this is available for the divert option. Several divert options may be active at the same time. To see the divert icons in the standby mode, see Icons in the standby mode on page 19. Anykey answer and select On and you can answer an incoming call by briefly pressing any key, except the Power key, Left selection key, Right selection key, and End key. Automatic redial and select On and your phone will make a maximum of ten attempts to connect a call after an unsuccessful call attempt. Speed dialing and select On and the names and phone numbers that are assigned to the speed dialing keys, from 29 with the keyboard closed, or the corresponding number keys of the keyboard, can be dialed by pressing and holding the corresponding number key. Call waiting and select Activate and the network will notify you of an incoming call while you have a call in progress (network service). See Call waiting on page 24. Summary after call and select On and after each call the phone will briefly display the
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 68 Wednesday, October 15, 2003 1:43 PM
duration and cost (network service) of the call. Send my caller identity and select Yes and your phone number will be displayed to the person you are calling (network service). Select Set by network and the setting agreed upon with your service provider is used. Line for outgoing calls (network service) to select the phone line 1 or 2 for making calls, for example you can use line 1 for personal calls and line 2 for business calls. For more information on availability, contact your network operator or service provider. If you select Line 2 and have not subscribed to this network service, you will not be able to make calls. However, calls on both lines can be answered regardless of the selected line. If supported by your SIM card, you can prevent the line selection by selecting the Lock option. Note: In the standby mode, you can switch from one line to the other by pressing and holding the * key.
PHONE SETTINGS
Select Menu > Settings > More settings > Phone settings, and select:
Phone language to set the language for the display texts. If Automatic is selected, the phone selects the language according to the information on the SIM card.
Memory status to view the amount of free, used and total amount of memory for each function. You may also find memory information in the menus of some functions, for example in the Applications menu. Security keyguard to lock the keypad of the phone with a security code, see Security code (5 to 10 digits) on page 70.
Key in the security code and select OK. To set the security keyguard, select On. The keypad lock remains active, if you open the keyboard. To activate the security keyguard, select Menu and the * key within 1.5 s., when the keyboard is closed. To deactivate the keyguard when the keyboard is open, select Unlock > OK; then key in the security code. If the keyboard is closed, select Unlock and the * key within 1.5 s.; then key in the security code. When the keypad is locked, activated the security keyguard, it does not protect your phone data from PC Suite access. appears on top of the display. If you have Cell info display and select On to set the phone to indicate when it is used in a cellular network that is based on Micro Cellular Network (MCN) technology.
Welcome note and key in the note that you would like to be shown briefly when the
phone is switched on. To save the note, select Save. Network selection and Automatic and the phone automatically selects one of the cellular networks available in your area.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 69 Wednesday, October 15, 2003 1:43 PM Settings If you select Manual, you can select a network that has a roaming agreement with your home network operator. If No network access is displayed, you must select another network. The phone stays in manual mode until the automatic mode is selected or another SIM card is inserted into the phone. Confirm SIM service actions. See SIM services on page 95. Help text activation to set the phone to show the help topics. Start-up tone to set the phone to play a start-up tone when it is switched on.
ENHANCEMENT SETTINGS The enhancement settings menu is only shown if the phone is or has been connected to some mobile enhancements (accessories), for example to chargers or hands-free units. Select Menu > Settings > Enhancement settings. Then select an appropriate enhancement from a list, if the corresponding enhancement is or has been connected to the phone. Select:
Default profile to automatically activate the desired profile when you connect to the
selected enhancement. You can select another profile while the enhancement is connected. Automatic answer to set the phone to automatically answer an incoming call after five seconds. If the Incoming call alert is set to Beep once or Off, automatic answer will not be used. Lights to set the lights permanently to On. Select Automatic to set the lights on for 15 seconds after a keypress. The Lights option is available only when Handsfree is selected.
When the phone is connected to the full car kit, select Ignition detector and On to
automatically switch off the phone approximately 20 seconds after you have switched off the ignition. For Text phone, select Use text phone and select Yes to use the text phone settings instead of headset or loopset settings.
SECURITY SETTINGS To work with security settings, select Menu > Settings > More settings > Security settings, and select the setting you would like to modify. Note: When security features that restrict calls are in use (call barring, closed user group and fixed dialing), calls may be possible to certain emergency numbers in some networks. PIN code request Select PIN code request to set the phone to ask for your PIN code every time the phone is switched on. Some SIM cards do not allow the PIN code request to be turned off. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 70 Wednesday, October 15, 2003 1:43 PM Call barring service (network service) Select Call barring service (network service) to restrict incoming calls to and outgoing calls from your phone. A barring password is required. Fixed dialing Select Fixed dialing to restrict your outgoing calls and text messages to selected phone numbers if this function is supported by your SIM card. The PIN2 code is required. When the fixed dialing is on, GPRS connections are not possible except while sending text messages over a GPRS connection. In this case, the recipients phone number and the message centre number must be included in the fixed dialing list. Closed user group Closed user group is a network service that specifies the group of people whom you can call and who can call you. For more information, contact your network operator or service provider. Security level Security level instructs the phone to ask for the security code whenever a new SIM card is inserted into the phone. Memory Select Memory to set the phone to request the security code when the SIM card memory is selected. Access codes Select Access codes to change the security code, PIN code, PIN2 code or barring password. Codes can only include numbers from 0 to 9. Refer to the following items when changing access codes. SECURITY CODE (5 TO 10 DIGITS) The security code protects your phone against unauthorized use. The preset code is 12345. When you have changed the code, keep the new code secret and in a safe place separate from your phone. To change the code, and to set the phone to request it, see Security settings on page 69. If you key in an incorrect security code five times in succession, the phone may display Code error. Wait for five minutes and key in the code again.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 71 Wednesday, October 15, 2003 1:43 PM Settings PIN AND PIN2 CODES (4 TO 8 DIGITS), MODULE PIN, AND SIGNING PIN The PIN (Personal Identification Number) code protects your SIM card against unauthorized use. The PIN code is usually supplied with the SIM card. To set the phone to request the PIN code each time the phone is switched on, see Security settings on page 69. The PIN2 code may be supplied with the SIM card and is required to access some functions. The module PIN is required to access the information in the security module. See Security module on page 93. The module PIN is supplied with the SIM card if the SIM card has a security module in it. The signing PIN is required for the digital signature. See Digital signature on page 94. The signing PIN is supplied with the SIM card if the SIM card has a security module in it. If you key in an incorrect PIN code three times in succession, the phone may display PIM blocked or PIN code blocked and ask you to key in the PUK code. PUK AND PUK2 CODES (8 DIGITS) The PUK (Personal Unblocking Key) code is required to change a blocked PIN code. The PUK2 code is required to change a blocked PIN2 code. If the codes are not supplied with the SIM card, contact your network operator or service provider. BARRING PASSWORD (4 DIGITS) The barring password is required when using the Call barring service. You can obtain the password from your service provider. WALLET CODE (4 TO 10 DIGITS) The wallet code is required to access the wallet services. If you key in an incorrect wallet code several times, the wallet application is blocked for five minutes. For further information, see Wallet on page 79.
RESTORE FACTORY SETTINGS To reset the menu settings to their original values, select Menu > Settings > More settings > Restore factory settings. Key in the security code and select OK. Note: The data you have keyed in or downloaded, for example the names and phone numbers saved in contacts, are not deleted. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 72 Wednesday, October 15, 2003 1:43 PM 11 Gallery In the Gallery menu you can manage images, photos, recordings, tones and video clips that you have, for example, received in multimedia messages. Your phone supports usage rights system to protect acquired content. A piece of content, for example ringing tone, can be protected and associated with certain usage rules, for example number of usage times and a certain usage period. The rules are defined in the usage rights for the content which can be delivered either together with the content or independently depending on the service provider. You may be able to update these rights. Always check the delivery terms of any content and usage rights before acquiring them, as they may be subject to a fee. The gallery uses shared memory. For more information, see Shared memory on page 7. 1 Select Menu > Gallery. A list of folders is shown. Graphics, Photos, Video clips, Record and Tones, and are the original folders on the phone. Scroll to the desired folder and select Open to view a list of files in the folder, or select Options for one of the following options that may be available:
Add folder, Delete folder, Move, Rename folder, Details, Type of view, Sort and Gallery downloads You cannot delete, rename or move the original folders on the phone. Type of view to select how the folders are displayed. Gallery downloads to download more images and tones. Select Image downloads or Tone downloads. The list of available browser bookmarks is shown. Select More bookmarks to access the list of bookmarks in the Services menu. Select the appropriate bookmark to connect t the desired site. If the connection fails, you may not be able to access the page from the service whose connection settings are currently active. In this case, enter the Services menu and activate another set of service settings. Try again to connect to the site. For availability of different services, pricing and tariffs, contact your network operator and/or the service provider. Download content only from the sources you trust.
If you opened a folder in step 2, select the file you want to view and select Open. Or, select Options and use one of the following functions that may be available for the selected file:
Delete, Send, Move, Rename Set as wallpaper, Set as ring tone, Edit image, Details, Type of view, Sort, Delete all, View in sequence, Play, Zoom, Mute audio
(Unmute audio), Set contrast. Send to send the selected file using MMS, a Bluetooth connection, or an IR
2 3
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 73 Wednesday, October 15, 2003 1:43 PM Gallery connection. Delete all to delete all the files in the selected folder. Edit image to insert text, a frame or clip-art into the selected picture. View in sequence to view the files in the folder one by one. Play to listen to or to view a sound or image file that is contained in the message. Zoom to increase the size of the image that is contained in the message.
Mute audio (Unmute audio) to mute (unmute) the sound file.
Set contrast to adjust the contrast level of the image. Update rights to update the usage rights of the selected file. The option is only shown if the rights update is supported by the file. Copyright protections may prevent some images, ringing tones, and other content from being copied, modified, transferred or forwarded. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 74 Wednesday, October 15, 2003 1:43 PM 12 Camera You can take photos and record video clips with the built-in camera. The camera lens is on the back of the phone, and the display of the phone works as a viewfinder. The camera produces pictures in JPEG format and the video clips in H.263 (SubQCIF) format. You cannot use the camera, if the keyboard is open. The camera includes a self-timer if you want to be included in the photo. The timer allows you 10 seconds before the camera takes the photo. If there is not enough memory to take a new photo or record a video clip, you need to free some by deleting old photos or other files from Gallery. The camera uses shared memory. For more information, see Shared memory on page 7. Note: Obey all local laws governing the taking of pictures.
CAMERA SETTINGS Use this procedure to choose your camera settings. Select Menu > Camera > Settings. Choose the settings for the following:
Image quality to define how much the photo file will be compressed when saving the image. Select High, Normal or Basic. The High setting provides the best image quality but takes more memory. Video clip length to select the length for video clips recorded with the camera. Select Default if you intend to send the file as a multimedia message. Camera sounds to set the shutter sound and the self-timer tone to On or Off. Default title to define the prefix the camera should use to name the photo files. If you select Automatic, the camera uses the prefix Image with an incremental number (such as Image001, Image 002). If you select My title, you can key in a prefix for a series of photos and the camera numbers the photo files for you. For example (PoolParty001, PoolParty002).
TAKE A PHOTO 1 Select Menu > Camera and choose from the following:
Night modeto take a photo when the lightning is dim. Standard phototo take a basic photo using landscape orientation. Portrait phototo take a photo using portrait orientation. Note: To quickly access the camera the standby mode (with standard photo view), move the joystick up.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 75 Wednesday, October 15, 2003 1:43 PM Camera 2 3 4 The image appears on the display, and you can use the display as a viewfinder. Select Capture. The phone saves the photo in the Photos folder of the Gallery menu. The saved photo appears on the display. Select Back to take another photo, or select Options and select from the following:
Zoomto enlarge the view. Use the joystick to reposition the picture in the viewfinder window. Sendto send the photo using MMS, IR or Bluetooth technology. Renameto change the name of the photo. Open Galleryto view the folders in the Gallery menu. Set contrastto adjust the contrast for the photo. Set as wallpaperto save the photo as background wallpaper on your phone. Detailsto see the name, size, resolution, date created, format, and copyright information.
To use the viewfinder options, select Options and select from the following:
View Previousto view the previous photo. Open Galleryto view the folders in the Gallery menu. Change modeto change the type of photo or video. Self-timerto take a photo using a delay. To use the self-timer, select Start and, after the timeout period (approximately 10 seconds) the camera takes the photo and saves it in the Gallery menu. While the self-timer is running, a beeping sound is heard(needsverificationxxxx).
RECORD A VIDEO CLIP icon and the remaining recording Select Menu > Camera > Video > Record. The red time are shown at the top of the display. To stop the recording, select Stop and the video clip is saved in the Video clips folder of the Gallery menu. To pause the recording, select Pause. To resume the recording, select Continue. Select Options to select, for example, an option to set the desired operation mode, mute or unmute the microphone, or access the gallery. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 76 Wednesday, October 15, 2003 1:43 PM 13 Organizer
ALARM CLOCK The alarm clock uses the time format that has been set for the clock. The alarm clock works even when the phone is switched off. Select Menu > Organizer > Alarm clock.
Select Alarm time, key in the alarm time and select OK. To change the alarm time, select On. Select Alarm tone, and you can select a default alarm tone, personalize your alarm tone by selecting one from the ringing tone list or from the gallery. When the alarm time expires, the phone sounds an alert tone, and flashes Alarm! along with the current time on the display.
Note: If the alarm time is reached while the phone is switched off, the phone switches itself on and starts sounding the alarm tone. If you select Stop, the phone prompts you to activate the phone for calls by displaying the option Switch the phone on?. Select No to switch off the phone or Yes to make and receive calls. Select Stop to stop the alarm. If you let the alarm continue for a minute or if you select Snooze, the alarm stops for about ten minutes and then resumes. Note: Do not select Yes when wireless phone use is prohibited or when it may cause interference or danger.
CALENDAR The calendar helps you to keep track of reminders, calls that you need to make, meetings, and birthdays. The calendar uses shared memory. For more information, see Shared memory on page 7. 1 Select Menu > Organizer > Calendar. Note: To quickly view the current Calendar month, move the joystick to the right in the standby mode. 2 3 4 Scroll to the day that you want and select View. The current day is indicated by a frame around the day. If there are any notes set for the day, the day is shown in bold type. To view a single note, scroll to the desired note, and select View. You can scroll to view the entire note. To perform other tasks, select Options and choose from the following:
Make a noteto create a note.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 77 Wednesday, October 15, 2003 1:43 PM Organizer
Delete, Edit, or Move optionsto erase, change, or move a note. Go to dateto go directly to a new date. Send noteto send the note to a compatible phone calendar using IR, calendar, text message, MMS, or Bluetooth technology. Copyto copy the note to another day. Settingsto set the date, time, date or time format, or the first day of the week. In the Auto-delete option you can set the phone to automatically delete old notes after a specified time. However, the repeated notes, for example birthday notes, will not be deleted. Go to to-do listto take a shortcut to the to-do list. Add a calendar note For information on keying in letters and numbers, see Tips for writing text on page 28. Select Menu > Organizer > Calendar or move the joystick to the right in the standby mode to go to the monthly view. Scroll to the date that you want, and select View. Select Add note if there are no notes for the day, or select Options > Make a note and select:
CalendarKey in the note and select Save. (or select Options and search for the name in contacts and select OK). Key in the location of the meeting, select Save. Key in the start time for the meeting and select OK, and then key in the end time and select OK To set the alarm for the note, select With tone or Silent (no alarm tone) and then set the alarm time. CallKey in the phone number, and select Save. Key in the name, select Save.
(Instead of keying in the phone number, search for the name and number in contacts). Key in the time for the call and select OK. To set the alarm for the note, select With tone or Silent (no alarm tone) and then set the alarm time. BirthdayKey in the name (or select Options and search for it in contacts) and select Save. Then key in the year of birth and select OK. To set the alarm for the note, select With tone or Silent (no alarm tone) and then set the alarm time. NoteKey in the note, and select Save. Key in the end day for the note and select OK. To set the alarm for the note, select With tone or Silent (no alarm tone) and set the alarm time. ReminderKey in the subject for the reminder, and select Save. To set the alarm for the note, select Alarm on and set the alarm time. is displayed when you view the notes. When you have set the alarm, the icon When the phone sounds an alarm for a note The phone beeps and displays the note. When a call note icon is shown on the display, you can call the displayed number by pressing the Send key. To stop the alarm and view the note, select View. Select Snooze to phone returns to the standby mode To stop the alarm without viewing the note, select Exit.
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 78 Wednesday, October 15, 2003 1:43 PM
TO-DO LIST In the to-do list, you can save notes for tasks that you have to do and manage the tasks in different ways. The to-do list uses shared memory. For more information, see Shared memory on page 7. Select Menu > Organizer > To-do list.
To add a new note when the task list is empty, select Add note, or select Options and select Add if you have saved tasks. Select Save and select the priority for the note High, Medium, or Low. The phone automatically sets the deadline without an alarm for the note. To change the deadline, view the note and select the option for deadline. In the task list, you can select Options, and select an option for, example to sort the tasks by priority or by deadline, send them to another phone, save them as a calendar note, or access the calendar. To view a task, scroll to the desired task on the list and select View. To edit the displayed task, select Edit.
NOTES You can use the Notes application for writing and sending notes using IR, SMS or MMS. The Notes application uses shared memory. For more information, see Shared memory on page 7. 1 Select Menu > Organizer > Notes, or type a character when the messaging keyboard is open. The phone will ask you to set the date and time, if they have not already been set when you start to write a note. To add a new note, select Add note, if the list of notes is empty, or select Options >
Make a note. To view a note, scroll to the desired note on the list and select View. To edit the displayed note, select Edit. Key in the note and select Save. If you select Options, you can select Insert time & date to add the current time and date to the note. If there is not enough space for time and date, the phone will ask you to delete the appropriate number of characters from your note. You can also send the note using IR, Bluetooth connection, MMS, or as a text message
(SMS) to another compatible phone. If the note is too long to be sent as a text message, the phone will ask you to delete the appropriate number of characters from your note. 2 3
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 79 Wednesday, October 15, 2003 1:43 PM
WALLET Organizer You can use the wallet to pay for your purchases made from the browser. You can save your personal information, such as credit card numbers and addresses in the wallet, and then use the data that are saved in the wallet during browsing. You can also save access codes to mobile services that request a user name and password. The data in the wallet is protected with a wallet code that you can define when you access the wallet for the first time. At Create wallet code: key in the code and select OK to confirm it and at Verify wallet code: key in the code again and select OK. To delete all the contents of the wallet and the wallet code, key in *#7370925538# (*#res wallet# in letters) in the standby mode. You also need the security code for the phone. See Access codes on page 70. Access the wallet Select Menu > Organizer > Wallet. Key in your wallet code and select OK. You then can choose from the following options:
Wallet profilesto create card combinations, for example, for different services. A wallet profile is helpful if the service asks you to fill in many data items. You can select the appropriate wallet profile instead of selecting different cards separately. Cardsto save personal card information. You can save payment card, loyalty card and access card information, including information such as user name and password combinations for different services. Ticketsto save notifications of e-tickets that you have bought using your mobile service. To view the tickets, scroll to the desired ticket and select View. Receiptsto save receipts for mobile purchases. Personal notesto save all kinds of personal information that you want to protect by the wallet PIN code. Settingsto manage your wallet settings. For more information, see Wallet settings on page 81. Save card details 1 2 Select Menu > Organizer > Wallet > Cards. Scroll to one of the following card types to save the details, and select Select:
Payment card for credit and debit cards. Loyalty card for membership cards. Access card for personal user names and passwords to online services. Address card for basic contact information for home/office. User info card for customized personal preferences for online services. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 80 Wednesday, October 15, 2003 1:43 PM 3 If there are no cards in the folder, select Add new to create a new card. To view saved details of the card, scroll to the desired card and select View. Fill in the fields for the details and select Done. 4 You can also receive card information to your phone over the air from a card issuer or service provider. You will be notified as to which category the card belongs to. Save or discard the received card. You can view, but not edit the saved card. For availability of receiving card information over the air, contact the card issuer or service provider. Add personal notes You can save personal notes, for example, account numbers, passwords, codes or notations. Access the wallet and select Personal notes. To create a new personal note, select Add new. To view a note, scroll to the desired note on the list and select View. To edit the displayed note, select Edit. When viewing a note, you can select the following options Send via text msg., Copy to calendar or Use detail. Create a wallet profile When you have saved your personal card details, you can combine them together to create a wallet profile. You can use the wallet profile to retrieve wallet data from different cards while browsing. 1 2 3 Access the wallet and select Wallet profiles. To create a new wallet profile, select Add new. Fill in the following fields and select Done. Some of the fields contain data that are selected from the wallet. You need to save the data before you can create a wallet profile.
Wallet profile name: enter a name for the profile.
Select payment card nextselect a card from the payment card list. Select loyalty card nextselect a card from the loyalty card list. Select access card nextselect a card from the access card list. Select user info card nextselect a card from the user data card list. Select billing address nextselect an address from the address card list. Select shipping address nextselect an address from the address card list. Select receipt delivery address nextselect an address from the address card list. Select receipt delivery method nextselect the way to deliver the receipt, Receipt to phone number or Receipt to e-mail address.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 81 Wednesday, October 15, 2003 1:43 PM Organizer Wallet settings Access the wallet and select Settings. Select Change code to change the wallet code.
Phone ID to set the RFID code.
Guidelines for wallet purchases To do your shopping, access the desired service site that supports the wallet. The service needs to support the Electronic Commerce Language specification. See Connect to a service on page 90. Choose the product that you want to buy and read carefully all provided information before your purchase.
Note: The text may not fit within a single screen. Therefore, make sure to scroll through and read all of the text before your purchase. To pay for the items, the phone asks whether you want to use the wallet or not. The phone also asks for your wallet PIN code. Select the card you want to pay with from the Payment cards list. Provided that the data form you receive from the service provider supports the Electronic Commerce Modeling Language specification, the phone automatically fills in the credit card information or the wallet profile from the wallet. Approve the purchase, and the information is forwarded. You may receive an acknowledgement or a digital receipt of the purchase. To close the wallet, select Close wallet. If you do not use the wallet for 5 minutes, it will be automatically closed. Note: If you have tried to access or have accessed confidential information requiring passwords (for example, your bank account), empty the cache of your phone after each use.
SYNCHRONIZATION Synchronization allows you to save your calendar and contacts data on a remote Internet server or on a compatible PC. If you have saved data on the remote Internet server, you can synchronize your phone by starting the synchronization from the phone. Synchronizing to the remote server is a network service. You can also synchronize your contact and calendar data to correspond with the data on your compatible PC by starting the synchronization from your PC. The contact data in your SIM card will not be synchronized. Note: Answering an incoming call during synchronization will end the synchronization process and you will need to restart it. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 82 Wednesday, October 15, 2003 1:43 PM Synchronize from your phone Before synchronizing from your phone, you may need to do the following:
Subscribe to a synchronization service. For more information on availability and the synchronization service settings, contact your network operator or service provider. Retrieve the synchronization settings from your network operator or service provider. Set the connection settings you need for synchronization. See How to set up the phone for a service on page 89.
To start the synchronization from your phone, use the following steps:
1 Activate the connection settings that you need for synchronization. See How to set up the phone for a service on page 89. Select Menu > Organizer > Synchronization > Settings > Active Internet sync. settings. Scroll to the set you wish to activate and select Activate. 2 3 4 Mark the data to be synchronized. 5 Select Menu > Organizer > Synchronization > Synchronize. The marked data in the active set will be synchronized after confirmation. Note: Synchronizing for the first time or after an interrupted synchronization may take up to 30 minutes to complete, if contacts or calendar are full. Obtain synchronization settings You may receive the synchronization settings as an over the air message from the network operator or service provider. To receive the settings over the air, see Over-the-air settings service on page 22. To key in the settings manually, use the following steps:
1 2 Select Menu > Organizer > Synchronization > Settings. Select Active Internet sync. settings. Scroll to the set you wish to activate, and select Activate. You need to activate the set where you want to save the synchronization settings. A set is a collection of settings required to make a connection to a service. Select Edit active Internet sync. settings. Select each setting one by one and key in all the required settings.
Settings' name. Key in the name for the set and select OK. Data to be synchronized. Mark the data you want to synchronize, Contacts and/
or Calendar, and select Done. Database addresses. Select Contacts database and/or Calendar database. User name. Key in the user name and select OK. Password. Key in the password and select OK.
3
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 83 Wednesday, October 15, 2003 1:43 PM Organizer
Synchronization server. Key in the name of the server and select OK. Connection settings to define connection settings required for synchronization. Select each of the settings one by one and key in all the required settings. Contact your network operator or service provider for the settings. Select PC sync. settings to key in the settings for server alerted synchronization. Select and key in User name and Password. Synchronize from your PC To synchronize contacts and the calendar from your PC, use an IR or Bluetooth connection, or a data cable. You also need the PC Suite software of your phone installed on your PC. Start the synchronization from your PC using PC suite. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 84 Wednesday, October 15, 2003 1:43 PM 14 Applications
GAMES The games use shared memory. For more information, see Shared memory on page 7. About photosensitive seizures A very small percentage of people may experience a seizure when exposed to certain visual images, including flashing lights or patterns that may appear in video games. Even people who have no history of seizures or epilepsy may have an undiagnosed condition that can cause photosensitive epileptic seizures while watching video games. These seizures may have a variety of symptoms, including lightheadedness, altered vision, eye or face twitching, jerking or shaking of arms or legs, disorientation, confusion, or momentary loss of awareness. Seizures may also cause loss of consciousness or convulsions that can lead to injury from falling down or striking nearby objects. Immediately stop playing and consult a doctor if you experience any of these symptoms. Adults who allow teenagers (or children) to play the games should watch for or ask their children about these symptoms as they are more likely than adults to experience these seizures. The risk of photosensitive epileptic seizures may be reduced by playing in a well-
lit room and by not playing when you are drowsy or fatigued. If you or any of your relatives have a history of seizures or epilepsy, consult a doctor before playing. Play safely Take a break from playing games at least every half hour. Stop playing immediately if you begin to feel tired of if you experience an unpleasant sensation or pain in your hands or arms. If the condition persists, consult a doctor. How to play games Select Menu > Applications > Games. Select:
Select game and scroll to a game or a game set (the name depends on the game) and select Open to launch a game. For functions that you can access by selecting Options in the game list, see Other options for an application or application set on page 85. Game downloads to download a game to the phone.
Memory to view the amount of memory that is available for game and application installations. Settings to set sounds, lights and shakes for the game.
Note: Running some games may consume the battery faster (and you may need to connect the phone to the charger).
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 85 Wednesday, October 15, 2003 1:43 PM
APPLICATIONS Applications The applications use shared memory. For more information, see Shared memory on page 7. Select Menu > Applications > Applications. Select from the following options:
Select application and scroll to an application or application set (the name depends on the application) and select Open to launch an application. For functions that you can access by selecting Options in the applications list, see Other options for an application or application set on page 85. App. downloads to download an application to the phone.
Memory to view the amount of memory that is available for game and application installations. Note: Running some applications may consume the battery faster and you may need to connect the phone to the charger. Other options for an application or application set
Delete to delete the application or application set from your phone. If you delete a pre-installed application or an application set from your phone, you may download it again to your phone from the Nokia Software Market, www.softwaremarket.nokia.com.
Web access to restrict the application from accessing the network. Select Ask first and the phone will ask you for net access, Allowed to allow the net access, or Not allowed not to allow the net access. Update version to check if a new version of the application is available for download from the services (network service).
Web page to provide further information or additional data for the application from an
Internet page. This is a network service and the menu is shown only if an Internet address has been provided with the application. Details to give additional information about the application.
Download a game or an application Your phone supports J2METM Java games and applications. Make sure that the application or a game is compatible with your phone before downloading it. You can download new Java applications in different ways:
Select Menu > Applications > Applications > App. downloads or select Menu >
Applications > Games > Game downloads. The list of available browser bookmarks appears. Select More bookmarks to access the list of bookmarks in the Services menu. Select the appropriate bookmark to connect to the desired site. If the connection fails, you may not be able to access the page from the service whose connection settings are currently active. In this case, enter the Services menu and activate another set of service settings. (See Connect to a service on page 90. (Try again to connect to the Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 86 Wednesday, October 15, 2003 1:43 PM
site. For the availability of different services, pricing and tariffs, contact your network operator and/or the service provider. Select Menu > Services > Download links to download an appropriate application or game. Use the Nokia Application installer from PC Suite to download the applications to your phone. When downloading a game or an application, it may be saved in the Games menu instead of the Applications menu. Note: Nokia does not warrant for applications from other sites. If you choose to download Java applications from them, you should take the same precautions, for security or content, as you would with any site.
EXTRAS Voice recorder You can record pieces of speech, such as a name and phone number to write them down later. The recorder cannot be used when a data call or connection is active. Note: Obey all local laws governing recording of calls. Make a recording 1 2 Select Menu > Applications > Extras > Voice recorder. To start the recording, select Record. To start the recording during a call, select Options > Record. While recording a call, all parties to the call will hear a faint beeping sound. When recording, hold the phone in the normal position near to your ear. To end the recording, select Stop. The recording will be saved in the Recordings folder of the Gallery menu. To listen to the last recording, select Replay last. To send the recording as a multimedia message, select 3 4 List of recordings Select Menu > Applications > Extras > Voice recorder > Recordings list. The list of folders in the Gallery appears. Scroll to Recordings, select Open and you can select some of the options for files in the Gallery.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 87 Wednesday, October 15, 2003 1:43 PM Applications Select Menu > Applications > Extras > Calculator. Calculator The calculator in your phone adds, subtracts, multiplies, divides, calculates the square and the square root, and converts currency values. 1 2 When 0 is displayed on the screen, key in the first number of the calculation, press the
# key for a decimal point or the corresponding symbol on the keyboard, if the keyboard is open. Select Options > Add, Subtract, Multiply, Divide, Square, Square root or Change sign. If the keyboard is open, you can also use the corresponding calculation symbols of the keyboard, if available. 3 Note: Alternatively, press the * key once to add, twice to subtract, three times to multiply or four times to divide, if you are using the calculator with the keyboard closed. Key in the second number. For the total, select Equals. Repeat steps 3 to 5 as many times as is necessary. To start a new calculation, press and hold Clear. 4 5 6 Note: This calculator has a limited accuracy and is designed for simple calculations. Convert currency 1 2 Select Menu > Applications > Extras > Calculator. To save the exchange rate, select Options > Exchange rate. Select either of the displayed options. Key in the exchange rate, press the # key for a decimal point, and select OK. The exchange rate remains in the memory until you replace it with another one. To perform the currency conversion, key in the amount to be converted, select Options > In domestic or In foreign. 3 You can also perform the currency conversion in the standby mode. Key in the amount to be converted, select Options > In domestic or In foreign. Note: When you change base currency, you must key in the new rates because all previously set exchange rates are set to zero. Countdown timer Select Menu > Applications > Extras > Countdown timer. Key in the time in hours and minutes and select OK. If you wish, write a note that will be displayed when the time expires, and select OK to start the countdown timer. To change the countdown time, select Change time, or to stop the timer, select Stop timer. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 88 Wednesday, October 15, 2003 1:43 PM If the alarm time is reached when the phone is in the standby mode, the phone sounds a tone and shows the note, if available or Countdown time up. Stop the alarm by pressing any key. If no key is pressed, the alarm stops automatically within 30 seconds. To stop the alarm and to delete the note, select OK. Stopwatch You can measure time and take split or lap times using the stopwatch. During timing, the other functions of the phone can be used. To set the stopwatch to run in the background, press the End key. Note: Using the stopwatch or allowing it to run in the background when using other features increases the demand on battery power and reduces the battery life. Take split times or lap times 1 Select Menu > Applications > Extras > Stopwatch. Select Split timing or Lap timing and select Start. You can select Continue if you have set the stopwatch to run in the background. select Split to take a split time, Lap to take a lap time or Stop to stop the timing. You can scroll through the split or lap times shown below the overall time. select Save to save the lap or split times as a set of times. To reset the times or to continue timing, select Options > Reset or Start. 2 3 View and delete times Select Menu > Applications > Extras > Stopwatch. If the stopwatch has not been reset, you can select Show last to view the most recent measured time. Select View times and a list of names or the final times of the time sets is shown. Select the time set that you want to view. To delete the saved times, select Delete times. Select Delete all and select OK, or select One by one, scroll to the times that you want to delete, select Delete and select OK.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 89 Wednesday, October 15, 2003 1:43 PM Services 15 Services You can access various services with the multi-mode browser, such as weather reports, news, flight times, financial information and entertainment. Check the availability of these services, pricing and tariffs with your network operator and/
or the service provider whose service you wish to use. Service providers will also give you instructions on how to use their services. With the multi-mode browser you can view the services that use wireless mark-up language
(WML) or extensible hypertext markup language (XHTML). Since the phone display area and the memory capacity are much smaller than in a computer, Internet content is displayed differently on the phone. You may not be able to view all details of the Internet pages.
MAIN STEPS FOR USING SERVICES Save the service settings that are required to access the service that you want to use. 1 2 Make a connection to the selected service. 3 4 Start browsing the pages of the service. Once you are finished browsing, end the connection to the service.
HOW TO SET UP THE PHONE FOR A SERVICE You may receive the service settings as an over the air message from the network operator or service provider that offers the service that you want to use.You can also key in the settings manually or add and edit the settings using PC Suite. For more information and for the appropriate settings, contact the network operator or service provider that offers the service that you want to use. To receive the service settings over the air, see Over-the-air settings service on page 22. Key in the service settings manually 1 2 Select Menu > Services > Settings > Connection settings > Active service settings. Scroll to the connection set that you would like to activate and select Activate. You need to activate the connection set where you want to save the service settings. A connection set is a collection of settings that are required to connect to a service. Select Edit active service settings. Select each of the settings one by one and key in all the required settings according to the information you have received from your network operator or service provider. Bearer-related settings are in the Bearer settings menu. 3 Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 90 Wednesday, October 15, 2003 1:43 PM Connect to a service First, make sure that the service settings of the service that you want to use have been activated. To activate the settings:
1 2 Next, make a connection to the service. There are three ways to connect:
Select Menu > Services > Settings > Connection settings > Active service settings. Scroll to the set you want to activate and select Activate. Open the start page of the service, for example the home page of the service provider:
select Menu > Services > Home, or in the standby mode, press and hold the 0 key. If the keyboard is open, press the corresponding number key. Select the bookmark of the service:
Select Menu > Services > Bookmarks, and select a bookmark. If the bookmark does not work with the current active service settings, activate another set of service settings and try again. Key in the address of the service:
Select Menu > Services > Go to address. Key in the address of the service, and select OK. It is not necessary to add the prefix http:// in front of the address since it will be added automatically.
Browse the pages of a service After you have made a connection to the service, you can start browsing its pages. The function of the phone keys may vary in different services. Follow the text guides on the phone display. For more information, contact your service provider. If EGPRS is selected as the data bearer, the icon during browsing. If you receive a call or a text message, or make a call during an EGPRS connection, the icon appears on the top right of the display to indicate that the EGPRS connection has been suspended (on hold). After the call the phone tries to reconnect the EGPRS connection. USE THE PHONE KEYS WHILE BROWSING
Move the joystick up or down to browse through the page.
To select a highlighted item, press the joystick briefly or press the Send key. To enter letters and numbers, press the keys 09 and to enter special characters, press the key the * key. When the keyboard is open, you can key in letters and numbers normally. is shown on the top left of the display OPTIONS WHILE BROWSING select Options to view the following options that may be available. The service provider may also offer other options. Select
Home to return to the home page. Bookmarks. See Bookmarks on page 92. Download links to show the list of bookmarks for downloading.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 91 Wednesday, October 15, 2003 1:43 PM Services
Add bookmark to save the page as a bookmark. Shortcuts to open a new list of options that are, for example, specific to the page. Other options to show a list of other options, for example, options for the wallet and some security options. Reload to reload and update the current page. Quit. See Disconnect from a service on page 91. Note: If you access confidential information requiring passwords, such as your bank account, empty the cache of your phone after each use. (See Cache memory on page 93. DIRECT CALLING The multi-mode browser supports functions that you can access while browsing. You can make a voice call, send DTMF tones while a voice call is in progress, and save a name and a phone number from a page. Disconnect from a service To quit browsing and to end the connection, select Options > Quit. When Quit browsing?
is shown, select Yes. Alternatively, press the End key twice. The phone ends the connection to the service. Appearance settings of the multi-mode browser While browsing, select Options > Other options > Appear. settings, or in the standby mode, select Menu > Services, Settings > Appearance settings. Select:
Text wrapping and select On if you want the text to continue on the next line or select Off, if you want it to be abbreviated if it is too long to be shown on one line. Show images and select No, if you do not want the pictures on the page to be shown. This can speed up the browsing of pages that contain a lot of pictures. Font size and select Small, Normal or Large. Alerts and select Alert for unsecure connection and Yes to set the phone to alert when a secure connection changes to an unsecure one during browsing. Select Alert for unsecure items and Yes to set the phone to alert when a secure page contains an unsecure item. Encoding and select an option in Content encoding to change the encoding for the web page content. The default value is Western. Select UTF-8 URLs and On, if you want the phone to send an URL as an UTF-8 encoding.
Cookies A cookie is data that a site saves in the browser cache memory of your phone. The data can be, for example, your user information or your browsing preferences. Cookies will be saved until you clear the cache memory, see Cache memory on page 93. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 92 Wednesday, October 15, 2003 1:43 PM 1 While browsing, select Options > Other options > Security > Cookies, or in the standby mode, select Menu > Services > Settings > Security settings > Cookies. Select Allow or Reject to allow or prevent the phone receiving cookies. 2 Bookmarks You can save addresses as bookmarks in the phone memory. 1 While browsing, select Options > Bookmarks, or in the standby mode, select Menu >
Services > Bookmarks. Select the desired bookmark or press the joystick briefly to make a connection to the page associated with the bookmark. To manage bookmarks, select Options and select View, Edit, Delete, Send, or New bookmark. 2 3 Your phone may have some pre-installed bookmarks for sites that are not affiliated to Nokia. Nokia does not guarantee or endorse these sites. If you choose to access them, you should take the same precautions for security and content as you would with any Internet site. RECEIVING A BOOKMARK When you have received a bookmark as an Over The Air (OTA) message, select Save to add it to the bookmark list, or select Options > View or Discard. Downloads 1 To download more tones, images, games or applications to your phone, select Menu >
Services > Download links. Select Tone downloads, Image downloads, Game downloads or App. downloads to download tones, images, games or applications, respectively. Download content only from sources you trust. Service inbox The phone is able to receive service messages (pushed messages) from your service provider. To set the phone to receive service messages, select Menu > Services > Settings > Service inbox settings > Service messages > On.
To view a received service message, select View. If you select Exit the message is moved to the Service inbox. To view the service message later, select Menu > Services >
Service inbox. 2
While browsing, select Options > Other options > Service inbox. Scroll to the message that you want and select Retrieve to download the marked content from the web page, or select Options > Details or Delete.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 93 Wednesday, October 15, 2003 1:43 PM Services Cache memory The information or services you have accessed are stored in the cache of your phone. A cache is a buffer memory, which is used to store data temporarily. To empty the cache while browsing, select Options > Other options > Clear the cache. To empty the cache in the standby mode, select Menu > Services > Clear the cache. Browser security Security features may be required for some services, such as banking services or shopping on a site. For such connections you need security certificates and possibly a security module, which may be available on your SIM card. For more information, contact your service provider. IMPORTANT INFORMATION ABOUT CERTIFICATES While the use of certificates makes the risks involved in remote connections and software installation considerably smaller, they must be used correctly in order to benefit from increased security. The existence of a certificate does not offer any protection by itself. The certificate manager must contain correct, authentic, or trusted certificates for increased security to be available. Certificates have a restricted lifetime. If Expired certificate or Certificate not valid yet is shown (even if the certificate should be valid), check that the current date and time in your phone are correct. Before changing these settings, make sure that you really trust the owner of the certificate and that the certificate really belongs to the listed owner. SECURITY MODULE The security module can contain certificates as well as private and public keys. The security module may improve the security services for applications requiring browser connection, and allows you to use a digital signature. The certificates are saved in the security module by the service provider. Select Menu > Services > Settings > Security settings > Security module settings. Select:
Security module details to show the security module title, its status, manufacturer and serial number.
Module PIN request to set the phone to ask for the module PIN when using services that are provided by the security module. Key in the code and select On. To disable the module PIN request, select Off. Change module PIN to change the module PIN, if allowed by the security module. Key in the current module PIN code; then key in the new code twice. Change signing PIN. Select the signing PIN that you want to change. Key in the current PIN code; then key in the new code twice.
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 94 Wednesday, October 15, 2003 1:43 PM CERTIFICATES There are three kinds of certificates: server certificates, authority certificates and user certificates.
is displayed during a connection if the data transmission between The phone uses a server certificate to improve security in connection between the phone and the gateway. The phone receives the server certificate from the service provider before the connection is established and its validity is checked using the authority certificates that are saved on the phone. Server certificates are not saved. The security icon the phone and the gateway (identified by the IP address in the Edit active service settings) is encrypted. However, the security icon is not an indication that the data transmission between the gateway and the content server (place where the requested resource is saved) is secure. It is up to the service provider to secure the data transmission between the gateway and the content server. Authority certificates are used by some services, such as banking, for checking the validity of other certificates. Authority certificates can be either saved in the security module by the service provider, or they can be downloaded from the network, if the service supports the use of authority certificates. User certificates are issued to users by a Certifying Authority. User certificates are required, for example, to create a digital signature and they associate the user with a specific private key in a security module.
DIGITAL SIGNATURE You can create digital signatures with your phone. The signature can be traced back to you through the private key in the security module and the user certificate that was used to create the signature. Using the digital signature may be considered to be equal to a normal signature on any legal document. To create a digital signature, select a link on a page, for example, the title of the book you want to buy and its price. The text that needs to be signed (possibly including amount, date, etc.) will be shown. Check that the header text is Read and that the digital signature icon is shown. Note: If the digital signature icon does not appear, there is a security breach and you should not enter any personal data such as your signing PIN. To add the digital signature to the text, read all of the text first and then you can select Sign. The text may not fit on a single screen. Therefore, make sure to scroll through and read all of the text before signing. Select the user certificate that you want to use. Key in the signing PIN and select OK. The digital signature icon will disappear and the service may display a confirmation of your purchase.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 95 Wednesday, October 15, 2003 1:43 PM SIM services 16 SIM services In addition to the functions that are available on the phone, your SIM card may provide additional services that you can access in Menu 10. Menu 10 is only shown if it is supported by your SIM card. The name and contents of the menu depend entirely on the service available. Note: For availability, rates and information on using SIM services, contact your SIM card vendor. You can set the phone to show you the confirmation messages that are sent between your phone and the network when you are using the SIM services by selecting the option Yes Confirm SIM service actions in Phone settings. Note: Accessing these services may involve sending a text message (SMS) or making a phone call for which you may be charged. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 96 Wednesday, October 15, 2003 1:43 PM 17 PC Connectivity You can send and receive e-mail, and access the Internet when your phone is connected to a compatible PC using an IR or Bluetooth connection, or a data cable. You can use your phone with a variety of PC connectivity and data communications applications. With PC Suite you can, for example synchronize contacts, calendar, to-do notes and notes between your phone and the compatible PC. You can find more information and downloadable files on the Nokia Website, www.nokia. com/support/phones/6820.
PC SUITE The PC Suite contains the following applications:
Nokia Application Installer to install Java applications from the compatible PC to the phone. Nokia Image Converter to create images in supported formats for portrait images, multimedia messages, or wallpapers, and to transfer them to your phone. Nokia Sound Converter to edit polyphonic ringing tones in supported formats to be compatible with your phone and transfer them to your phone. Nokia Content Copier to copy data or back-up data from your phone to a compatible PC or to another compatible Nokia phone. Nokia Settings Manager to edit and send your browser bookmarks or update the connection sets to your phone. Nokia Phone Editor to send text messages (SMS) and edit the contacts in your phone. Nokia Phone Browser to view the contents of the Gallery folder of your phone on a compatible PC. You can browse picture and audio files in the phone memory and to transfer them between phone and PC. Nokia Multimedia Player to play multimedia (MMS) messages, and audio and video files. You can also create playlists of your favorite multimedia files. Nokia PC Sync to synchronize contacts, calendar, to-do notes and notes between your phone and your PC. Nokia 6820 data modem drivers enable you to use your phone as a modem. Nokia Modem Options contains settings for HSCSD and GPRS connections. Nokia Connection Manager to select the connection type between the PC and the phone.
Copyright protections may prevent some images, ringing tones and other content from being copied, modified, transferred or forwarded.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 97 Wednesday, October 15, 2003 1:43 PM PC Connectivity EGPRS, HSCSD and CSD You can use the EGPRS (enhanced GPRS), GPRS (general packet radio service), HSCSD (high speed circuit switched data) and CSD (circuit switched data, GSM data) data services. For availability and subscription to data services, contact your network operator or service provider. The use of HSCSD service consumes the battery more quickly than normal voice or data calls. You may need to connect the phone to a charger for the duration of data transfer. For more information, see EGPRS modem settings on page 67.
DATA COMMUNICATIONS APPLICATIONS For information on using a data communications application, refer to the documentation provided with it. Note: Making or answering phone calls during a computer connection is not recommended as it might disrupt the operation. For a better performance during data calls, place the phone on a stationary surface with the keypad facing downward. Do not move the phone or hold it in your hand during a data call. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 98 Wednesday, October 15, 2003 1:43 PM 18 Enhancements This section provides information about the batteries, chargers, and accessories for your phone. Be aware that the information in this section is subject to change as the batteries, chargers, and accessories change. Warning:Use only batteries, chargers and accessories approved by the phone manufacturer for use with this particular phone model. The use of any other types may invalidate any approval or warranty applying to the phone, and may be dangerous. For availability of approved accessories, please check with your dealer.
SAFETY Keep all enhancements out of the reach of small children.
When you disconnect the power cord of any enhancement, grasp and pull the plug, not
the cord. Check regularly that any vehicle-installed enhancements are mounted and are operating properly. Installation of any complex car enhancements must be made by qualified personnel only. Check the model number of any charger before use with this device. This device is intended for use when supplied with power from ACP-7, ACP-8, ACP-9, ACP-12, LCH-8, LCH-9, LCH-
12, and ACH-1.
ENHANCEMENTS FOR YOUR PHONE For detailed information on accessories and enhancements, contact your authorized Nokia dealer or visit the Nokia Web site at www.nokia.com/us. Audio
Wireless Headset (HDW-2)
Wireless Clip-on Headset (HS-3W)
Wireless Boom Headset (HS-4W)
Car
Wireless Car Kit (CARK112)
Wireless Car Kit (CK-1W) Boom Headset (HDB-4) Headset (HS-5) Retractable Headset (HS-10)
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 99 Wednesday, October 15, 2003 1:43 PM Enhancements Car Installation Kit (CARK 126) Nokia Observation Camera Image Frames (SU-4/7) Image Viewer (SU-2)
Imaging
Messaging
Digital Pen Data
Power
Data Cable (DKU-5) Desktop Stand (DCV-14) Battery, 850 mAh, Li-ion (BL-5C) Retractable Charger (AC-1) Travel Charger (ACP 12) Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 100 Wednesday, October 15, 2003 1:43 PM 19 Reference Information
BATTERY INFORMATION Charging and Discharging Your phone is powered by a rechargeable battery. A new batterys full performance is achieved only after two or three complete charge and discharge cycles!
The battery can be charged and discharged hundreds of times but it will eventually wear out. When the operating time (talk time and standby time) is noticeably shorter than normal, it is time to buy a new battery. Use only batteries approved by the phone manufacturer and recharge your battery only with the chargers approved by the manufacturer. Unplug the charger when not in use. Do not leave the battery connected to a charger for longer than a week, since overcharging may shorten its lifetime. If left unused a fully charged battery will discharge itself over time. Temperature extremes can affect the ability of your battery to charge. Use the battery only for its intended purpose. Never use any charger or battery which is damaged. Do not short-circuit the battery. Accidental short-circuiting can occur when a metallic object (coin, clip or pen) causes direct connection of the + and - terminals of the battery
(metal strips on the battery) for example when you carry a spare battery in your pocket or purse. Short-circuiting the terminals may damage the battery or the connecting object. Leaving the battery in hot or cold places, such as in a closed car in summer or winter conditions, will reduce the capacity and lifetime of the battery. Always try to keep the battery between 15C and 25C (59 F and 77 F). A phone with a hot or cold battery may temporarily not work, even when the battery is fully charged. Batteries' performance is particularly limited in temperatures well below freezing. Do not dispose of batteries in a fire!
Dispose of batteries according to local regulations (such as recycling). Do not dispose as household waste. Battery operation times Battery talk and standby times are estimates only and depend on signal strength, network conditions, features used, battery age and condition (including the effect of charging habits), temperatures to which battery is exposed, use in digital mode, and many other
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 101 Wednesday, October 15, 2003 1:43 PM factors. Please note that the amount of time a phone is used for calls will affect its standby time. Likewise, the amount of time that the phone is turned on and in the standby mode will affect its talk time. Reference Information
CARE AND MAINTENANCE Your phone is a product of superior design and craftsmanship and should be treated with care. The suggestions below will help you to fulfil any warranty obligations and to enjoy this product for many years.
Keep the phone and all its parts and accessories out of the reach of small children. Keep the phone dry. Precipitation, humidity and all types of liquids or moisture can contain minerals that will corrode electronic circuits. Do not use or store the phone in dusty, dirty areas. Its moving parts can be damaged. Do not store the phone in hot areas. High temperatures can shorten the life of electronic devices, damage batteries, and warp or melt certain plastics. Do not store the phone in cold areas. When it warms up (to its normal temperature), moisture can form inside, which may damage electronic circuit boards. Do not attempt to open the phone. Non-expert handling may damage it. Do not drop, knock or shake the phone. Rough handling can break internal circuit boards. Do not use harsh chemicals, cleaning solvents, or strong detergents to clean the phone. Do not paint the phone. Paint can clog the moving parts and prevent proper operation. Use only the supplied or an approved replacement antenna. Unauthorized antennas, modifications or attachments could damage the phone and may violate regulations governing radio devices.
All of the above suggestions apply equally to your phone, battery, charger or any accessory. If any of them is not working properly, take it to your nearest qualified service facility. The personnel there will assist you and, if necessary, arrange for service.
TRAFFIC SAFETY Do not use a hand-held telephone while driving a vehicle. Always secure the phone in its holder; do not place the phone on the passenger seat or where it can break loose in a collision or sudden stop. Remember road safety always comes first!
OPERATING ENVIRONMENT Remember to follow any special regulations in force in any area and always switch off your phone whenever it is forbidden to use it, or when it may cause interference or danger. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 102 Wednesday, October 15, 2003 1:43 PM Use the phone only in its normal operating positions. Parts of the phone are magnetic. Metallic materials may be attracted to the phone, and persons with a hearing aid should not hold the phone to the ear with the hearing aid. Always secure the phone in its holder, because metallic materials may be attracted by the earpiece. Do not place credit cards or other magnetic storage media near the phone, because information stored on them may be erased.
ELECTRONIC DEVICES Most modern electronic equipment is shielded from radio frequency (RF) signals. However, certain electronic equipment may not be shielded against the RF signals from your wireless phone. Pacemakers Pacemaker manufacturers recommend that a minimum separation of 6 inches (20 cm) maintained between a handheld wireless phone and a pacemaker to avoid potential interference with the pacemaker. These recommendations are consistent with the independent research by and recommendations of Wireless Technology Research. Persons with pacemakers:
Should always keep the phone more than 6 inches (20 cm) from their pacemaker when the phone is switched on;
Should not carry the phone in a breast pocket;
Should use the ear opposite the pacemaker to minimize the potential for interference. If you have any reason to suspect that interference is taking place, switch off your phone immediately.
Hearing aids Some digital wireless phones may interfere with some hearing aids. In the event of such interference, you may want to consult your service provider. Other medical devices Operation of any radio transmitting equipment, including cellular phones, may interfere with the functionality of inadequately protected medical devices. Consult a physician or the manufacturer of the medical device to determine if they are adequately shielded from external RF energy or if you have any questions. Switch off your phone in health care facilities when any regulations posted in these areas instruct you to do so. Hospitals or health care facilities may be using equipment that could be sensitive to external RF energy.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 103 Wednesday, October 15, 2003 1:43 PM Reference Information Vehicles RF signals may affect improperly installed or inadequately shielded electronic systems in motor vehicles (e.g. electronic fuel injection systems, electronic anti-skid (anti-lock) braking systems, electronic speed control systems, air-bag systems). Check with the manufacturer or its representative regarding your vehicle. You should also consult the manufacturer of any equipment that has been added to your vehicle. Posted facilities Switch your phone off in any facility where posted notices so require.
POTENTIALLY EXPLOSIVE ENVIRONMENTS Switch off your phone when in any area with a potentially explosive atmosphere and obey all signs and instructions. Sparks in such areas could cause an explosion or fire resulting in bodily injury or even death. Users are advised to switch off the phone when at a refuelling point (service station). Users are reminded of the need to observe restrictions on the use of radio equipment in fuel depots (fuel storage and distribution areas), chemical plants or where blasting operations are in progress. Areas with a potentially explosive atmosphere are often but not always clearly marked. They include below deck on boats; chemical transfer or storage facilities; vehicles using liquefied petroleum gas (such as propane or butane); areas where the air contains chemicals or particles, such as grain, dust or metal powders; and any other area where you would normally be advised to turn off your vehicle engine.
VEHICLES Only qualified personnel should service the phone, or install the phone in a vehicle. Faulty installation or service may be dangerous and may invalidate any warranty which may apply to the unit. Check regularly that all wireless phone equipment in your vehicle is mounted and operating properly. Do not store or carry flammable liquids, gases or explosive materials in the same compartment as the phone, its parts or accessories. For vehicles equipped with an air bag, remember that an air bag inflates with great force. Do not place objects, including both installed or portable wireless equipment in the area over the air bag or in the air bag deployment area. If in-vehicle wireless equipment is improperly installed and the air bag inflates, serious injury could result. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 104 Wednesday, October 15, 2003 1:43 PM Using your phone while in the air is prohibited. Switch off your phone before boarding an aircraft. The use of wireless telephones in an aircraft may be dangerous to the operation of the aircraft, disrupt the wireless telephone network and may be illegal. Failure to observe these instructions may lead to suspension or denial of telephone services to the offender, or legal action or both.
EMERGENCY CALLS Important:This phone, like any wireless phone, operates using radio signals, wireless and landline networks as well as user-programmed functions. Because of this, connections in all conditions can not be guaranteed. Therefore, you should never rely solely upon any wireless phone for essential communications (such as medical emergencies). 2 3 Emergency calls may not be possible on all wireless phone networks or when certain network services and/or phone features are in use. Check with local service providers. To make an emergency call:
1 If the phone is not on, switch it on. Check for adequate signal strength. Some networks may require that a valid SIM card is properly inserted in the phone. Press the End key as many times as needed (to exit a call, to exit a menu, etc.) to clear the display and ready the phone for calls. Key in the emergency number for your present location. Emergency numbers vary by location. Press the Send key 4 If certain features are in use, you may first need to turn those features off before you can make an emergency call. Consult this guide and your local cellular service provider. When making an emergency call, remember to give all the necessary information as accurately as possible. Remember that your wireless phone may be the only means of communication at the scene of an accident - do not cut off the call until given permission to do so. CERTIFICATION INFORMATION (SAR) THIS MODEL PHONE MEETS THE GOVERNMENTS REQUIREMENTS FOR EXPOSURE TO RADIO WAVES. Your wireless phone is a radio transmitter and receiver. It is designed and manufactured not to exceed the emission limits for exposure to radio frequency (RF) energy set by the Federal Communications Commission of the U.S. Government. These limits are part of comprehensive guidelines and establish permitted levels of RF energy for the general population. The guidelines are based on standards that were developed by independent
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 105 Wednesday, October 15, 2003 1:43 PM Reference Information scientific organizations through periodic and thorough evaluation of scientific studies. The standards include a substantial safety margin designed to assure the safety of all persons, regardless of age and health. The exposure standard for wireless mobile phones employs a unit of measurement known as the Specific Absorption Rate, or SAR. The SAR limit set by the FCC is 1.6W/kg.* Tests for SAR are conducted using standard operating positions accepted by the FCC with the phone transmitting at its highest certified power level in all tested frequency bands. Although the SAR is determined at the highest certified power level, the actual SAR level of the phone while operating can be well below the maximum value. This is because the phone is designed to operate at multiple power levels so as to use only the power required to reach the network. In general, the closer you are to a wireless base station antenna, the lower the power output. Before a phone model is available for sale to the public, it must be tested and certified to the FCC that it does not exceed the limit established by the government-adopted requirement for safe exposure. The tests are performed in positions and locations (for example, at the ear and worn on the body) as required by the FCC for each model. The highest SAR value for the Nokia 6820a model phone as reported to the FCC when tested for use at the ear is 0.66 W/kg, and when worn on the body, as described in this user guide, is 1.20 W/kg. The highest SAR value for the Nokia 6820b model phone as reported to the FCC when tested for use at the ear is X.XX W/kg, and when worn on the body, as described in this user guide, is X.XX W/kg.(Body-worn measurements differ among phone models, depending upon available enhancements and FCC requirements). While there may be differences between the SAR levels of various phones and at various positions, they all meet the government requirement. The FCC has granted an Equipment Authorization for this model phone with all reported SAR levels evaluated as in compliance with the FCC RF exposure guidelines. SAR information on this model phone is on file with the FCC and can be found under the Display Grant section of http://www.fcc.gov/oet/fccid after searching on FCC ID PYANHL-9 for the Nokia 6280a model and FCC ID XXXXXX-X for the Nokia 6820b model. For body worn operation, this phone has been tested and meets the FCC RF exposure guidelines for use with a carry case, belt clip, or holder that contains no metal and that positions the handset a minimum of 5/8-inch (1.5 cm) from the body. Use of other carry cases, belt clips, or holders may not ensure compliance with FCC RF exposure guidelines. If you do not use a body-worn accessory and are not holding the phone at the ear, position the handset a minimum of 5/8-inch (1.5 cm) from your body when the phone is switched on.
*In the United States and Canada, the SAR limit for mobile phones used by the public is 1.6 watts/kilogram (W/kg) averaged over one gram of tissue. The standard incorporates a substantial margin of safety to give additional protection for the public and to account for any variations in measurements. SAR values may vary depending on national reporting requirements and the network band. For SAR information in other regions please look under product information at www.nokia.com. Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 106 Wednesday, October 15, 2003 1:43 PM 20 Technical information Weight Size Frequency range 3.5 oz (100 g) with BL-5C 850mAh semi-fixed Li-Ion Battery Volume: 4.8 cubic inches (79 cc) Weight: 3.5 oz (100 g) Length: 4.2 in (106.1 mm closed) Width: 1.8 in (46.1 mm) at hinges, 1.5 in (38 mm) at bottom Thickness: .8 in (21.6 mm) at top, .7 in (17 mm at bottom) 6820a EGSM900 880.2-914.8 MHz (TX) 92.5-959.8 MHz (RX) GSM1800 1710.2-1784.8 MHz (TX) 6820b GSM850 824.2-848.8 MHz (TX) 869.2-893.8 MHz (RX) GSM1800 1710.2-1784.8 MHz (TX) 1805.2-1879.8 (RX) 1805.2-1879.8 (RX) GSM1900 1850.2-1909.8 MHz (TX) GSM1900 1850.2-1909.8 MHz (TX) 1930.2-1989.8 (RX) 1930.2-1989.8 (RX) Tx output power Up to 2 W Battery voltage 3.7 V Operating temperature aTalk time, standby time 14F to + 131F (-10C to +55C) Talk time: up to 7 hours Stand-by time: up to 10 days a. Battery talk and standby times are estimates only and depend on signal strength, network con-
ditions, features used, battery age and condition (including the effect of charging habits), tem-
peratures to which battery is exposed, use in digital mode, and many other factors. Please note that the amount of time a phone is used for calls will affect its standby time. Likewise, the amount of time that the phone is turned on and in the standby mode will affect its talk time.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 107 Wednesday, October 15, 2003 1:43 PM 21 Nokia One-Year Limited Warranty Nokia One-Year Limited Warranty 2 3 4 5 6 7 Nokia Inc. (Nokia) warrants that this cellular phone (Product) is free from defects in material and workmanship that result in Product failure during normal usage, according to the following terms and conditions:
1 The limited warranty for the Product extends for ONE (1) year beginning on the date of the purchase of the Product. This one year period is extended by each whole day that the Product is out of your possession for repair under this warranty. The limited warranty extends only to the original purchaser (Consumer) of the Product and is not assignable or transferable to any subsequent purchaser/end-user. The limited warranty extends only to Consumers who purchase the Product in the United States of America. During the limited warranty period, Nokia will repair, or replace, at Nokias sole option, any defective parts, or any parts that will not properly operate for their intended use with new or refurbished replacement items if such repair or replacement is needed because of product malfunction or failure during normal usage. No charge will be made to the Consumer for any such parts. Nokia will also pay for the labor charges incurred by Nokia in repairing or replacing the defective parts. The limited warranty does not cover defects in appearance, cosmetic, decorative or structural items, including framing, and any non-operative parts. Nokias limit of liability under the limited warranty shall be the actual cash value of the Product at the time the Consumer returns the Product for repair, determined by the price paid by the Consumer for the Product less a reasonable amount for usage. Nokia shall not be liable for any other losses or damages. These remedies are the Consumers exclusive remedies for breach of warranty. Upon request from Nokia, the Consumer must prove the date of the original purchase of the Product by a dated bill of sale or dated itemized receipt. The Consumer shall bear the cost of shipping the Product to Nokia in Melbourne, Florida. Nokia shall bear the cost of shipping the Product back to the Consumer after the completion of service under this limited warranty. The Consumer shall have no coverage or benefits under this limited warranty if any of the following conditions are applicable:
The Prodct has been subjected to abnormal use, abnormal conditions, improper
storage, exposure to moisture or dampness, unauthorized modifications, unauthorized connections, unauthorized repair, misuse, neglect, abuse, accident, alteration, improper installation, or other acts which are not the fault of Nokia, including damage caused by shipping. The Product has been damaged from external causes such as collision with an object, or from fire, flooding, sand, dirt, windstorm, lightning, earthquake or damage from exposure to weather conditions, an Act of God, or battery leakage,
Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 108 Wednesday, October 15, 2003 1:43 PM theft, blown fuse, or improper use of any electrical source, damage caused by computer or internet viruses, bugs, worms, Trojan Horses, cancelbots or damage caused by the connection to other products not recommended for interconnection by Nokia. Nokia was not advised in writing by the Consumer of the alleged defect or malfunction of the Product within fourteen (14) days after the expiration of the applicable limited warranty period. The Product serial number plate or the accessory data code has been removed, defaced or altered. The defect or damage was caused by the defective function of the cellular system or by inadequate signal reception by the external antenna, or viruses or other software problems introduced into the Product.
8 Nokia does not warrant uninterrupted or error-free operation of the Product. If a problem develops during the limited warranty period, the Consumer shall take the following step-by-step procedure:
The Consumer shall return the Product to the place of purchase for repair or replacement processing. If a is not convenient because of distance (more than 50 miles) or for other good cause, the Consumer shall ship the Product prepaid and insured to:
Nokia Inc., Attn: Repair Department 795 West Nasa Blvd. Melbourne, FL 32901 The Consumer shall include a return address, daytime phone number and/or fax number, complete description of the problem, proof of purchase and service agreement (if applicable). Expenses related to removing the Product from an installation are not covered under this limited warranty. The Consumer will be billed for any parts or labor charges not covered by this limited warranty. The Consumer will be responsible for any expenses related to reinstallation of the Product. Nokia will repair the Product under the limited warranty within 30 days after receipt of the Product. If Nokia cannot perform repairs covered under this limited warranty within 30 days, or after a reasonable number of attempts to repair the same defect, Nokia at its option, will provide a replacement Product or refund the purchase price of the Product less a reasonable amount for usage. In some states the Consumer may have the right to a loaner if the repair of the Product takes more than ten (10) days. Please contact the Customer Service Center at Nokia at the telephone number listed at the end of this warranty if you need a loaner and the repair of the Product has taken or is estimated to take more than ten (10) days. If the Product is returned during the limited warranty period, but the problem with the Product is not covered under the terms and conditions of this limited warranty,
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 109 Wednesday, October 15, 2003 1:43 PM Nokia One-Year Limited Warranty the Consumer will be notified and given an estimate of the charges the Consumer must pay to have the Product repaired, with all shipping charges billed to the Consumer. If the estimate is refused, the Product will be returned freight collect. If the Product is returned after the expiration of the limited warranty period, Nokias normal service policies shall apply and the Consumer will be responsible for all shipping charges. 9 You (the Consumer) understand that the product may consist of refurbished equipment that contains used components, some of which have been reprocessed. The used components comply with Product performance and reliability specifications. 10 ANY IMPLIED WARRANTY OF MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE OR USE, SHALL BE LIMITED TO THE DURATION OF THE FOREGOING LIMITED WRITTEN WARRANTY. OTHERWISE, THE FOREGOING LIMITED WARRANTY IS THE CONSUMERS SOLE AND EXCLUSIVE REMEDY AND IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESS OR IMPLIED. NOKIA SHALL NOT BE LIABLE FOR SPECIAL, INCIDENTAL, PUNITIVE OR CONSEQUENTIAL DAMAGES, INCLUDING BUT NOT LIMITED TO LOSS OF ANTICIPATED BENEFITS OR PROFITS, LOSS OF SAVINGS OR REVENUE, LOSS OF DATA, PUNITIVE DAMAGES, LOSS OF USE OF THE PRODUCT OR ANY ASSOCIATED EQUIPMENT, COST OF CAPITAL, COST OF ANY SUBSTITUTE EQUIPMENT OR FACILITIES, DOWNTIME, THE CLAIMS OF ANY THIRD PARTIES, INCLUDING CUSTOMERS, AND INJURY TO PROPERTY, RESULTING FROM THE PURCHASE OR USE OF THE PRODUCT OR ARISING FROM BREACH OF THE WARRANTY, BREACH OF CONTRACT, NEGLIGENCE, STRICT TORT, OR ANY OTHER LEGAL OR EQUITABLE THEORY, EVEN IF NOKIA KNEW OF THE LIKELIHOOD OF SUCH DAMAGES. NOKIA SHALL NOT BE LIABLE FOR DELAY IN RENDERING SERVICE UNDER THE LIMITED WARRANTY, OR LOSS OF USE DURING THE PERIOD THAT THE PRODUCT IS BEING REPAIRED. 11 Some states do not allow limitation of how long an implied warranty lasts, so the one year warranty limitation may not apply to you (the Consumer). Some states do not allow the exclusion or limitation of incidental and consequential damages, so certain of the above limitations or exclusions may not apply to you (the Consumer). This limited warranty gives the Consumer specific legal rights and the Consumer may also have other rights which vary from state to state. 12 Nokia neither assumes nor authorizes any authorized service center or any other person or entity to assume for it any other obligation or liability beyond that which is expressly provided for in this limited warranty including the provider or seller of any extended warranty or service agreement. 13 This is the entire warranty between Nokia and the Consumer, and supersedes all prior and contemporaneous agreements or understandings, oral or written, relating to the Product, and no representation, promise or condition not contained herein shall modify these terms. and Nokia. The allocation is recognized by the Consumer and is reflected in the purchase price. 14 This limited warranty allocates the risk of failure of the Product between the Consumer Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 110 Wednesday, October 15, 2003 1:43 PM 15 Any action or lawsuit for breach of warranty must be commenced within eighteen (18) 16 Questions concerning this limited warranty may be directed to:
months following purchase of the Product. Nokia Inc. Attn: Customer Service 7725 Woodland Center Blvd., Ste. 150 Tampa, FL 33614 Telephone: 1-888-NOKIA-2U (1-888-665-4228) Facsimile: (813) 287-6612 TTY/TDD Users Only: 1-800-24-NOKIA (1-800-246-6542) 17 The limited warranty period for Nokia supplied attachments and accessories is specifically defined within their own warranty cards and packaging.
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 111 Wednesday, October 15, 2003 1:43 PM Manufactured or sold under one or more of the following US Patents. Asterisk (*) indicates design patents pending. Nokia One-Year Limited Warranty 4558302 5151946 5317283 5384782 5479476 5581244 5760568 5844884 5912570 5956625 6006114 6038238 6060193 6094587 6121846 6148209 6185295 6282436 6324412 6381468 6487397 5444816 5722074 5862178 5963901 6137789 6240076 6438370 4868846 5173927 5331638 5396657 5526366 5600708 5794142 5845219 5914690 5956633 6011853 6043760 6069923 6097964 6128509 6151485 6188909 6292668 6347218 6392660 6522670 5487084 5754976 5898925 6005857 6167248 6266321 6456237 4945633 5212834 5335362 5400949 5553125 5625274 5802465 5870683 5914796 5966378 6014551 6047196 6072787 6105784 6138091 6151507 6249584 6295286 6363259 6400958 6198928 5640395 5805301 5930233 6011971 6170073 6285888 4969192 5230091 5353328 5416435 5557639 5677620 5809413 5884103 5917868 5977887 6014573 6049796 6081732 6112099 6140966 6163609 6259312 6311054 6370362 6453179 4969192 5664053 5835889 5946651 6031827 6178535 6356759 5001372 5241583 5371481 5442521 5565821 5692032 5827082 5889770 5920826 5987137 6026161 6050415 6084920 6115617 6144243 6164547 6266330 6314166 6370389 6463278 5266782 5699482 5857151
*5960354 6118775 6195338 6377803 5101175 5311151 5378935 5446364 5570369 5729541 5839101 5907823 5956332 5991857 6035189 6055439 6084962 6119180 6144676 6167248 6272361 6324389 6377820 6470470 5390223 5701392 5859843 5960389 6128322 6199035 6430163 Nokia User Guide-FCC DRAFT 10/16/03
Copyright Nokia 2003 6820.ENv1_9310322.book Page 112 Wednesday, October 15, 2003 1:43 PM
)&&'5$)7
Copyright Nokia 2003 6820.ENv1_9310322.book Page 113 Wednesday, October 15, 2003 1:43 PM Appendix A Message from the CTIA Appendix A Message from the CTIA
(Cellular Telecommunications
& Internet Association) to all users of mobile phones.
&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ$OO5LJKWV
5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
[ 113 ]
6820.ENv1_9310322.book Page 114 Wednesday, October 15, 2003 1:43 PM 6DIHW\LVWKHPRVWLPSRUWDQWFDOO\RXZLOOHYHUPDNH
A Guide to Safe and Responsible Wireless Phone Use
7HQVRIPLOOLRQVRISHRSOHLQWKH86WRGD\WDNHDGYDQWDJHRIWKHXQLTXH
FRPELQDWLRQRIFRQYHQLHQFHVDIHW\DQGYDOXHGHOLYHUHGE\WKHZLUHOHVVWHOHSKRQH
4XLWHVLPSO\WKHZLUHOHVVSKRQHJLYHVSHRSOHWKHSRZHUIXODELOLW\WRFRPPXQLFDWH
E\YRLFHDOPRVWDQ\ZKHUHDQ\WLPHZLWKWKHERVVZLWKDFOLHQWZLWKWKHNLGV
ZLWKHPHUJHQF\SHUVRQQHORUHYHQZLWKWKHSROLFH(DFK\HDU$PHULFDQVPDNH
ELOOLRQVRIFDOOVIURPWKHLUZLUHOHVVSKRQHVDQGWKHQXPEHUVDUHUDSLGO\JURZLQJ
%XWDQLPSRUWDQWUHVSRQVLELOLW\DFFRPSDQLHVWKRVHEHQHILWVRQHWKDWHYHU\ZLUHOHVV
SKRQHXVHUPXVWXSKROG:KHQGULYLQJDFDUGULYLQJLV\RXUILUVWUHVSRQVLELOLW\$
ZLUHOHVVSKRQHFDQEHDQLQYDOXDEOHWRROEXWJRRGMXGJPHQWPXVWEHH[HUFLVHGDW
DOOWLPHVZKLOHGULYLQJDPRWRUYHKLFOHZKHWKHURQWKHSKRQHRUQRW
7KHEDVLFOHVVRQVDUHRQHVZHDOOOHDUQHGDVWHHQDJHUV'ULYLQJUHTXLUHVDOHUWQHVV
FDXWLRQDQGFRXUWHV\,WUHTXLUHVDKHDY\GRVHRIEDVLFFRPPRQVHQVHNHHS\RXU
KHDGXSNHHS\RXUH\HVRQWKHURDGFKHFN\RXUPLUURUVIUHTXHQWO\DQGZDWFKRXW
IRURWKHUGULYHUV,WUHTXLUHVREH\LQJDOOWUDIILFVLJQVDQGVLJQDOVDQGVWD\LQJZLWKLQ
WKHVSHHGOLPLW,WPHDQVXVLQJVHDWEHOWVDQGUHTXLULQJRWKHUSDVVHQJHUVWRGRWKH
VDPH
%XWZLWKZLUHOHVVSKRQHXVHGULYLQJVDIHO\PHDQVDOLWWOHPRUH7KLVEURFKXUHLVD
FDOOWRZLUHOHVVSKRQHXVHUVHYHU\ZKHUHWRPDNHVDIHW\WKHLUILUVWSULRULW\ZKHQ
EHKLQGWKHZKHHORIDFDU:LUHOHVVWHOHFRPPXQLFDWLRQVLVNHHSLQJXVLQWRXFK
VLPSOLI\LQJRXUOLYHVSURWHFWLQJXVLQHPHUJHQFLHVDQGSURYLGLQJRSSRUWXQLWLHVWR
KHOSRWKHUVLQQHHG
:KHQLWFRPHVWRWKHXVHRIZLUHOHVVSKRQHVVDIHW\LV\RXUPRVWLPSRUWDQWFDOO
Wireless Phone "Safety Tips"
%HORZDUHVDIHW\WLSVWRIROORZZKLOHGULYLQJDQGXVLQJDZLUHOHVVSKRQHZKLFK
VKRXOGEHHDV\WRUHPHPEHU
*HWWRNQRZ\RXUZLUHOHVVSKRQHDQGLWVIHDWXUHVVXFKDVVSHHGGLDODQGUHGLDO
&DUHIXOO\UHDG\RXULQVWUXFWLRQPDQXDODQGOHDUQWRWDNHDGYDQWDJHRIYDOXDEOH
IHDWXUHVPRVWSKRQHVRIIHULQFOXGLQJDXWRPDWLFUHGLDODQGPHPRU\$OVRZRUN
WRPHPRUL]HWKHSKRQHNH\SDGVR\RXFDQXVHWKHVSHHGGLDOIXQFWLRQZLWKRXW
WDNLQJ\RXUDWWHQWLRQRIIWKHURDG
:KHQDYDLODEOHXVHDKDQGVIUHHGHYLFH$QXPEHURIKDQGVIUHHZLUHOHVVSKRQH
DFFHVVRULHVDUHUHDGLO\DYDLODEOHWRGD\:KHWKHU\RXFKRRVHDQLQVWDOOHGPRXQWHG
GHYLFHIRU\RXUZLUHOHVVSKRQHRUDVSHDNHUSKRQHDFFHVVRU\WDNHDGYDQWDJHRI
WKHVHGHYLFHVLIDYDLODEOHWR\RX
3RVLWLRQ\RXUZLUHOHVVSKRQHZLWKLQHDV\UHDFK0DNHVXUH\RXSODFH\RXU
ZLUHOHVVSKRQHZLWKLQHDV\UHDFKDQGZKHUH\RXFDQJUDELWZLWKRXWUHPRYLQJ
\RXUH\HVIURPWKHURDG,I\RXJHWDQLQFRPLQJFDOODWDQLQFRQYHQLHQWWLPHLI
SRVVLEOHOHW\RXUYRLFHPDLODQVZHULWIRU\RX
6XVSHQGFRQYHUVDWLRQVGXULQJKD]DUGRXVGULYLQJFRQGLWLRQVRUVLWXDWLRQV/HW
WKHSHUVRQ\RXDUHVSHDNLQJZLWKNQRZ\RXDUHGULYLQJLIQHFHVVDU\VXVSHQGWKH
[ 114 ]
6820.ENv1_9310322.book Page 115 Wednesday, October 15, 2003 1:43 PM Appendix A Message from the CTIA FDOOLQKHDY\WUDIILFRUKD]DUGRXVZHDWKHUFRQGLWLRQV5DLQVOHHWVQRZDQGLFH
FDQEHKD]DUGRXVEXWVRLVKHDY\WUDIILF$VDGULYHU\RXUILUVWUHVSRQVLELOLW\LV
WRSD\DWWHQWLRQWRWKHURDG
'RQRWWDNHQRWHVRUORRNXSSKRQHQXPEHUVZKLOHGULYLQJ,I\RXDUHUHDGLQJDQ
DGGUHVVERRNRUEXVLQHVVFDUGRUZULWLQJDWRGROLVWZKLOHGULYLQJDFDU\RX
DUHQRWZDWFKLQJZKHUH\RXDUHJRLQJ,WVFRPPRQVHQVH'RQWJHWFDXJKWLQD
GDQJHURXVVLWXDWLRQEHFDXVH\RXDUHUHDGLQJRUZULWLQJDQGQRWSD\LQJDWWHQWLRQ
WRWKHURDGRUQHDUE\YHKLFOHV
'LDOVHQVLEO\DQGDVVHVVWKHWUDIILFLISRVVLEOHSODFHFDOOVZKHQ\RXDUHQRW
PRYLQJRUEHIRUHSXOOLQJLQWRWUDIILF7U\WRSODQ\RXUFDOOVEHIRUH\RXEHJLQ\RXU
WULSRUDWWHPSWWRFRLQFLGH\RXUFDOOVZLWKWLPHV\RXPD\EHVWRSSHGDWDVWRS
VLJQUHGOLJKWRURWKHUZLVHVWDWLRQDU\%XWLI\RXQHHGWRGLDOZKLOHGULYLQJ
IROORZWKLVVLPSOHWLSGLDORQO\DIHZQXPEHUVFKHFNWKHURDGDQG\RXUPLUURUV
WKHQFRQWLQXH
'RQRWHQJDJHLQVWUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVWKDWPD\EHGLVWUDFWLQJ
6WUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVDQGGULYLQJGRQRWPL[WKH\DUH
GLVWUDFWLQJDQGHYHQGDQJHURXVZKHQ\RXDUHEHKLQGWKHZKHHORIDFDU0DNH
SHRSOH\RXDUHWDONLQJZLWKDZDUH\RXDUHGULYLQJDQGLIQHFHVVDU\VXVSHQG
FRQYHUVDWLRQVZKLFKKDYHWKHSRWHQWLDOWRGLYHUW\RXUDWWHQWLRQIURPWKHURDG
8VH\RXUZLUHOHVVSKRQHWRFDOOIRUKHOS<RXUZLUHOHVVSKRQHLVRQHRIWKH
JUHDWHVWWRROV\RXFDQRZQWRSURWHFW\RXUVHOIDQG\RXUIDPLO\LQGDQJHURXV
VLWXDWLRQVZLWK\RXUSKRQHDW\RXUVLGHKHOSLVRQO\WKUHHQXPEHUVDZD\'LDO
RURWKHUORFDOHPHUJHQF\QXPEHULQWKHFDVHRIILUHWUDIILFDFFLGHQWURDG
KD]DUGRUPHGLFDOHPHUJHQF\5HPHPEHULWLVDIUHHFDOORQ\RXUZLUHOHVVSKRQH
8VH\RXUZLUHOHVVSKRQHWRKHOSRWKHUVLQHPHUJHQFLHV<RXUZLUHOHVVSKRQH
SURYLGHV\RXDSHUIHFWRSSRUWXQLW\WREHD*RRG6DPDULWDQLQ\RXU
FRPPXQLW\,I\RXVHHDQDXWRDFFLGHQWFULPHLQSURJUHVVRURWKHUVHULRXV
HPHUJHQF\ZKHUHOLYHVDUHLQGDQJHUFDOORURWKHUORFDOHPHUJHQF\QXPEHU
DV\RXZRXOGZDQWRWKHUVWRGRIRU\RX
&DOOURDGVLGHDVVLVWDQFHRUDVSHFLDOZLUHOHVVQRQHPHUJHQF\DVVLVWDQFHQXPEHU
ZKHQQHFHVVDU\&HUWDLQVLWXDWLRQV\RXHQFRXQWHUZKLOHGULYLQJPD\UHTXLUH
DWWHQWLRQEXWDUHQRWXUJHQWHQRXJKWRPHULWDFDOOIRUHPHUJHQF\VHUYLFHV%XW
\RXVWLOOFDQXVH\RXUZLUHOHVVSKRQHWROHQGDKDQG,I\RXVHHDEURNHQGRZQ
YHKLFOHSRVLQJQRVHULRXVKD]DUGDEURNHQWUDIILFVLJQDODPLQRUWUDIILFDFFLGHQW
ZKHUHQRRQHDSSHDUVLQMXUHGRUDYHKLFOH\RXNQRZWREHVWROHQFDOOURDGVLGH
DVVLVWDQFHRURWKHUVSHFLDOQRQHPHUJHQF\ZLUHOHVVQXPEHU
&DUHOHVVGLVWUDFWHGLQGLYLGXDOVDQGSHRSOHGULYLQJLUUHVSRQVLEO\UHSUHVHQWDKD]DUG
WRHYHU\RQHRQWKHURDG6LQFHWKH&HOOXODU7HOHFRPPXQLFDWLRQV,QGXVWU\
$VVRFLDWLRQDQGWKHZLUHOHVVLQGXVWU\KDYHFRQGXFWHGHGXFDWLRQDORXWUHDFKWR
LQIRUPZLUHOHVVSKRQHXVHUVRIWKHLUUHVSRQVLELOLWLHVDVVDIHGULYHUVDQGJRRG
FLWL]HQV$VZHDSSURDFKDQHZFHQWXU\PRUHDQGPRUHRIXVZLOOWDNHDGYDQWDJHRI
WKHEHQHILWVRIZLUHOHVVWHOHSKRQHV$QGDVZHWDNHWRWKHURDGVZHDOOKDYHD
UHVSRQVLELOLW\WRGULYHVDIHO\
7KHZLUHOHVVLQGXVWU\UHPLQGV\RXWRXVH\RXUSKRQHVDIHO\ZKHQGULYLQJ
[ 115 ]
6820.ENv1_9310322.book Page 116 Wednesday, October 15, 2003 1:43 PM
)RUPRUHLQIRUPDWLRQSOHDVHFDOO6$)(
)RUXSGDWHVKWWSZZZZRZFRPFRPFRQVXPHULVVXHVGULYLQJ
DUWLFOHVFIP",'
&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ$OO5LJKWV
5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&3KRQH
[ 116 ]
6820.ENv1_9310322.book Page 117 Wednesday, October 15, 2003 1:43 PM Appendix B Message from the FDA Appendix B Message from the FDA
(U.S. Food and Drug Administration) to all users of mobile phones.
-XO\
)RUXSGDWHVKWWSZZZIGDJRYFGUKSKRQHV
[ 117 ]
6820.ENv1_9310322.book Page 118 Wednesday, October 15, 2003 1:43 PM Consumer Update on Wireless Phones U.S. Food and Drug Administration
1. Do wireless phones pose a health hazard?
7KHDYDLODEOHVFLHQWLILFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPVDUH
DVVRFLDWHGZLWKXVLQJZLUHOHVVSKRQHV7KHUHLVQRSURRIKRZHYHUWKDWZLUHOHVV
SKRQHVDUHDEVROXWHO\VDIH:LUHOHVVSKRQHVHPLWORZOHYHOVRIUDGLRIUHTXHQF\
HQHUJ\5)LQWKHPLFURZDYHUDQJHZKLOHEHLQJXVHG7KH\DOVRHPLWYHU\ORZOHYHOV
RI5)ZKHQLQWKHVWDQGE\PRGH:KHUHDVKLJKOHYHOVRI5)FDQSURGXFHKHDOWK
HIIHFWVE\KHDWLQJWLVVXHH[SRVXUHWRORZOHYHO5)WKDWGRHVQRWSURGXFHKHDWLQJ
HIIHFWVFDXVHVQRNQRZQDGYHUVHKHDOWKHIIHFWV0DQ\VWXGLHVRIORZOHYHO5)
H[SRVXUHVKDYHQRWIRXQGDQ\ELRORJLFDOHIIHFWV6RPHVWXGLHVKDYHVXJJHVWHGWKDW
VRPHELRORJLFDOHIIHFWVPD\RFFXUEXWVXFKILQGLQJVKDYHQRWEHHQFRQILUPHGE\
DGGLWLRQDOUHVHDUFK,QVRPHFDVHVRWKHUUHVHDUFKHUVKDYHKDGGLIILFXOW\LQ
UHSURGXFLQJWKRVHVWXGLHVRULQGHWHUPLQLQJWKHUHDVRQVIRULQFRQVLVWHQWUHVXOWV
2. What is FDAs role concerning the safety of wireless phones?
8QGHUWKHODZ)'$GRHVQRWUHYLHZWKHVDIHW\RIUDGLDWLRQHPLWWLQJFRQVXPHU
SURGXFWVVXFKDVZLUHOHVVSKRQHVEHIRUHWKH\FDQEHVROGDVLWGRHVZLWKQHZGUXJV
RUPHGLFDOGHYLFHV+RZHYHUWKHDJHQF\KDVDXWKRULW\WRWDNHDFWLRQLIZLUHOHVV
SKRQHVDUHVKRZQWRHPLWUDGLRIUHTXHQF\HQHUJ\5)DWDOHYHOWKDWLVKD]DUGRXVWR
WKHXVHU,QVXFKDFDVH)'$FRXOGUHTXLUHWKHPDQXIDFWXUHUVRIZLUHOHVVSKRQHVWR
QRWLI\XVHUVRIWKHKHDOWKKD]DUGDQGWRUHSDLUUHSODFHRUUHFDOOWKHSKRQHVVRWKDW
WKHKD]DUGQRORQJHUH[LVWV
$OWKRXJKWKHH[LVWLQJVFLHQWLILFGDWDGRQRWMXVWLI\)'$UHJXODWRU\DFWLRQV)'$KDV
XUJHGWKHZLUHOHVVSKRQHLQGXVWU\WRWDNHDQXPEHURIVWHSVLQFOXGLQJWKH
IROORZLQJ
6XSSRUWQHHGHGUHVHDUFKLQWRSRVVLEOHELRORJLFDOHIIHFWVRI5)RIWKHW\SH
HPLWWHGE\ZLUHOHVVSKRQHV
'HVLJQZLUHOHVVSKRQHVLQDZD\WKDWPLQLPL]HVDQ\5)H[SRVXUHWRWKHXVHU
WKDWLVQRWQHFHVVDU\IRUGHYLFHIXQFWLRQDQG
&RRSHUDWHLQSURYLGLQJXVHUVRIZLUHOHVVSKRQHVZLWKWKHEHVWSRVVLEOH
LQIRUPDWLRQRQSRVVLEOHHIIHFWVRIZLUHOHVVSKRQHXVHRQKXPDQKHDOWK
)'$EHORQJVWRDQLQWHUDJHQF\ZRUNLQJJURXSRIWKHIHGHUDODJHQFLHVWKDWKDYH
UHVSRQVLELOLW\IRUGLIIHUHQWDVSHFWVRI5)VDIHW\WRHQVXUHFRRUGLQDWHGHIIRUWVDWWKH
IHGHUDOOHYHO7KHIROORZLQJDJHQFLHVEHORQJWRWKLVZRUNLQJJURXS
1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ 1DWLRQDO7HOHFRPPXQLFDWLRQVDQG,QIRUPDWLRQ$GPLQLVWUDWLRQ 7KH1DWLRQDO,QVWLWXWHVRI+HDOWKSDUWLFLSDWHVLQVRPHLQWHUDJHQF\ZRUNLQJJURXS
DFWLYLWLHVDVZHOO
(QYLURQPHQWDO3URWHFWLRQ$JHQF\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ
[ 118 ]
6820.ENv1_9310322.book Page 119 Wednesday, October 15, 2003 1:43 PM Appendix B Message from the FDA
)'$VKDUHVUHJXODWRU\UHVSRQVLELOLWLHVIRUZLUHOHVVSKRQHVZLWKWKH)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQ)&&$OOSKRQHVWKDWDUHVROGLQWKH8QLWHG6WDWHV
PXVWFRPSO\ZLWK)&&VDIHW\JXLGHOLQHVWKDWOLPLW5)H[SRVXUH)&&UHOLHVRQ)'$
DQGRWKHUKHDOWKDJHQFLHVIRUVDIHW\TXHVWLRQVDERXWZLUHOHVVSKRQHV)&&DOVR
UHJXODWHVWKHEDVHVWDWLRQVWKDWWKHZLUHOHVVSKRQHQHWZRUNVUHO\XSRQ:KLOHWKHVH
EDVHVWDWLRQVRSHUDWHDWKLJKHUSRZHUWKDQGRWKHZLUHOHVVSKRQHVWKHPVHOYHVWKH
5)H[SRVXUHVWKDWSHRSOHJHWIURPWKHVHEDVHVWDWLRQVDUHW\SLFDOO\WKRXVDQGVRI
WLPHVORZHUWKDQWKRVHWKH\FDQJHWIURPZLUHOHVVSKRQHV%DVHVWDWLRQVDUHWKXVQRW
WKHVXEMHFWRIWKHVDIHW\TXHVWLRQVGLVFXVVHGLQWKLVGRFXPHQW
3. What kinds of phones are the subject of this update?
7KHWHUPZLUHOHVVSKRQHUHIHUVKHUHWRKDQGKHOGZLUHOHVVSKRQHVZLWKEXLOWLQ
DQWHQQDVRIWHQFDOOHGFHOOPRELOHRU3&6SKRQHV7KHVHW\SHVRIZLUHOHVVSKRQHV
FDQH[SRVHWKHXVHUWRPHDVXUDEOHUDGLRIUHTXHQF\HQHUJ\5)EHFDXVHRIWKHVKRUW
GLVWDQFHEHWZHHQWKHSKRQHDQGWKHXVHUVKHDG7KHVH5)H[SRVXUHVDUHOLPLWHGE\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQVDIHW\JXLGHOLQHVWKDWZHUHGHYHORSHGZLWK
WKHDGYLFHRI)'$DQGRWKHUIHGHUDOKHDOWKDQGVDIHW\DJHQFLHV:KHQWKHSKRQHLV
ORFDWHGDWJUHDWHUGLVWDQFHVIURPWKHXVHUWKHH[SRVXUHWR5)LVGUDVWLFDOO\ORZHU
EHFDXVHDSHUVRQ V5)H[SRVXUHGHFUHDVHVUDSLGO\ZLWKLQFUHDVLQJGLVWDQFHIURPWKH
VRXUFH7KHVRFDOOHGFRUGOHVVSKRQHVZKLFKKDYHDEDVHXQLWFRQQHFWHGWRWKH
WHOHSKRQHZLULQJLQDKRXVHW\SLFDOO\RSHUDWHDWIDUORZHUSRZHUOHYHOVDQGWKXV
SURGXFH5)H[SRVXUHVIDUEHORZWKH)&&VDIHW\OLPLWV
4. What are the results of the research done already?
7KHUHVHDUFKGRQHWKXVIDUKDVSURGXFHGFRQIOLFWLQJUHVXOWVDQGPDQ\VWXGLHVKDYH
VXIIHUHGIURPIODZVLQWKHLUUHVHDUFKPHWKRGV$QLPDOH[SHULPHQWVLQYHVWLJDWLQJWKH
HIIHFWVRIUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHVFKDUDFWHULVWLFRIZLUHOHVVSKRQHV
KDYH\LHOGHGFRQIOLFWLQJUHVXOWVWKDWRIWHQFDQQRWEHUHSHDWHGLQRWKHUODERUDWRULHV
$IHZDQLPDOVWXGLHVKRZHYHUKDYHVXJJHVWHGWKDWORZOHYHOVRI5)FRXOGDFFHOHUDWH
WKHGHYHORSPHQWRIFDQFHULQODERUDWRU\DQLPDOV+RZHYHUPDQ\RIWKHVWXGLHVWKDW
VKRZHGLQFUHDVHGWXPRUGHYHORSPHQWXVHGDQLPDOVWKDWKDGEHHQJHQHWLFDOO\
HQJLQHHUHGRUWUHDWHGZLWKFDQFHUFDXVLQJFKHPLFDOVVRDVWREHSUHGLVSRVHGWR
GHYHORSFDQFHULQWKHDEVHQFHRI5)H[SRVXUH2WKHUVWXGLHVH[SRVHGWKHDQLPDOVWR
5)IRUXSWRKRXUVSHUGD\7KHVHFRQGLWLRQVDUHQRWVLPLODUWRWKHFRQGLWLRQV
XQGHUZKLFKSHRSOHXVHZLUHOHVVSKRQHVVRZHGRQWNQRZZLWKFHUWDLQW\ZKDWWKH
UHVXOWVRIVXFKVWXGLHVPHDQIRUKXPDQKHDOWK
7KUHHODUJHHSLGHPLRORJ\VWXGLHVKDYHEHHQSXEOLVKHGVLQFH'HFHPEHU
%HWZHHQWKHPWKHVWXGLHVLQYHVWLJDWHGDQ\SRVVLEOHDVVRFLDWLRQEHWZHHQWKHXVHRI
ZLUHOHVVSKRQHVDQGSULPDU\EUDLQFDQFHUJOLRPDPHQLQJLRPDRUDFRXVWLF
QHXURPDWXPRUVRIWKHEUDLQRUVDOLYDU\JODQGOHXNHPLDRURWKHUFDQFHUV1RQH
RIWKHVWXGLHVGHPRQVWUDWHGWKHH[LVWHQFHRIDQ\KDUPIXOKHDOWKHIIHFWVIURP
ZLUHOHVVSKRQH5)H[SRVXUHV+RZHYHUQRQHRIWKHVWXGLHVFDQDQVZHUTXHVWLRQV
DERXWORQJWHUPH[SRVXUHVVLQFHWKHDYHUDJHSHULRGRISKRQHXVHLQWKHVHVWXGLHV
ZDVDURXQGWKUHH\HDUV
5.What research is needed to decide whether RF exposure from wireless phones poses a health risk?
[ 119 ]
6820.ENv1_9310322.book Page 120 Wednesday, October 15, 2003 1:43 PM
$FRPELQDWLRQRIODERUDWRU\VWXGLHVDQGHSLGHPLRORJLFDOVWXGLHVRISHRSOHDFWXDOO\
XVLQJZLUHOHVVSKRQHVZRXOGSURYLGHVRPHRIWKHGDWDWKDWDUHQHHGHG/LIHWLPH
DQLPDOH[SRVXUHVWXGLHVFRXOGEHFRPSOHWHGLQDIHZ\HDUV+RZHYHUYHU\ODUJH
QXPEHUVRIDQLPDOVZRXOGEHQHHGHGWRSURYLGHUHOLDEOHSURRIRIDFDQFHU
SURPRWLQJHIIHFWLIRQHH[LVWV(SLGHPLRORJLFDOVWXGLHVFDQSURYLGHGDWDWKDWLV
GLUHFWO\DSSOLFDEOHWRKXPDQSRSXODWLRQVEXWRUPRUH\HDUVIROORZXSPD\EH
QHHGHGWRSURYLGHDQVZHUVDERXWVRPHKHDOWKHIIHFWVVXFKDVFDQFHU7KLVLVEHFDXVH
WKHLQWHUYDOEHWZHHQWKHWLPHRIH[SRVXUHWRDFDQFHUFDXVLQJDJHQWDQGWKHWLPH
WXPRUVGHYHORSLIWKH\GRPD\EHPDQ\PDQ\\HDUV7KHLQWHUSUHWDWLRQRI
HSLGHPLRORJLFDOVWXGLHVLVKDPSHUHGE\GLIILFXOWLHVLQPHDVXULQJDFWXDO5)H[SRVXUH
GXULQJGD\WRGD\XVHRIZLUHOHVVSKRQHV0DQ\IDFWRUVDIIHFWWKLVPHDVXUHPHQW
VXFKDVWKHDQJOHDWZKLFKWKHSKRQHLVKHOGRUZKLFKPRGHORISKRQHLVXVHG
6. What is FDA doing to find out more about the possible health effects of wireless phone RF?
)'$LVZRUNLQJZLWKWKH861DWLRQDO7R[LFRORJ\3URJUDPDQGZLWKJURXSVRI
LQYHVWLJDWRUVDURXQGWKHZRUOGWRHQVXUHWKDWKLJKSULRULW\DQLPDOVWXGLHVDUH
FRQGXFWHGWRDGGUHVVLPSRUWDQWTXHVWLRQVDERXWWKHHIIHFWVRIH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)
)'$KDVEHHQDOHDGLQJSDUWLFLSDQWLQWKH:RUOG+HDOWK2UJDQL]DWLRQ,QWHUQDWLRQDO
(OHFWURPDJQHWLF)LHOGV(0)3URMHFWVLQFHLWVLQFHSWLRQLQ$QLQIOXHQWLDO
UHVXOWRIWKLVZRUNKDVEHHQWKHGHYHORSPHQWRIDGHWDLOHGDJHQGDRIUHVHDUFKQHHGV
WKDWKDVGULYHQWKHHVWDEOLVKPHQWRIQHZUHVHDUFKSURJUDPVDURXQGWKHZRUOG7KH
3URMHFWKDVDOVRKHOSHGGHYHORSDVHULHVRISXEOLFLQIRUPDWLRQGRFXPHQWVRQ(0)
LVVXHV
)'$DQGWKH&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ&7,$KDYHD
IRUPDO&RRSHUDWLYH5HVHDUFKDQG'HYHORSPHQW$JUHHPHQW&5$'$WRGR
UHVHDUFKRQZLUHOHVVSKRQHVDIHW\)'$SURYLGHVWKHVFLHQWLILFRYHUVLJKWREWDLQLQJ
LQSXWIURPH[SHUWVLQJRYHUQPHQWLQGXVWU\DQGDFDGHPLFRUJDQL]DWLRQV&7,$
IXQGHGUHVHDUFKLVFRQGXFWHGWKURXJKFRQWUDFWVWRLQGHSHQGHQWLQYHVWLJDWRUV7KH
LQLWLDOUHVHDUFKZLOOLQFOXGHERWKODERUDWRU\VWXGLHVDQGVWXGLHVRIZLUHOHVVSKRQH
XVHUV7KH&5$'$ZLOODOVRLQFOXGHDEURDGDVVHVVPHQWRIDGGLWLRQDOUHVHDUFK
QHHGVLQWKHFRQWH[WRIWKHODWHVWUHVHDUFKGHYHORSPHQWVDURXQGWKHZRUOG
7. How can I find out how much radiofrequency energy exposure I can get by using my wireless phone?
$OOSKRQHVVROGLQWKH8QLWHG6WDWHVPXVWFRPSO\ZLWK)HGHUDO&RPPXQLFDWLRQV
&RPPLVVLRQ)&&JXLGHOLQHVWKDWOLPLWUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHV
)&&HVWDEOLVKHGWKHVHJXLGHOLQHVLQFRQVXOWDWLRQZLWK)'$DQGWKHRWKHUIHGHUDO
KHDOWKDQGVDIHW\DJHQFLHV7KH)&&OLPLWIRU5)H[SRVXUHIURPZLUHOHVVWHOHSKRQHV
LVVHWDWD6SHFLILF$EVRUSWLRQ5DWH6$5RIZDWWVSHUNLORJUDP:NJ7KH
)&&OLPLWLVFRQVLVWHQWZLWKWKHVDIHW\VWDQGDUGVGHYHORSHGE\WKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLF(QJLQHHULQJ,(((DQGWKH1DWLRQDO&RXQFLORQ
5DGLDWLRQ3URWHFWLRQDQG0HDVXUHPHQW7KHH[SRVXUHOLPLWWDNHVLQWR
FRQVLGHUDWLRQWKHERG\VDELOLW\WRUHPRYHKHDWIURPWKHWLVVXHVWKDWDEVRUEHQHUJ\
IURPWKHZLUHOHVVSKRQHDQGLVVHWZHOOEHORZOHYHOVNQRZQWRKDYHHIIHFWV
[ 120 ]
6820.ENv1_9310322.book Page 121 Wednesday, October 15, 2003 1:43 PM Appendix B Message from the FDA 0DQXIDFWXUHUVRIZLUHOHVVSKRQHVPXVWUHSRUWWKH5)H[SRVXUHOHYHOIRUHDFKPRGHO
RISKRQHWRWKH)&&7KH)&&ZHEVLWHKWWSZZZIFFJRYRHWUIVDIHW\JLYHV
GLUHFWLRQVIRUORFDWLQJWKH)&&LGHQWLILFDWLRQQXPEHURQ\RXUSKRQHVR\RXFDQILQG
\RXUSKRQHV5)H[SRVXUHOHYHOLQWKHRQOLQHOLVWLQJ
8. What has FDA done to measure the radiofrequency energy coming from wireless phones?
7KH,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((LVGHYHORSLQJDWHFKQLFDO
VWDQGDUGIRUPHDVXULQJWKHUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHIURPZLUHOHVV
SKRQHVDQGRWKHUZLUHOHVVKDQGVHWVZLWKWKHSDUWLFLSDWLRQDQGOHDGHUVKLSRI)'$
VFLHQWLVWVDQGHQJLQHHUV7KHVWDQGDUG5HFRPPHQGHG3UDFWLFHIRU'HWHUPLQLQJWKH
6SDWLDO3HDN6SHFLILF$EVRUSWLRQ5DWH6$5LQWKH+XPDQ%RG\'XHWR:LUHOHVV
&RPPXQLFDWLRQV'HYLFHV([SHULPHQWDO7HFKQLTXHVVHWVIRUWKWKHILUVWFRQVLVWHQW
WHVWPHWKRGRORJ\IRUPHDVXULQJWKHUDWHDWZKLFK5)LVGHSRVLWHGLQWKHKHDGVRI
ZLUHOHVVSKRQHXVHUV7KHWHVWPHWKRGXVHVDWLVVXHVLPXODWLQJPRGHORIWKHKXPDQ
KHDG6WDQGDUGL]HG6$5WHVWPHWKRGRORJ\LVH[SHFWHGWRJUHDWO\LPSURYHWKH
FRQVLVWHQF\RIPHDVXUHPHQWVPDGHDWGLIIHUHQWODERUDWRULHVRQWKHVDPHSKRQH
6$5LVWKHPHDVXUHPHQWRIWKHDPRXQWRIHQHUJ\DEVRUEHGLQWLVVXHHLWKHUE\WKH
ZKROHERG\RUDVPDOOSDUWRIWKHERG\,WLVPHDVXUHGLQZDWWVNJRUPLOOLZDWWVJ
RIPDWWHU7KLVPHDVXUHPHQWLVXVHGWRGHWHUPLQHZKHWKHUDZLUHOHVVSKRQH
FRPSOLHVZLWKVDIHW\JXLGHOLQHV
9. What steps can I take to reduce my exposure to radiofrequency energy from my wireless phone?
,IWKHUHLVDULVNIURPWKHVHSURGXFWVDQGDWWKLVSRLQWZHGRQRWNQRZWKDWWKHUH
LVLWLVSUREDEO\YHU\VPDOO%XWLI\RXDUHFRQFHUQHGDERXWDYRLGLQJHYHQSRWHQWLDO
ULVNV\RXFDQWDNHDIHZVLPSOHVWHSVWRPLQLPL]H\RXUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\5)6LQFHWLPHLVDNH\IDFWRULQKRZPXFKH[SRVXUHDSHUVRQUHFHLYHV
UHGXFLQJWKHDPRXQWRIWLPHVSHQWXVLQJDZLUHOHVVSKRQHZLOOUHGXFH5)H[SRVXUH
,I\RXPXVWFRQGXFWH[WHQGHGFRQYHUVDWLRQVE\ZLUHOHVVSKRQHHYHU\GD\\RX
FRXOGSODFHPRUHGLVWDQFHEHWZHHQ\RXUERG\DQGWKHVRXUFHRIWKH5)VLQFHWKH
H[SRVXUHOHYHOGURSVRIIGUDPDWLFDOO\ZLWKGLVWDQFH)RUH[DPSOH\RXFRXOGXVHD
KHDGVHWDQGFDUU\WKHZLUHOHVVSKRQHDZD\IURP\RXUERG\RUXVHDZLUHOHVVSKRQH
FRQQHFWHGWRDUHPRWHDQWHQQD
$JDLQWKHVFLHQWLILFGDWDGRQRWGHPRQVWUDWHWKDWZLUHOHVVSKRQHVDUHKDUPIXO%XW
LI\RXDUHFRQFHUQHGDERXWWKH5)H[SRVXUHIURPWKHVHSURGXFWV\RXFDQXVH
PHDVXUHVOLNHWKRVHGHVFULEHGDERYHWRUHGXFH\RXU5)H[SRVXUHIURPZLUHOHVV
SKRQHXVH
10. What about children using wireless phones?
7KHVFLHQWLILFHYLGHQFHGRHVQRWVKRZDGDQJHUWRXVHUVRIZLUHOHVVSKRQHV
LQFOXGLQJFKLOGUHQDQGWHHQDJHUV,I\RXZDQWWRWDNHVWHSVWRORZHUH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)WKHPHDVXUHVGHVFULEHGDERYHZRXOGDSSO\WRFKLOGUHQ
DQGWHHQDJHUVXVLQJZLUHOHVVSKRQHV5HGXFLQJWKHWLPHRIZLUHOHVVSKRQHXVHDQG
LQFUHDVLQJWKHGLVWDQFHEHWZHHQWKHXVHUDQGWKH5)VRXUFHZLOOUHGXFH5)
H[SRVXUH6RPHJURXSVVSRQVRUHGE\RWKHUQDWLRQDOJRYHUQPHQWVKDYHDGYLVHGWKDW
FKLOGUHQEHGLVFRXUDJHGIURPXVLQJZLUHOHVVSKRQHVDWDOO)RUH[DPSOHWKH
[ 121 ]
6820.ENv1_9310322.book Page 122 Wednesday, October 15, 2003 1:43 PM JRYHUQPHQWLQWKH8QLWHG.LQJGRPGLVWULEXWHGOHDIOHWVFRQWDLQLQJVXFKD
UHFRPPHQGDWLRQLQ'HFHPEHU7KH\QRWHGWKDWQRHYLGHQFHH[LVWVWKDWXVLQJ
DZLUHOHVVSKRQHFDXVHVEUDLQWXPRUVRURWKHULOOHIIHFWV7KHLUUHFRPPHQGDWLRQWR
OLPLWZLUHOHVVSKRQHXVHE\FKLOGUHQZDVVWULFWO\SUHFDXWLRQDU\LWZDVQRWEDVHGRQ
VFLHQWLILFHYLGHQFHWKDWDQ\KHDOWKKD]DUGH[LVWV
11. What about wireless phone interference with medical equipment?
5DGLRIUHTXHQF\HQHUJ\5)IURPZLUHOHVVSKRQHVFDQLQWHUDFWZLWKVRPHHOHFWURQLF
GHYLFHV)RUWKLVUHDVRQ)'$KHOSHGGHYHORSDGHWDLOHGWHVWPHWKRGWRPHDVXUH
HOHFWURPDJQHWLFLQWHUIHUHQFH(0,RILPSODQWHGFDUGLDFSDFHPDNHUVDQG
GHILEULOODWRUVIURPZLUHOHVVWHOHSKRQHV7KLVWHVWPHWKRGLVQRZSDUWRIDVWDQGDUG
VSRQVRUHGE\WKH$VVRFLDWLRQIRUWKH$GYDQFHPHQWRI0HGLFDOLQVWUXPHQWDWLRQ
$$0,7KHILQDOGUDIWDMRLQWHIIRUWE\)'$PHGLFDOGHYLFHPDQXIDFWXUHUVDQG
PDQ\RWKHUJURXSVZDVFRPSOHWHGLQODWH7KLVVWDQGDUGZLOODOORZ
PDQXIDFWXUHUVWRHQVXUHWKDWFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVDUHVDIHIURP
ZLUHOHVVSKRQH(0,)'$KDVWHVWHGKHDULQJDLGVIRULQWHUIHUHQFHIURPKDQGKHOG
ZLUHOHVVSKRQHVDQGKHOSHGGHYHORSDYROXQWDU\VWDQGDUGVSRQVRUHGE\WKH,QVWLWXWH
RI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((7KLVVWDQGDUGVSHFLILHVWHVWPHWKRGV
DQGSHUIRUPDQFHUHTXLUHPHQWVIRUKHDULQJDLGVDQGZLUHOHVVSKRQHVVRWKDWQR
LQWHUIHUHQFHRFFXUVZKHQDSHUVRQXVHVDFRPSDWLEOHSKRQHDQGDDFFRPSDQLHG
KHDULQJDLGDWWKHVDPHWLPH7KLVVWDQGDUGZDVDSSURYHGE\WKH,(((LQ
)'$FRQWLQXHVWRPRQLWRUWKHXVHRIZLUHOHVVSKRQHVIRUSRVVLEOHLQWHUDFWLRQVZLWK
RWKHUPHGLFDOGHYLFHV6KRXOGKDUPIXOLQWHUIHUHQFHEHIRXQGWRRFFXU)'$ZLOO
FRQGXFWWHVWLQJWRDVVHVVWKHLQWHUIHUHQFHDQGZRUNWRUHVROYHWKHSUREOHP
12. Where can I find additional information?
)RUDGGLWLRQDOLQIRUPDWLRQSOHDVHUHIHUWRWKHIROORZLQJUHVRXUFHV
)'$ZHESDJHRQZLUHOHVVSKRQHV KWWSZZZIGDJRYFGUKSKRQHVLQGH[KWPO
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&5)6DIHW\3URJUDP
KWWSZZZIFFJRYRHWUIVDIHW\
,QWHUQDWLRQDO&RPPLVVLRQRQ1RQ,RQL]LQJ5DGLDWLRQ3URWHFWLRQ KWWSZZZLFQLUSGH
:RUOG+HDOWK2UJDQL]DWLRQ:+2,QWHUQDWLRQDO(0)3URMHFW KWWSZZZZKRLQWHPI 1DWLRQDO5DGLRORJLFDO3URWHFWLRQ%RDUG8. KWWSZZZQUSERUJXN
-XO\)RUXSGDWHVKWWSZZZIGDJRYFGUKSKRQHV
[ 122 ]
6820.ENv1_9310322.book Page 123 Wednesday, October 15, 2003 1:43 PM Index B battery operation times 100 C customer care 12 I IMEI location on the phone 11 M menu shortcuts 29 P phone illustration 3 S shortcuts, menu 29 standby times and talk times 106 T talk time 106 8260 User Guide
Copyright Nokia 2003 6820.ENv1_9310322.book Page 124 Wednesday, October 15, 2003 1:43 PM 124 Copyright Nokia 2003 6820.ENv1_9310322.book Page 125 Wednesday, October 15, 2003 1:43 PM Para obtener un manual del usuario en espaol favor de llamar o enviar un fax al telfono 1-888-NOKIA-2U, fax 813-249-9619.
6820.ENv1_9310322.book Page 126 Wednesday, October 15, 2003 1:43 PM
Copyright Nokia 2003
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2003-11-07 | 1850.2 ~ 1909.8 | PCE - PCS Licensed Transmitter held to ear | Original Equipment |
2 | 2402 ~ 2480 | DSS - Part 15 Spread Spectrum Transmitter |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 | Effective |
2003-11-07
|
||||
1 2 | Applicant's complete, legal business name |
Microsoft Corporation
|
||||
1 2 | FCC Registration Number (FRN) |
0016179699
|
||||
1 2 | Physical Address |
1 Microsoft Way
|
||||
1 2 |
Redmond, Washington 98052
|
|||||
1 2 |
United States
|
|||||
app s | TCB Information | |||||
1 2 | TCB Application Email Address |
h******@americantcb.com
|
||||
1 2 | TCB Scope |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
||||
1 2 |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
|||||
app s | FCC ID | |||||
1 2 | Grantee Code |
PYA
|
||||
1 2 | Equipment Product Code |
NHL-9
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 | Name |
H******** S******
|
||||
1 2 | Title |
Director, EMC, SI and RF Compliance
|
||||
1 2 | Telephone Number |
1-425********
|
||||
1 2 | Fax Number |
1-425********
|
||||
1 2 |
h******@microsoft.com
|
|||||
app s | Technical Contact | |||||
1 2 | Firm Name |
Nokia Corporation
|
||||
1 2 | Name |
T****** L******
|
||||
1 2 | Physical Address |
Joensuunkatu 7e
|
||||
1 2 |
Salo, 24101
|
|||||
1 2 |
Finland
|
|||||
1 2 | Telephone Number |
011 3********
|
||||
1 2 | Fax Number |
011 3********
|
||||
1 2 |
t******@nokia.com
|
|||||
app s | Non Technical Contact | |||||
n/a | ||||||
app s | Confidentiality (long or short term) | |||||
1 2 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 | Equipment Class | PCE - PCS Licensed Transmitter held to ear | ||||
1 2 | DSS - Part 15 Spread Spectrum Transmitter | |||||
1 2 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | GSM 900/1800/1900 Cellular Telephone w/Bluetooth | ||||
1 2 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 2 | Modular Equipment Type | Does not apply | ||||
1 2 | Purpose / Application is for | Original Equipment | ||||
1 2 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | Yes | ||||
1 2 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 | Grant Comments | Power Output is EIRP. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and which provide at least 1.5 cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Head: 0.66W/kg; Body-worn 1.2W/kg. This device contains 900/1800 MHz GSM functions that are not operational in U.S. Territories. This filing is only applicable for 1900 MHz PCS operations. | ||||
1 2 | Power Output listed is Conducted. The Bluetooth and PCS antennae contained in this transmitter are collocated. End-users and installers must be provided with antenna installation instructions and transmitter operating conditions for satisfying RF exposure compliance. | |||||
1 2 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 2 | Firm Name |
Intertek ETL Semko Oy
|
||||
1 2 | Name |
T****** H********
|
||||
1 2 | Telephone Number |
358-1********
|
||||
1 2 | Fax Number |
358-1********
|
||||
1 2 |
t******@intertek.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 24E | BC | 1850.2 | 1909.8 | 1.13 | 0.034 ppm | 247KGXW | |||||||||||||||||||||||||||||||||
1 | 2 | 24E | BC | 1850.2 | 1909.8 | 0.9 | 0.34 ppm | 247KG7W | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 15C | CE | 2402.00000000 | 2480.00000000 | 0.0010000 |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC