all | frequencies |
|
|
exhibits | applications |
---|---|---|---|---|---|
manuals |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 |
|
Manual a | Users Manual | 2.39 MiB | ||||
1 2 |
|
Manual b | Users Manual | 2.05 MiB | ||||
1 2 | Cover Letter(s) | |||||||
1 2 | External Photos | |||||||
1 2 | ID Label/Location Info | |||||||
1 2 | Internal Photos | |||||||
1 2 | Internal Photos | |||||||
1 2 | Cover Letter(s) | |||||||
1 2 | Cover Letter(s) | |||||||
1 2 | RF Exposure Info | |||||||
1 2 | RF Exposure Info | |||||||
1 2 | Test Report | |||||||
1 2 | Test Report | |||||||
1 2 | External Photos | |||||||
1 2 | ID Label/Location Info | |||||||
1 2 | Internal Photos | |||||||
1 2 | RF Exposure Info | |||||||
1 2 | RF Exposure Info | |||||||
1 2 | Test Setup Photos | |||||||
1 2 | Test Report |
1 2 | Manual a | Users Manual | 2.39 MiB |
09 Feb 2004 USER GUIDE Following is a preliminary draft copy of the US English User Guide for FCC ID: QURNHL-12, IC: 661AC-NHL12 Exhibit 08: User Guide Applicant: Nokia Corporation FCC ID: QURNHL-12 IC: 661AC-NHL12 Copyright 2004 Nokia. All rights reserved. Nokia 6620 User Guide Phone information Numbers Where is the number?
My number Voice mail number Wireless providers number Providers customer care Model number Type number IMEI number Wireless service provider Wireless service provider Wireless service provider Wireless service provider Label on back of phone (under battery). Label on back of phone (under battery). Label on back of phone (under battery). ii Copyright 2004 Nokia LEGAL INFORMATION 168 PART NO. 9310640, ISSUE NO. 1 Copyright 2004 Nokia. All rights reserved. Nokia, Nokia 6620, Nokia Connecting People, and the Nokia Original Enhancements logos are trademarks or registered trademarks of Nokia Corporation. Other company and product names mentioned herein may be trademarks or trade names of their respective owners. Nokia tune is a sound mark of Nokia Corporation. This product includes software licensed from Symbian Ltd 1998-2003 1998-2003 Symbian Ltd. All rights reserved. Symbian and Symbian OS are trademarks of Symbian Ltd. All rights reserved. Printed in Canada, February 2004 Includes RSA BSAFE cryptographic or security protocol software from RSA Security. Java is a trademark of Sun Microsystems, Inc. USE OF THIS PRODUCT IN ANY MANNER THAT COMPLIES WITH THE MPEG-4 VISUAL STANDARD IS PROHIBITED, EXCEPT FOR USE DIRECTLY RELATED TO (A) DATA OR INFORMATION (i) GENERATED BY AND OBTAINED WITHOUT CHARGE FROM A CONSUMER NOT THEREBY ENGAGED IN A BUSINESS ENTERPRISE, AND (ii) FOR PERSONAL USE ONLY; AND (B) OTHER USES SPECIFICALLY AND SEPARATELY LICENSED BY MPEG LA, L.L.C. The information contained in this user guide was written for the Nokia 6620 product. Nokia operates a policy of ongoing development. Nokia reserves the right to make changes to any of the products described in this document without prior notice. UNDER NO CIRCUMSTANCES SHALL NOKIA BE RESPONSIBLE FOR ANY LOSS OF DATA OR INCOME OR ANY SPECIAL, INCIDENTAL, AND CONSEQUENTIAL OR INDIRECT DAMAGES HOWSOEVER CAUSED. THE CONTENTS OF THIS DOCUMENT ARE PROVIDED "AS IS." EXCEPT AS REQUIRED BY APPLICABLE LAW, NO WARRANTIES OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE MADE IN RELATION TO THE ACCURACY AND RELIABILITY OR CONTENTS OF THIS DOCUMENT. NOKIA RESERVES THE RIGHT TO REVISE THIS DOCUMENT OR WITHDRAW IT AT ANY TIME WITHOUT PRIOR NOTICE. EXPORT CONTROLS This device contains commodities, technology, or software exported from the United States in accordance with the Export Administration regulations. Diversion contrary to U.S. or Canadian law is prohibited. Nokia 6620 User Guide
LLL Copyright 2004 Nokia FCC/INDUSTRY CANADA NOTICE Your device may cause TV or radio interference (for example, when using a telephone in close proximity to receiving equipment). The FCC or Industry Canada can require you to stop using your telephone if such interference cannot be eliminated. If you require assistance, contact your local service facility. This device complies with part 15 of the FCC rules. Operation is subject to the condition that this device does not cause harmful interference. Stac , LZS , 1996, Stac, Inc., 1994-1996 Microsoft Corporation. Includes one or more U.S. Patents: No. 4701745, 5016009, 5126739, 5146221, and 5414425. Other patents pending. Hi/fn , LZS ,1988-98, Hi/fn. Includes one or more U.S. Patents: No. 4701745, 5016009, 5126739, 5146221, and 5414425. Other patents pending. Part of the software in this product is Copyright ANT Ltd. 1998. All rights reserved. m-Router Connectivity Components 2000-2002 Intuwave Limited. All rights reserved.
(www.intuwave.com) US Patent No 5818437 and other pending patents. T9 text input software Copyright (C) 1997-2003. Tegic Communications, Inc. All rights reserved. Manufactured or sold under one or more of the following US patents:
4868846 5241583 5384782 5553125 5692032 5844884 5914796 5987137 6038238 6072787 6115617 6148209 6249584 6314166 6381468 6198928 5699482 5862178 6011971 6195338 6438370 4945633 5311151 5396657 5557639 5729541 5845219 5917868 5991857 6043760 6081732 6119180 6151485 6259312 6324389 6392660 4969192 5701392 5898925 6031827 6199035 6456237 5001372 5317283 5400949 5565821 5760568 5870683 5920826 6006114 6047196 6084920 6121846 6151507 6266330 6324412 6400958 5266782 5722074 5930233 6118775 6240076 RE32580 5101175 5331638 5416435 5570369 5794142 5884103 5956332 6011853 6049796 6084962 6128509 6163609 6272361 6347218 6453179 5390223 5754976 5946651 6128322 6266321 5818437 5151946 5335362 5442521 5581244 5802465 5889770 5956625 6014551 6050415 6094587 6138091 6164547 6282436 6363259 6463278 5444816 5805301 5960354 6137789 6285888 5953541 5173927 5353328 5446364 5600708 5809413 5907823 5956633 6014573 6055439 6097964 6140966 6167248 6292668 6370362 6470470 5487084 5835889 5960389 6167248 6356759 6011554 5212834 5371481 5479476 5625274 5827082 5912570 5966378 6026161 6060193 6105784 6144243 6185295 6295286 6370389 6487397 5640395 5857151 5963901 6170073 6377803 4558302 5230091 5378935 5526366 5677620 5839101 5914690 5977887 6035189 6069923 6112099 6144676 6188909 6311054 6377820 6522670 5664053 5859843 6005857 6178535 6430163 iv Copyright 2004 Nokia Nokia 6620 phone at a glance Power key (on top) Camera lens Earpiece Speaker Display Send key Menu key Edit key Left selection key Five-way joystick End key Clear key Right selection key Note: The internet symbol on the 0 key does not appear on all phones. Charger connector, Pop-Port connector, and microphone (on bottom) Nokia 6620 User Guide
Y Copyright 2004 Nokia Quick guide Make a call Answer a call Answer call during call End a call Decline a call Mute a call Redial Adjust call volume Use the in-call menu Save a name and number Use 1-touch dialing Look up a name Check voice mail Write and send text messages Send a picture message Read a new message Press Press and hold Enter a phone number, and press the Send key. Press the Send key. Select Options > Answer call. Press the End key. Press the End key. Select Options > Mute during a call. Press the Send key twice. Scroll left or right with the joystick during a call. Select Options during a call. Enter a number, select Options > Save to contacts > New entry, choose a category, enter a name, and select Done. Press and hold a key (28). You must assign a key to a number in Contacts. See "Assign 1-touch dialing keys,"
p. 31. Select Menu > Contacts > Find. Press and hold the 1 key (contact your service provider for details). Select Menu > Messages > Text messages > Create message. Enter the recipient in the to field. Enter the text message and select Options > Send. Select Menu > Messages > Text messages > Create message > Options > Insert picture. Scroll to the picture you want and press Select. Enter the recipient in the to field. Enter the text message and select Options > Send. If a new message arrives, select Show, to display the message. Press a key briefly and release it. Press and hold a key for 2 to 3 seconds and release it. vi Copyright 2004 Nokia Nokia 6620 phone at a glance . v Quick guide. vi 1 FOR YOUR SAFETY . 1 Network services. 2 Shared memory. 3 2 General information . 4 Register your phone . 4 E-Newsletters . 4 Follow graphic clues. 4 Finding the phone label . 5 Contacting Nokia . 5 Accessibility solutions . 6 3 Getting started . 7 Remove the back cover . 8 Insert the SIM card. 9 Insert the memory card . 10 Insert the battery . 11 Charge the battery . 11 Switch the phone on (or off) . 12 Tips on efficient operation . 12 If the phone requests a PIN code . 12 If the phone requests a lock code . 12 Set the time and date. 13 Make a call . 13 Standby mode . 13
[ vii ]
Icons . 14 Menu . 16 Options lists . 17 Help . 17 Navigation bar . 17 Actions common to all applications . 18 Search for items . 19 Volume control . 19 Keyguard . 20 4 Your phone. 21 Make a call . 21 Answer a call. 23 Call log . 24 5 Personal information . 28 Contacts . 28 Presence (network service) . 32 Calendar . 34 To-do . 37 Import data from compatible Nokia phones . 38 6 Multimedia. 39 Cameras. 39 View images . 42 RealOne Player . 43 Gallery . 45 7 Messaging . 49
[ viii ]
Write text . 50 Write and send messages. 53 View a multimedia presentation . 55 Inboxreceiving messages. 55 My folders . 57 Remote mailbox (network service) . 57 Outbox . 59 View messages on a SIM card . 60 Cell broadcast (network service) . 60 Service command editor. 61 settings . 61 8 Tools . 66 Settings . 66 File manager . 76 9 Personalization . 78 Profiles. 78 Themes. 79 Go to . 81 10 Extras . 83 Wallet . 83 Calculator . 86 Converter. 86 Notes . 88 Clock . 88 Recorder . 89 Voice commands. 89
[ ix ]
Instant messaging (IM) (network service) . 91 Memory card. 97 11 Web Browser and Applications . 99 Web (Mobile browser) . 99 Configuration manager . 105 Application manager . 106 12 Connectivity . 110 Bluetooth connection. 110 Infrared connection . 113 USB connection . 115 Connection manager . 115 Connect your phone to a compatible computer . 116 Syncremote synchronization. 117 13 Troubleshooting . 119 SIM card . 119 Memory low . 119 Different ways to store data . 120 Q&A . 120 14 Reference information . 124 Battery information . 124 Enhancements. 124 Enhancements, Batteries, and Chargers . 125 Care and maintenance . 128 Additional safety information . 128 Emergency calls . 130
[ x ]
Certification Information (SAR). 131 Nokia 6620 technical information . 133 Message from the CTIA . 139 Message from the FDA . 143 Index. 149
[ xi ]
[ xii ]
FOR YOUR SAFETY 1 FOR YOUR SAFETY Read these simple guidelines. Not following them may be dangerous or illegal. Read the complete user guide for further information. SWITCH ON SAFELY Do not switch the phone on when wireless phone use is prohibited or when it may cause interference or danger. ROAD SAFETY COMES FIRST Obey all local laws. Always keep your hands free to operate the vehicle while driving. Your first consideration while driving should be road safety. INTERFERENCE All wireless phones may be susceptible to interference, which could affect performance. SWITCH OFF IN HOSPITALS Follow any restrictions. Switch the phone off near medical equipment. SWITCH OFF IN AIRCRAFT Follow any restrictions. Wireless devices can cause interference in aircraft. SWITCH OFF WHEN REFUELING Dont use the phone at a refueling point. Dont use near fuel or chemicals. SWITCH OFF NEAR BLASTING Follow any restrictions. Dont use the phone where blasting is in progress. USE SENSIBLY Use only in the normal position as explained in the product documentation. Dont touch the antenna unnecessarily. QUALIFIED SERVICE Only qualified personnel may install or repair this product. ENHANCEMENTS AND BATTERIES Use only approved enhancements and batteries. Do not connect incompatible products. Nokia 6620 User Guide
Copyright 2004 Nokia ENHANCEMENTS Use only approved enhancements. Do not connect incompatible products. WATER-RESISTANCE Your phone is not water-resistant. Keep it dry. BACK-UP COPIES Remember to make back-up copies or keep a written record of all important information stored in your phone. CONNECTING TO OTHER DEVICES When connecting to any other device, read its user guide for detailed safety instructions. Do not connect incompatible products. EMERGENCY CALLS Ensure the phone is switched on and in service. Press End as many times as needed to clear the display and return to the main screen. Enter the emergency number, then press Send. Give your location. Do not end the call until given permission to do so.
NETWORK SERVICES The wireless phone described in this guide is approved for use on the GSM 850, 1800, and 1900 networks. Contact your service provider for more information about networks. To use the phone you must have service from a wireless service provider. Many of the features in this device depend on features in the wireless network to function. These Network Services may not be available on all networks, or you may have to make specific arrangements with your service provider before you can utilize Network Services. Your service provider may need to give you additional instructions for their use and explain what charges will apply. Some networks may have limitations that affect how you can use Network Services. For instance, some networks may not support all language-dependent characters and services. Your service provider may have requested that certain features be disabled or not activated in your device. If so, they will not appear on your device menu. Contact your service provider for more information. When using the features in this device, obey all laws and respect privacy and legitimate rights of others. 2 Copyright 2004 Nokia Warning: To use any features in this phone, other than the alarm clock, the phone must be switched on. Do not switch the device on when wireless phone use may cause interference or danger. FOR YOUR SAFETY
SHARED MEMORY The following features in this device may share memory: contacts, text messages, e-mail messages, multimedia messages, instant messages, images and ringing tones, Video recorder, RealOne Player, calendar and to-do notes, themes, and downloaded applications. Use of one or more of these features may reduce the memory available for the remaining features sharing memory. For example, saving many images may use all of the available memory. Your phone may display a message that the memory is full when you try to use a shared memory feature. In this case, delete some of the information or entries stored in the shared memory features before continuing. Some of the features may have a certain amount of memory specially allotted to them in addition to the amount of memory shared with other features. Nokia 6620 User Guide
Copyright 2004 Nokia 2 General information Congratulations on your purchase of a Nokia mobile phone. Your phone provides many functions that are practical for daily use, such as a digital camera, a video recorder, an mp3 player, messaging, e-mail, a clock, an alarm clock, a calculator, and a calendar. Your phone can connect to a PC, laptop, or other device using a data cable, Bluetooth technology, or the built-in IR port. For more information on connectivity, refer to the PC Connectivity Guide. The PC Connectivity guide, Nokia PC Suite, and all related software can be downloaded from the U.S. Mobile Phone products section of www.nokia.com. The phone must be switched on to use all of the features in this device except for the alarm clock. Do not switch the device on when wireless phone use may cause interference or danger.
REGISTER YOUR PHONE Make sure to register your phone at www.warranty.nokiausa.com or 1-888-NOKIA-2U (1-888-665-4228) if you need to call the center or have your phone repaired.
E-NEWSLETTERS When you register your phone, you may sign up for Nokias e-newsletter Nokia Connections. You will receive tips and tricks on using your phone, accessory information, and special offers.
FOLLOW GRAPHIC CLUES This guide uses certain icons to alert you to important information. Note: Explains a feature or points out an important concept. Important: Indicates critical information on using a feature. Warning: Helps you avoid personal injury, damage to the phone, or property damage. 4 Copyright 2004 Nokia General information Information label under battery
FINDING THE PHONE LABEL If you ever need to call the Nokia Customer Care Center or your service provider, you will need to provide specific information about your phone. This information is located on the phone label, which is found on the back of the phone beneath the battery. The inside cover of this guide has a chart in which you can enter the information from your phone label so that you can refer to it easily.
CONTACTING NOKIA To help Nokia promptly answer your questions, please have the following information available before contacting the Nokia Customer Care Center (see Finding the phone label on page 5 to locate this information):
Your phone model number (Nokia 6620) Type number IMEI number Your local zip code Nokia 6620 User Guide
Copyright 2004 Nokia
The phone or accessory in question. Nokia Customer Care Center, USA Nokia Mobile Phones 7725 Woodland Center Blvd. Suite #150 Tampa, Florida 33614 Tel:1-888-NOKIA-2U
(1-888-665-4228) Fax:1-813-249-9619 For TTY/TDD users: 1-800-24-NOKIA
(1-800-246-6542) Customer Care, Canada Nokia Products Ltd. 601 Westney Road South Ajax, Ontario L1S 4N7 Tel:1-888-22-NOKIA
(1-888-226-6542) Website: www.nokia.ca
ACCESSIBILITY SOLUTIONS Nokia is committed to making mobile phones easy to use for all users including those with disabilities. For more information, visit www.nokiaaccessibility.com. For more information on accessibility accessories, see Inductive Loopset LPA-4 on page 127 and Phone Adapter HDA-10 on page 127. 6 Copyright 2004 Nokia
Getting started 3 Getting started To begin using your Nokia 6620 phone, a SIM card must be inserted into the phone. You may also use a memory card with the phone. Before you attempt to insert or remove a SIM card or memory card, review the following procedures to become familiar with the inside of your phone. For a better understanding of your SIM card and memory card, see SIM card on page 119 and Memory card on page 97. Note: See Nokia 6620 phone at a glance on page v, to identify other features on your phone. Nokia 6620 User Guide
Copyright 2004 Nokia
REMOVE THE BACK COVER Before removing the phone cover, always switch off the power and disconnect the phone from the charger or any other device. Always store and use the phone with the cover attached. 1 To open the cover, with the back of the phone facing you, press the locking catch in the direction of the arrow. 1 2 2 While pressing the locking catch, slide the back cover off of the phone. Remove the battery from the phone if necessary. 3 SIM card slot Gray sliding catch: Gently slide the gray catch up and down to open the SIM card slot and the memory card slot. When the catch is in the middle position and the dots on the catch line up with the dotted line to the right of the catch, both card slots are secured. Refer to the following procedures for specific instructions on how to insert the SIM card and memory card:
Insert the SIM card on page 9 Insert the memory card on page 10 Gray sliding catch Memory card slot 8 Copyright 2004 Nokia
INSERT THE SIM CARD Getting started Keep all SIM cards out of the reach of small children. For availability and information on using SIM card services, contact your SIM card vendor. This may be the service provider, network operator, or other vendor. For a better understanding of your SIM card, see SIM card on page 119. 1 2 1 3 4 Locate the SIM card slot. Slide the gray catch toward the bottom of the phone until it reaches its lowest position. Insert the top of the SIM card under the small hood at the top of the slot and carefully slide the SIM card into the slot, until the bottom of the SIM card fits in the base of the slot. Make sure that the bevelled corner on the SIM card is facing toward the top left of the phone and that the golden contact area on the card is facing downwards. Slide the gray catch up to its midpoint position to secure the SIM card in place. The catch is in place when the dotted line on the catch lines up with the dotted line to the right of the catch. 3 2 4 Note: The catch is used to secure both the SIM card and memory card. Line up the dots Nokia 6620 User Guide
Copyright 2004 Nokia
INSERT THE MEMORY CARD Keep all memory cards out of the reach of small children. See Insert the SIM card on page 9 for details on removing the phone cover. See Memory card on page 97 for important information about what kind of memory card to use with this phone. 1 2 1 2 3 Slide the gray catch toward the top of the phone until it reaches its highest position. Insert the top of the memory card under the hood at the right side of the slot and carefully slide the memory card to the right until it fits in the slot. Make sure that the bevelled corner on the memory card is facing toward the bottom right side of the phone and that the golden contact area on the card is facing downward. Slide the catch down to its midpoint position to secure the memory card in its place. The catch is in place at its midpoint, when the dotted line on the catch lines up with the dotted line to the right of the catch. Note: If the catch is moved past the midpoint to its lowest position the SIM card will no longer be secured. To secure both the SIM card and the memory card in place, make sure that the dotted line on the catch lines up with the dotted line to the right of the catch under the phone label. 3 Line up the dots 10 Copyright 2004 Nokia Getting started
INSERT THE BATTERY 1 2 Align the golden contacts of the battery with the corresponding connectors on the phone, and push the opposite end of the battery until it snaps into place. Slide the cover back onto the phone.
CHARGE THE BATTERY 1 2 3 4 Connect the power cord to the charger. (You will hear it click into place.) Connect the power cord from the charger to the base of the phone. Connect the charger to an ac wall outlet. The battery indicator bar starts scrolling. Note that you can use the phone while charging. When the battery is fully charged, the bar stops scrolling. Disconnect the charger from the ac outlet and from the phone. See "Battery information" on page 124. Nokia 6620 User Guide
Copyright 2004 Nokia
SWITCH THE PHONE ON (OR OFF) Press and hold the Power key. Warning: Do not switch on the phone when wireless phone use is prohibited or when it may cause interference or danger.
TIPS ON EFFICIENT OPERATION Your phone has an internal antenna on the back of the phone above the camera lens. As with any other radio transmitting device, do not touch the antenna unnecessarily when the device is switched on. Contact with the antenna affects call quality and may cause the phone to operate at a higher power level than otherwise needed. Avoiding contact with the antenna area when operating the phone optimizes the antenna performance and the battery life.
IF THE PHONE REQUESTS A PIN CODE The PIN code is usually supplied with the SIM card. Key in the code (displayed as ****) and press the Right selection key. For more information on PIN codes, see Security on page 73.
IF THE PHONE REQUESTS A LOCK CODE Key in the lock code (displayed as *****) and press the Right selection key. The factory setting for the lock code is 12345. For more information on the access codes, see Security on page 73. 12 Copyright 2004 Nokia
SET THE TIME AND DATE Use the number keys 09 to key in first the current time and then the date. Press the Right selection key to accept the settings. Getting started
MAKE A CALL 1 2 3 4 In the standby mode, key in the phone number, including the area code. If you make a mistake, press the Clear key to clear numbers. Press the Send key and wait for the answer. Press the End key to finish the call or to cancel the call attempt.
STANDBY MODE B C E D G A Indicators are shown when the phone is ready for use, with no characters keyed in. In this state, the phone is in the standby mode. The graduated bar (A) shows the signal strength of the cellular network at your current location. The higher the bar, the stronger the signal. The antenna symbol is replaced with when GPRS the GPRS symbol connection has been set to When available and a connection is available in the network or in the current cell. See "GPRS" on page 71. The area to the right of the signal bar (B) shows an analog or a digital clock. See
"Date and time" on page 72. The area above the date (C) indicates in which cellular network the phone is currently being used. The graduated bar (D) shows the battery charge level. The higher the bar, the more power left in the battery. The navigation bar (E) shows the currently active profile. If the selected profile is General, the current date is displayed instead of the profile name. See "Navigation bar" on page 17. Current shortcuts (F) are assigned to the Right and Left selection keys. F Nokia 6620 User Guide
Copyright 2004 Nokia The background image (G) may be any image you select in the standby mode. See
"Themes" on page 79. Note: Your phone has a screen saver. If there are no actions for one minute, the display is cleared and a screen saver becomes visible. To deactivate the screen saver, press any key. You can also modify the screen saver display and the amount of time that elapses before the screen saver starts. See Themes on page 79 and Standby mode on page 67.
ICONS Several icons may be displayed while the phone is in the standby mode. The icons are related to activity, data connections, enhancements, or voice volume. Activity indicators One or more of the following icons may be shown when the phone is in the standby mode:
Indicates that you have received new messages to Inbox in Messaging. If the indicator is blinking, the phone memory is low, and you must delete some data. See "Memory low" on page 119. Indicates that you have received new e-mail. Indicates that you have received one or more voice messages. See "Call voice mail" on page 21. Indicates that there are messages waiting to be sent in Outbox. See
"Outbox" on page 59. Indicates that Ringing type has been set to Silent and Message alert tone to Off, and IM alert tone to Off in the currently active profile. See
"Profiles" on page 78. Indicates that the phone keypad is locked. To unlock, press the Left selection key and then the * key. Indicates that you have an active alarm. See "Clock" on page 88. See
"Calendar" on page 34. Indicates that a Bluetooth connection is active. Note that when data is transmitted using a Bluetooth connection, is shown. 14 Copyright 2004 Nokia Indicates that all calls to the phone are forwarded. Indicates that all calls to the phone are forwarded to voice mail. Getting started See "Call forwarding (network service)" on page 24. If you have two phone lines, the forward indicator for the first line is second line Indicates that you can make calls using phone line 2 only (network service). See "Line in use (network service)" on page 68. See Line in use (network service) on page 68. and for the Data connection indicators When an application is establishing a data connection, one of the indicators below blinks in the standby mode. When an indicator is shown continuously, the connection is active. when there is an active GPRS connection, Data call. High-speed data call. GPRS connection. The GPRS symbol is shown instead of the antenna symbol multiple GPRS connections, and put on hold during voice calls. Fax call. Bluetooth connection. Infrared connection. when there are for when the GPRS connection is Enhancement indicators A headset is connected. A loopset is connected. Voice volume indicators Earpiece mode. Loudspeaker mode. Nokia 6620 User Guide
Copyright 2004 Nokia
MENU Press the Menu key to display the main menu. In the menu, you can access all the applications in your phone. Menu options are Open, List view / Grid view, Delete, Move, Move to folder, New folder, Rename, Download Applications, Memory details, Help, and Exit. Move in the menu Move the joystick as follows to navigate the menu:
Scroll up by pressing the joystick up (1). Scroll down by pressing the joystick down (2). Scroll left by pressing the joystick left (3). Scroll right by pressing the joystick right (4). Press the center of the joystick to open a selected application or folder (5). 3 2 5 1 4 Close applications Backstep by pressing Back or Exit as many times as needed to return to the standby mode or select Options > Exit. If you press and hold the End key, the phone returns to the standby mode and the application is left open in the background. Note: Pressing the End key will always end a call, even if another application is active and displayed. When you switch the phone off correctly, using the Power key, the phone will attempt to save any unsaved data and close any applications that are still open. Hence the process may take a short time. Rearrange the menu You can rearrange the menu icons as required. You can place more rarely used applications in folders and move applications that you use more often from a folder to the main menu. You can also create new folders. 1 Scroll to the item you want to move and select Options > Move. A check mark is placed beside the application. 2 Move the selection where you want the application to be and select OK. To move an item to a folder:
1 Scroll to an item and select Options > Move to folder. A list of available folders is displayed. 16 Copyright 2004 Nokia
Getting started Scroll to the folder to which you want to move the application and select OK. 2 Switch between applications If you have several applications open and want to switch from one application to another, press and hold the Menu key. The application switching window opens showing a list of applications that are currently open. Scroll to an application and press the joystick to go to it. Note: If memory is getting low, the phone may close some applications. The phone saves any unsaved data before an application is closed.
OPTIONS LISTS Options lists tell you which commands are available in different views and situations. The available commands change depending on the view you are in. In some situations, when you press the joystick, a shorter options list appears listing the main commands available in the view.
HELP Your Nokia phone has a help function that you can access from any application that has the Options selection (displayed above the Left selection key). You can also access the help function from the main menu.
NAVIGATION BAR Navigation bar functions are as follows:
Small arrows or tabs that tell you if there are more views, folders, or files to which you can move. Scroll left and right to access these other views. Editing indicators. See "Write text" on page 50. Other information, for example, 2/14 means that the current picture is the second of 14 pictures in the folder. Scroll right to see the next picture. Nokia 6620 User Guide
Copyright 2004 Nokia
ACTIONS COMMON TO ALL APPLICATIONS Opening items for viewingWhen you are viewing a list of files or folders, to open an item, scroll to an item and press the joystick, or select Options >
Open. Editing itemsTo open an item for editing, you sometimes need to first open it for viewing and then select Options > Edit, if you want to change its contents. Use the joystick to scroll through all fields of the item. Renaming itemsTo give a new name to a file or folder, scroll to it and select Options > Rename. Removing, deleting itemsScroll to the item and select Options > Delete or press the Clear key. To delete many items at a time, you first need to mark them. See the next paragraph: Marking an item. Marking an itemThere are several ways to select items when you are in a list. To select one item at a time, scroll to it and select Options > Mark/
Unmark > Mark or press the Edit key and the joystick at the same time. A check mark is placed next to the item. To select all items in the list, select Options > Mark/Unmark > Mark all. Marking multiple itemsPress and hold the Edit key, then move the joystick down or up. As the selection moves, a check mark is placed next to the items. To end the selection, stop the scrolling with the joystick and then release the Edit key. After you have selected all the items you want, you can move or delete them by selecting Options > Move to folder or Delete. To unmark an item, scroll to it and select Options > Mark/Unmark > Unmark or press the Edit key and the joystick at the same time. Creating foldersTo create a new folder, select Options > New folder. You are asked to give a name to the folder (max. 35 letters). Moving items to a folderTo move items to a folder or between folders, select Options > Move to folder (not shown if there are no folders available). When you select Move to folder, a list of available folders opens and you can also see the root level of the application (for moving an item out of a folder). Select the location to which you want the item to be moved and select OK. Sending itemsTo send items to compatible devices, scroll to the item that you want to send and select Options > Send > Via multimedia, Via Bluetooth, Via infrared, or Via e-mail. If you select to send the item in an e-mail or a multimedia message, an editor opens. Press the joystick to select the recipient(s) from the Contacts directory or write the phone number or e-mail address of the 18 Copyright 2004 Nokia
Getting started recipient in the To: field. Add text or sound and select Options > Send. See "Write and send messages" on page 53. If you select Via infrared, see Send and receive data by infrared on page 114 If you select Via Bluetooth, see Send data by Bluetooth connection on page 111
SEARCH FOR ITEMS You can search for a name, file, folder, or shortcut by using the search field. In some situations the search field is not visible automatically, but you can activate it by selecting Options > Find or just by starting to key in letters. 1 To search for an item, start to key in text in the search field. The phone immediately starts to search for matches and moves the selection to the best match. To make the search more accurate, key in more letters and the selection moves to the item that best matches the letters. 2 3 When the correct item is found, press the joystick to open it.
VOLUME CONTROL When you have an active call or are listening to a sound, scroll right or left to increase or decrease the volume level, respectively. See also Voice volume indicators on page 15. The loudspeaker allows you to speak and listen to the phone from a short distance without having to hold the phone to your ear (for example, setting it on a table nearby). The loudspeaker can be used during a call, with sound and video applications, and when viewing multimedia messages. Sound and video applications use the loudspeaker by default. Using the loudspeaker makes it easier to use other applications while in a call. To activate the loudspeaker during an already active call, select Options > Activate loudsp.. A tone is played, is shown in the navigation bar, and the volume indicator changes. To turn off the loudspeaker during an active call, select Options > Activate handset. Nokia 6620 User Guide
Copyright 2004 Nokia
Note: The loudspeaker cannot be activated when you have a headset connected to the phone. Important: Do not hold the phone near to your ear when the loudspeaker is in use, because the volume may be extremely loud.
KEYGUARD appears on the display. Press the Left Use the keyguard (keypad lock) feature to help prevent accidental key presses. In the standby mode, press the Left selection key and then quickly press the * key. When the keys are locked, selection key and then quickly press the * key to unlock the keys. When keyguard is on, press the Send key to answer a call. During a call, the phone can be operated in the normal way. When the keyguard is on, calls still may be possible to the official emergency number programmed into your phone. Enter the emergency number and press the Send key. 20 Copyright 2004 Nokia 4 Your phone
MAKE A CALL Your phone 1 2 3 In the standby mode, key in the phone number, including the area code. Scroll right or left to move the cursor. Press the Clear key to remove a number. For international calls, press the * key twice for the international prefix (the + character replaces the international access code), and then key in the country code, the area code without 0, and the phone number. Note: Calls described here as international may in some cases be made between regions of the same nation. Press the Send key to call the number. Press the End key to end the call (or to cancel the call attempt). Note: Pressing the End key will always end a call, even if another application is active and displayed. You can make a call using your voice so that you do not need to look at the display to key in the number. See "Voice dialing" on page 29. Use Contacts to make a call 1 2 To open the Contacts directory, select Menu > Contacts. To find a contact, scroll to the desired name, or key in the first letters of the name. The Search field opens automatically and matching contacts are listed. Press the Send key to start the call. If the contact has more than one phone number, scroll to the number and press the Send key to start the call. 3 Call voice mail Voice mail (network service) is an answering service where callers who are unable to reach you can leave you voice messages. To call voice mail, press the 1 key and the Send key in the standby mode. Nokia 6620 User Guide
Copyright 2004 Nokia
If the phone asks for the voice mail number, key it in and press OK. You can obtain this number from your service provider. To forward calls to your voice mail, see Call forwarding (network service) on page 24. Each phone line may have its own voice mail number. See "Line in use (network service)" on page 68. CHANGING THE VOICE MAIL NUMBER To change the phone number of your voice mail, select Menu > Tools > Voice mail and select Options > Change number. Key in the number (obtained from your service provider) and press OK. 1-touch dialing To view the 1-touch dialing grid, select Menu > Tools > 1-touch. 1 Assign a phone number to one of the 1-touch dialing keys (29). See "Assign 1-touch dialing keys" on page 31. To call the number in the standby mode, press the corresponding 1-touch dialing key and the Send key. If the 1-touch dialing function is set to On, press and hold the corresponding 1-touch dialing key until the call is started. To turn the 1-touch dialing function on, select Menu > Tools > Settings >
Call > 1-touch dialing > On. 2 Make a conference call (network service) Conference calling is a network service that allows you to make a conference call with a maximum of six participants, including yourself. 1 Make a call to the first participant. 2 To make a call to a new participant, select Options > New call. Key in or search the memory for the phone number of the participant and press OK. The first call is automatically put on hold. 3 When the new call has been answered, select Options > Conference to join the first participant in the conference call. To add a new person to the call, repeat step 2. To have a private conversation with one of the participants: Select Options > Conference > Private. Scroll to the desired participant and press Private. The conference call is put on hold in your phone, and the other participants can still continue talking with each other while you 22 Copyright 2004 Nokia
Your phone have a private discussion with one participant only. Once you have finished the private conversation, press Options > Conference to return to the conference call. To drop one participant from the conference call, select Options >
Conference > Drop participant, then scroll to the participant and press Drop. 4 To end the active conference call, press the End key. Note: The quickest way to make a new call is to dial the number and press the Send key to start the call. The existing call is automatically put on hold.
ANSWER A CALL To answer an incoming call, press the Send key. To end the call, press the End key. If you do not want to answer a call, press the End key. The caller will either be forwarded to voice mail or will hear a line busy tone (depending on whether call forwarding is activated). When a call comes in, press Silence to quickly mute the ringing tone. Options during a call Note: You may not have all of these options. Contact your service provider for more details. Press Options during a call for some of the following options:
Activate handsfree or Deactivate handsfree, Hold or Unhold, Mute or Unmute, New call, End active call, End all calls, Conference, Private, Swap, Transfer, Drop participant, Send DTMF, Answer, and Reject. Loudspeaker and Handset may be displayed as options for the Right selection key and can be used as shortcuts for Activate handsfree and Deactivate handsfree, respectively. Swap is used to switch between the active call and the call on hold. Transfer is used to connect an incoming call or a call on hold with an active call and to disconnect yourself from both calls. Nokia 6620 User Guide
Copyright 2004 Nokia
Send DTMF is used to send DTMF tone sequences, for example, passwords or bank account numbers:
1 Key in the digits with the 09 keys. Each keystroke generates a DTMF tone, which is transmitted while the call is active. Press the * key repeatedly to produce: *, p (inserts a pause of approximately two seconds before, or between DTMF characters), and w (if you use this character, the remaining sequence is not sent until you press the Send key again during the call). Press the # key to produce #. To send the tone, press OK. 2 Call waiting (network service) If you have activated the call waiting service, the network will notify you of a new incoming call while you have a call in progress. 1 During a call, press the Send key to answer the waiting call. The first call is put on hold. To switch between the two calls, press Swap. To end the active call, press the End key. Or, to end both calls at the same time, select Options > End all calls. 2 3 Call forwarding (network service) When this network service is activated, you can direct your incoming calls to another number, for example, to your voice mail number. For details, contact your service provider. Select Menu > Tools > Settings > Call forwarding. Select one of the forwarding options, for example, select If busy to forward voice calls when your number is busy or when you reject incoming calls. Select Options > Activate to turn the forwarding setting on, Cancel to turn the forwarding setting off, or Check status to check whether the forwarding is activated or not. To cancel all active forwarding, select Options > Cancel all forwarding. See "Activity indicators" on page 14. Note: You cannot have call blocking and call forwarding active at the same time. See "File manager" on page 76.
CALL LOG Select Menu > Log. 24 Copyright 2004 Nokia
Your phone In the log you can monitor phone calls, text messages, packet data connections, and fax and data calls registered by the phone. You can filter the log to view just one type of event and create new contact cards based on the log information. Note: Connections to your remote mailbox, multimedia messaging center, or browser pages are shown as data calls or packet data connections in the general communications log. GPRS data counter Select Menu > Log > GPRS counter. The GPRS data counter allows you to check the amount of data sent and received during packet data (GPRS) connections. For example, you may be charged for your GPRS connections by the amount of data sent and received. Recent calls log Select Menu > Log > Recent calls. The phone registers the phone numbers of missed, received, and dialed calls, and the approximate duration of your calls. The phone registers missed and received calls only if the network supports these functions and if the phone is switched on and is within the network service area. Options in the Missed, Received, and Dialed views: Call, Create message, Use number, Delete, Clear list, Add to Contacts, Help, and Exit. MISSED CALLS AND RECEIVED CALLS To view a list of the last 20 phone numbers from which somebody has tried to call you without success (network service), select Log > Recent calls > Missed calls. When you see a note in the standby mode about missed calls, press Show to access the list of missed calls. To call back, scroll to the number or name you want and press the Send key. To view a list of the 20 numbers or names from which you have most recently accepted calls
(network service), select Log > Recent calls >
Received calls. DIALED NUMBERS To view the 20 phone numbers that you have most recently called or attempted to call, select Log >
Call register > Dialed numbers. ERASING RECENT CALL LISTS To clear all recent call lists, select Options >
Clear list in the Recent calls main view. Nokia 6620 User Guide
Copyright 2004 Nokia To clear one of the call registers, open the register you want to erase and select Options > Clear list. To clear an individual event, open a register, scroll to the event, and press the Clear key. Call timers Select Menu > Log > Call timers. Allows you to view the duration of your incoming and outgoing calls. Note: The actual time invoiced for calls by your service provider may vary, depending upon network features, rounding-off for billing, and so forth. Erasing call duration timersSelect Options > Clear timers. For this you need the lock code. See "Security" on page 73. View the general log Select Menu > Log and scroll right. In the general log, for each communication event, you can see the sender or recipient name, phone number, name of the service provider, or access point. Note: Sub-events, such as a text message sent in more than one part and packet data connections, are logged as one communication event. Select Options > Filter. A list of filters opens. Scroll to a filter and press Select. FILTERING THE GENERAL LOG 1 2 ERASING THE CONTENTS OF THE GENERAL LOG To erase all the log contents, Recent calls register, and Messaging delivery reports permanently, select Options > Clear log. Confirm by pressing Yes. PACKET DATA COUNTER AND CONNECTION TIMER To view how much data, measured in kilobytes, has been transferred and how long a certain GPRS connection has lasted, scroll to an Incoming or Outgoing event with the access point icon Log settings Select Menu > Log > Options > Settings. The list of settings opens. and select Options > View details. 26 Copyright 2004 Nokia Your phone Log durationThe log events remain in the phone memory for a set number of days after which they are automatically erased to free memory. Note: If you select No log, all the log contents, Recent calls register, and Messaging delivery reports are permanently deleted. Show call durationSet to On or Off. See "Call timers" on page 26. Nokia 6620 User Guide
Copyright 2004 Nokia
5 Personal information
CONTACTS To open Contacts, press the joystick in the standby mode or select Menu > Contacts. In Contacts, you can store and manage contact information, such as names, phone numbers, and addresses. You can also add a personal ringing tone, voice tag, or a thumbnail image to a contact card. You can create contact groups, which allow you to send text messages or e-mail to many recipients at the same time. Note: Contact information can only be sent to or received from compatible devices. 2 Options in the Contacts directory: Open, Call, Create message, New contact, Presence options, Open conversation, Edit, Delete, Duplicate, Add to group, Belongs to groups, Mark/Unmark, Copy to SIM direct., Go to URL address, Send, Contacts info, SIM directory, Service numbers, Settings, Help, and Exit. Create and edit contact cards 1 Open Contacts and select Options > Create New. An empty contact card opens. Fill in the fields you want and press Done. The contact card is saved in the phone memory and closed, after which you can see it in the Contacts directory. To edit contact cards, see Actions common to all applications on page 18. Options when editing a contact card: Add thumbnail / Remove thumbnail, Add detail, Delete detail, Edit label, Help, and Exit. To delete contact cards, in the Contacts directory, scroll to the contact card and select Options > Delete. To attach a small thumbnail image to a contact card, open a contact card, 28 Copyright 2004 Nokia
Personal information select Options > Edit and then select Options > Add thumbnail. The thumbnail image is also shown when the contact is calling you. After you attach a thumbnail image to a contact card, you can select Add thumbnail to replace the image with a different thumbnail or Remove thumbnail to remove the thumbnail from the contact card. To assign default numbers and addresses to a contact card, open an contact card and select Options > Defaults. A pop-up window opens, listing the different options. Copy between SIM card and phone memory To copy names and numbers from a SIM card to your phone, open Contacts, select Options > SIM directory, scroll to the name(s) you want to copy and select Options > Copy to Contacts. G56 If you want to copy a phone, fax, or pager number from Contacts to your SIM card, select Contacts, open a contact card, scroll to the number, and select Options >
Copy to SIM direct.. Add a ringing tone for a contact card or group You can set a ringing tone for each contact card and group. When that contact or group member calls you, the phone plays the chosen ringing tone (if the callers telephone number is sent with the call and your phone recognizes it). 1 Press the joystick to open a contact card or go to the Groups list and select a contact group. Select Options > Ringing tone. A list of ringing tones opens. Use the joystick to select the ringing tone you wish to use for the contact or group, and press Select. To remove the ringing tone, select Default tone from the list of ringing tones. Note: For an individual contact, the phone will always use the ringing tone that was assigned last. So, if you first change a group ringing tone and then the ringing tone of a single contact that belongs to that group, the ringing tone of the single contact is used. 2 3 4 Voice dialing You can make a phone call by saying a voice tag that has been added to a contact card. Any spoken word(s) can be a voice tag. When recording, hold the phone at a short distance away from your mouth. After the starting tone, say clearly the word, or words, you want to record as a voice tag. Nokia 6620 User Guide
Copyright 2004 Nokia
Before using voice dialing, note that:
Voice tags are not language-dependent. They are dependent on the speakers voice. Voice tags are sensitive to background noise. Record voice tags and use them in a quiet environment. Very short names are not accepted. Use long names and avoid similar names for different numbers. Note: You must say the name exactly as you said it when you recorded it. This may be difficult in a noisy environment or during an emergency, so you should not rely solely upon voice dialing in all circumstances. ADD A VOICE TAG TO A PHONE NUMBER Note: Voice tags can only be added to phone numbers stored in phone memory. See "Copy between SIM card and phone memory" on page 29. 1 2 3 4 In the Contacts main view, scroll to the contact to which you want to add a voice tag, and press the joystick to open the contact card. Scroll to the number to which you want to add the voice tag, and select Options > Add voice tag. Press Start to record a voice tag. After the starting tone, clearly say the word(s) you want to use as a voice tag. After recording, the phone plays the recorded tag and the note Playing voice tag is displayed. When the voice tag has been successfully saved, the note Voice tag saved is displayed and a beep sounds. A symbol can be seen next to the number in the contact card. To replay, erase, or change a voice tag, scroll to the item that has a voice tag
(indicated by MAKE A CALL USING A VOICE TAG 1
), and select Options > Voice tag. > Playback, Delete, or Change. In the standby mode, press and hold the Left selection key. A short tone is played and the note Speak now is displayed. 2 When you make a call by saying a voice tag, hold the phone at a short distance away from your mouth and face and say the voice tag clearly. The phone plays the original voice tag, displays the name and number, and after a few seconds dials the number of the recognized voice tag. If the phone plays the wrong voice tag or if you want to retry voice dialing, press Retry. 30 Copyright 2004 Nokia
Personal information Note: Voice dialing cannot be used when a data call or a GPRS connection is active. Assign 1-touch dialing keys 1-touch dialing is a quick way to call frequently used numbers. You can assign 1-touch dialing keys to eight phone numbers. Number 1 is reserved for voice mail. 1 Open the contact card for which you want a 1-touch dialing key and select Options >
Assign 1-touch no.. The 1-touch dialing grid opens, showing you the numbers from 1-9. Scroll to a number and press Assign. When you return to the contact information view, you can see the 1-touch dialing icon next to the number. To call the contact by 1-touch dialing, go to the standby mode and press the 1-touch dialing key and the Send key. 2 3 View subscribed contacts In the Contacts directory, scroll right to the second tab to open the subscribed contacts list. This list allows you to view presence data, including availability and IM status, for all subscribed contacts. See also Presence (network service) on page 32 and Instant messaging (IM) (network service) on page 91. Options in the subscribed contacts view: Presence details, Call, Create message, Notify, Open conversation, Unsubscribe, Subscribe new, Mark / Unmark, My Presence, Settings, Help, and Exit. If you are offline, you will see only a few of these options. Manage contact groups You can create contact groups, which can, for example, be used as distribution lists for sending text messages and e-mail. A ringing tone may be added to a group. See
"Manage contact groups" on page 31. Options in the Groups list view: Open, New group, Delete, Rename, Ringing tone, Contacts info, Settings, Help, and Exit. Nokia 6620 User Guide
Copyright 2004 Nokia CREATING CONTACT GROUPS 1 In the Contacts directory, scroll right to open the groups list. Select Options > New group. 2 3 Write a name for the group or use the default name Group 1 and press OK. ADDING MEMBERS TO A GROUP 1 In the Contacts directory, scroll to the contact you want to add to a group and select Options > Add to group. A list of available groups opens. Scroll to the group to which you want to add the contact and press the joystick. 2
PRESENCE (NETWORK SERVICE) Select Menu > Presence. Options in the Presence view: Open, Current Availability, Viewers, Update presence, Login / Logout, Settings, Help, and Exit. Use the Presence application to inform others when, where, and how you want to be contacted. Presence allows you to view and create a dynamic profile and share information or control services. Presence information is visible to others and can include your availability if you prefer for people to call or send messages depending on where you are and what you are doing. Before you can use Presence, you need to choose a service provider and then save the settings of that service. You may receive the settings in a special text message, called a smart message, from the service provider that offers the Presence service. See "Smart messages" on page 56. For more information, contact your service provider. The Presence application allows you to change your own published information and manage who is authorized to see your presence. To view the presence information of others, you must use the Contacts application. See "View subscribed contacts"
on page 31. 32 Copyright 2004 Nokia Personal information Change your availability information Select Options > Current Availability and select:
AvailableYou are available for people to call or send you messages; for example, your phone is in general profile. See "Profiles" on page 78. DiscreetYou may be available for people to call or send you messages; for example, your phone is in meeting profile. Not availableYou are not available for people to call or send you messages; for example, your phone is in silent profile. Change who can view your information Select Options > Viewers and select:
Public PresenceDisplays limited information, for managing ways for people to contact you. This is available to anyone you have not blocked. AvailabilitySelect Available, Discreet, or Not available. ViewersOpens the Public Viewers view of your Public Presence. Private PresenceDisplays private information so that you can share more personal information. This is only available to those that you have authorized to view your private information. You can select the following options:
AvailabilitySelect Available, Discreet, or Not available. Private messageYou can write a text message of up to 40 characters to describe your current availability. The last used text is shown in the status message field. Private LogoYou can add a logo to your availability information. Logo files are stored in the Gallery. See "Gallery" on page 45. ViewersOpens the Private Viewers view of your Private Presence. Blocked PresenceDisplays a screen containing no personal details. You may select Options > Viewers to define Update your information Select Menu > Presence and select Options > Log in to connect to the server. Once the connection has been established:
1 Key in your user ID and password and press the joystick to log in. Note: You obtain the user ID and password from your service provider. Nokia 6620 User Guide
Copyright 2004 Nokia
2 Select Options > Update presence. The option is only available when you are logged in to the server and have changed your presence information in Private Presence or Public Presence view and have not updated it yet. To log out, select Options > Log out. 3 Presence settings Select Options > Settings from the Presence main menu:
PublishingSelect:
Private and PublicBoth public and private presence is published. Only privateOnly private viewers can see your presence information. Only publicBoth public and private viewers see your public presence information. OffYour presence information is not published. Presence for new viewersSpecifies what level of presence new viewers are allowed to see. Select Public or Private. Depends on profilesSelect:
OffThe presence attributes are not changed, even if you change your presence profile. Availability and Private messageBoth Availability and Private message are shown for each presence profile. Only AvailabilityPrivate message is not shown. Only Private MessageAvailability is not shown. Log inSelect Automatic in home network, Always automatic, or Manual. Configure settingsAllows you to manually configure the Presence service settings.
CALENDAR In Calendar, you can keep track of your appointments, meetings, birthdays, anniversaries, and other events. You can also set a calendar alarm to remind you of upcoming events. Calendar uses shared memory. See "Shared memory" on page 3. Create entries 1 2 Select Menu > Calendar. Select Options > New entry and select:
Meeting to create an appointment that has a specific date and time. Memo to write a general entry for a day. Anniversary to remind you of birthdays or special dates. Anniversary 34 Copyright 2004 Nokia
Personal information 3 4 entries are repeated every year. in the Day view. Fill in the fields. Use the joystick to move between fields. Subject / OccasionWrite a description of the event. Locationthe place of a meeting, optional. Start time, End time, Start date, and End date. AlarmSelect Active to display the Alarm time and Alarm date fields. RepeatPress the joystick to change the entry to be repeating. Shown with Repeat untilYou can set an ending date for the repeated entry, for example, the ending date of a weekly course you are taking. This option is shown only if you have selected to repeat the event. SynchronizationPrivateafter synchronization the calendar entry can be seen only by you and it will not be shown to others with online access to view the calendar. Publicthe calendar entry is shown to others who have access to view your calendar online. Nonethe calendar entry will not be copied when you synchronize your calendar. To save the entry, press Done. Note: When editing or deleting a repeated entry, choose how you want the changes to take effect: All occurrencesall repeated entries are changed, or This entry onlyonly the current entry will be changed. Views Press the # key in the Month, Week, or Day views to automatically highlight todays date. To write a calendar entry, press any number key (10) in any calendar view. A Meeting entry is opened and the characters you keyed in are added to the Subject field. To go to a certain date, select Options > Go to date. Write the date and press OK. Nokia 6620 User Guide
Copyright 2004 Nokia
Icons in Day and Week view:
Synchronization icons in Month view:
None, Private, Public, Memo, and Anniversary. the day has more than one entry 36 Copyright 2004 Nokia
Personal information Settings Select Options > Settings and select:
Calendar alarm toneTo select a personalized alarm tone, or no tone at all. Default viewTo select the view that is shown first when you open Calendar. Week starts onTo change the starting day of the week. Week view titleTo change the title of the Week view to be the week number or the week dates.
TO-DO In To-do you can keep a list of tasks that you need to do. The To-do list uses shared memory. See "Shared memory" on page 3. 1 2 Select Menu > To-do. To start to write a to-do note, press any number key (10). The editor opens and the cursor blinks after the letters you have keyed in. 3 Write the task in the Subject field. Press the
* key to add special characters. 4 To set a due date for the task, scroll to the Due date filed and key in a date. To set a priority for the task, scroll to the Priority field and press the joystick. To save the to-do note, press Done. If you remove all characters and press Done, the note will be deleted, even if you edit a previously saved note. To open a to-do note, scroll to it and press the joystick. To delete a to-do note, scroll to it and select Options > Delete or press the Clear key. To mark a to-do note as completed, scroll to it and select Options > Mark as done. To restore a to-do note, select Options > Mark as not done. Nokia 6620 User Guide
Copyright 2004 Nokia
IMPORT DATA FROM COMPATIBLE NOKIA PHONES You can move calendar, contacts, and to-do data from compatible Nokia phones to your phone using the PC Suite Data Import application. Instructions for using the application can be found in the help function of PC Suite on the CD-ROM. 38 Copyright 2004 Nokia 6 Multimedia
CAMERAS Multimedia With the Cameras application you can take pictures and record videos while on the move. The images are automatically saved in the Gallery application, where you can rename them and organize them in folders. You can also send images and video recordings in a multimedia message, as an e-mail attachment, or by infrared or a Bluetooth connection. The camera produces JPEG images, and video clips are recorded in the 3GPP file format with the .3gp file extension. Video recorder uses shared memory. See "Shared memory" on page 3. Take pictures Note: Obey all local laws governing the taking of pictures. Do not use this feature illegally. 1 2 3 Press Camera in the standby mode or select Menu > Cameras, and scroll right or left to move to the Still image tab. The Camera application opens and you can see the view to be captured. You can see the viewfinder and the cropping lines, which show you the image area to be captured. You can also see the image counter, which shows you how many images, depending on the selected picture quality, fit in the memory of your phone or memory card, if you use one. Options before taking a picture: Capture, New, Activate Night mode, Self-timer, Go to Gallery, Settings, Help, and Exit. Scroll up to zoom in on your subject before taking the picture. Scroll down to zoom out again. The zoom indicator to the right of the display shows the zoom level. To take a picture, press the joystick. Do not move the phone before the Camera application starts to save the image. The image is saved automatically in the Gallery. See "Gallery" on page 45. Nokia 6620 User Guide
Copyright 2004 Nokia Note: The resolution of a zoomed picture is lower than that of a non-
zoomed picture, but the image remains the same size. You may notice the difference in image quality if viewed on a PC, for example. Note: The camera goes into battery saving mode if there have been no key presses within a minute. To continue taking pictures, press the joystick. OPTIONS AFTER CAPTURING AN IMAGE Options after a picture has been taken: New, Delete, Send, Set as background image, Rename image, Go to Gallery, Settings, Help, and Exit. If you do not want to save the image, select Options > Delete. To return to the viewfinder to take a new picture, press the joystick. You can insert an image into a contact card. See "Create and edit contact cards"
on page 28. SELF-TIMER Use the self-timer to delay the taking of a picture, so that you can include yourself in the picture. 1 2 3 Select Options > Self-timer. Select the delay 10 seconds, 20 seconds, or 30 seconds. Press Activate. The camera will take the picture after the selected delay has elapsed. SETTINGS In the Camera application settings, you can adjust the image quality setting, change the default image name, and change the memory location of saved images. 1 2 Select Options > Settings > Image. Scroll to the setting you want to change:
Image qualityHigh, Normal, and Basic. The better the image quality, the more memory the image consumes. See "Images and memory consumption" on page 41. Default image nameBy default, Camera names images in the format Image.jpg. Default image name allows you to set a name for the images stored. Memory in useSelect whether you want to store your images in the phone memory or on the memory card, if you use one. 40 Copyright 2004 Nokia
Multimedia IMAGES AND MEMORY CONSUMPTION Your phone has approximately 6 MB (megabytes) of free memory for images, contact information, calendar, messages, and so on. See "Shared memory" on page 3. Portrait images (always taken in High quality) are so small that they take up very little memory. Images taken using the High quality setting and those taken in Night mode take up the most memory. By using a memory card with your phone you can increase the number of images you can store. To see how much memory is available on your phone and memory card, see View memory consumption on page 77. If 1 MB of memory is used for images only, it would fit approximately 22 Normal quality pictures taken in Standard mode. In the table below, you can see approximately how many images would fit in 1 MB of memory. Image quality Image type Basic Normal High Standard Night 55 50 22 25 15 18 Record videos Note: Obey all local laws governing the taking of videos. Do not use this feature illegally. 1 2 3 Press Camera in the standby mode or select Menu > Cameras, and scroll right or left to move to the Video tab. Options before starting the video recorder:
Record, New, Activate night mode, Mute microphone, Go to Gallery, Settings, Help, and Exit. Press the joystick to start recording. To pause recording at any time, press the Left selection key. Press the Left selection key again, to resume recording. Scroll up to zoom in on your subject before, or during, recording. Scroll down to zoom out again. Press the Right selection key to stop the video recording. Nokia 6620 User Guide
Copyright 2004 Nokia
The video clip is saved to either phone memory or the memory card, depending on the setting of your Memory in use. See "Setting up the Video recorder" on page 42. To immediately play the video clip you just recorded, select Options > Play. To play previously saved video clips, go to the Gallery. See "Gallery" on page 45. Options after you have recorded a clip: New, Play, Delete, Send, Rename video, Go to Gallery, Settings, Help, and Exit. SETTING UP THE VIDEO RECORDER To define how videos are recorded, select Options > Settings and choose:
Video clip length:
MaximumRecorded video length is restricted by available memory only. ShortRecorded video size is restricted to approximately 95kB, which optimizes it for MMS sending. Video length on this setting varies from 5 to 20 seconds, depending on the movement, resolution, and audio. Video resolutionSelect 128x96 or 176x144. Default video nameDefine a default name. Example: If you set Holiday as the default video clip name, the video recorder will name all the video clips you take Holiday, Holiday(001), Holiday(002), and so on, until you change the setting again. Memory in useSelect Phone memory or Memory card. If you have given your memory card a name, the name of the card will appear instead of Memory card.
VIEW IMAGES Pictures taken with the Camera are stored as images in the Gallery. See "Gallery"
on page 45. Select an image from the list of images in the Images folder in the Gallery to start the image viewer and display the image. When viewing an image, scroll right or left to go to the next or previous image in the current folder. Options when viewing an image: Send, Set as wallpaper, Rotate, Zoom in, Zoom out, Full screen, Delete, Rename, View details, Add to Go to, Help, and Exit. In the images thumbnail view:
1 2 3 Scroll right or left to move between the phone and memory card. To browse the list of images, scroll up and down. Press the joystick to open an image. When the image is open, you can see the name of the image. 42 Copyright 2004 Nokia
Multimedia You can view animated GIF files in the same way as other images. Zoom on a saved image 1 Select Options > Zoom in or Zoom out. You can see the zooming ratio at the top of the display. See "Keyboard shortcuts" on page 43. Press the Left selection key to return to the initial view. The zooming ratio is not stored permanently. 2 If you zoom in on GIF animations while they are playing, the animation will freeze until normal zoom is resumed, when play will continue. FULL SCREEN When you select Options > Full screen, the panes around the image are removed so that you can see more of the image. Press the Left selection key to return to the initial view. MOVING THE FOCUS When you are zooming an image, or viewing an image in full screen mode, use the joystick to move the focus to the left, right, up, or down, so that you can take a closer look at one part of the image, for example, its upper right corner. Keyboard shortcuts 1 keyRotate image 90 degrees counterclockwise 3 keyRotate image 90 degrees clockwise 5 keyZoom in (press and hold to return to the normal view) 0 keyZoom out (press and hold to return to the normal view)
* keyChange between full screen and normal view JoystickScroll up, down, left, right Note: When you rotate an image, the rotation status is not stored permanently.
REALONE PLAYER Select Menu > RealOne. Note: Obey all local laws regarding video playback. Do not use this feature illegally. Nokia 6620 User Guide
Copyright 2004 Nokia
With RealOne Player, you can play local media files stored in the phone memory, or memory card, or stream media files over the air from a streaming link. The streaming link can be activated during a browsing session or stored in the phone memory, or memory card. Media files are video, music, or audio clips. Files with extensions such as .mp3, .3gp,
.mp4, .rm, .ram, .ra, and .rv. are supported by RealOne Player. RealOne Player does not necessarily support all file formats or all the variations of a file format. For example, RealOne Player will attempt to open all .mp4 files. However, some .mp4 files may include content that is not compliant with 3GPP standards and, therefore, is not supported by this phone. In this case, the operation might fail and result in partial playback or in an error message. RealOne Player uses shared memory. See "Shared memory" on page 3. Play media files Options in RealOne Player when a clip is selected: Play, Continue, Stop, Mute, Unmute, Clip details, Send, Settings, Help, and Exit. To play a media file stored in phone memory or memory card, select Menu > RealOne > Options >
Open and one of the following:
Most recent clipsto play one of the last 6 files played in RealOne Player. Saved clipto play a file saved in the Gallery. See "Gallery" on page 45. Scroll to a file and press the joystick to play the file. To stream content over the air:
Select a streaming link saved in the Gallery. Before your live content begins streaming, your phone will connect to the site and load the file. Open the link to a file in the browser. To stream live content, you must first configure your default access point. See
"Access points" on page 68. Note: Many service providers will require you to use an Internet access point (IAP) for your default access point. Other service providers allow you to use a WAP access point. Contact your service provider for more information. 44 Copyright 2004 Nokia
Multimedia Note: In RealOne Player, you can only open an rtsp:// URL address. You cannot open an http:// URL address; however, RealOne Player will recognize an http link to a .ram file since a .ram file is a text file containing an rtsp link. SHORTCUTS DURING PLAY When a media file is playing, use the joystick to seek (move quickly through the media file), and to mute the sound, as follows:
Scroll up and hold to seek forward, or scroll down and hold to seek backward through the media file. Scroll left and hold until the Scroll right and hold until you see the Change settings Select Options > Settings > Video or Connection. Scroll right or left to move between the different setting tabs for Video and Connection. Select Video to change the following list of settings:
indicator is displayed to mute the sound. indicator to turn on the sound. ContrastOpen the slider view to change the contrast. RepeatChoose On to have the playing video or audio file restart automatically once it has finished. Select Connection to change the connection settings.
GALLERY Select Menu > Gallery. Options: Open (folder or item), Send, Delete, Create new, Move to folder, Copy to, New folder, Mark/
Unmark, Edit, Rename, Gallery downloads, Image uploader, Receive via infrared, View details, Add to Go to, Settings, Help, and Exit. Use the Gallery to store and organize your images, sound clips, video clips, streaming links, and RAM files. Gallery uses shared memory. See "Shared memory"
on page 3. Nokia 6620 User Guide
Copyright 2004 Nokia
Open the Gallery to see a list of the folders in the phone memory. Scroll right to see the folders on the memory card, if you use one. Select a folder Images, Sound clips, or Video clips (or other folder that you have created) and press the joystick to open it. In the open folder you can see:
An icon depicting the type of each file in the folder, or in the case of an image, a small thumbnail picture; a preview of the image. The name of the file. The date and time a file was saved, or the size of the file. Subfolders, if present. You can browse, open, and create folders, mark, copy and move items to folders. See "Actions common to all applications" on page 18. Open files Select any file and press the joystick to open it. Each file will open in its corresponding application as follows:
ImagesOpen in the Image viewer. See "View images" on page 42. Sound clipsOpen and play in the music player. Video clips, RAM files, and streaming linksOpen and play in the RealOne Player application. See "RealOne Player" on page 43. SubfoldersOpen to display contents. Default Images folders PICTURE MESSAGES FOLDER Select the folder Images > Picture msgs.. Use this folder to store pictures sent to you in picture messages. To save a picture that you have received in a picture message, select Messaging > Inbox, open the message, and select Options > Save picture. Options in the Picture messages folder: Open, Send, Delete, Mark/Unmark, Rename, View details, Help, and Exit. WALLPAPERS FOLDER Select the folder Images > Wallpapers. Use this folder to store pictures that you want to use as background images. PRESENCE LOGOS FOLDER Select the folder Images > Presence logos. 46 Copyright 2004 Nokia
Multimedia Use this folder to store logos for Presence. See "Presence (network service)" on page 32. Download files To download files into the Gallery using the browser, select Options > Gallery downloads and choose from Graphic downloads, Video downloads, or Tone downloads. The browser opens and you can choose a bookmark for the site to download from. See "View bookmarks" on page 100. To download files, you must first configure your default access point. See "Access points" on page 68. Once items have been downloaded, the browser closes and the phone returns to the Gallery view. Upload images to an image server (network service) You can send your pictures to an image server to allow others to share your pictures online. Note: You can only upload .JPG files to an image server. 3 Before you can upload images, you must enter the settings for the image server. See "Setting up the image server" on page 47. You can get these settings from your service provider. 1 2 Select Options > Image uploader. To begin an upload, mark the images, or the entire folder that you want to upload, and select Upload. Enter a name for the folder on the image server that the images will be stored in and press the Left selection key. SETTING UP THE IMAGE SERVER 1 Select Settings > Image servers and press the Left selection key. Fill in the details for each field. See "Access points" on page 68. Press the Right selection key. 2 Create a track list for audio files You can create a track list to play audio files on your Nokia 6620 phone. See RealOne Player on page 43 for a list of supported audio file formats. 1 2 Select Menu > Gallery > Create new > Track list. In the Select memory window, select either Phone memory or Memory card. This selection specifies where to locate the first sound clip. Nokia 6620 User Guide
Copyright 2004 Nokia 3 In the Select sound clip window, scroll to the first sound clip you want to add, and press the joystick to select it. The media player opens, and the first sound clip begins playing. You can pause or stop the clip if you do not want it to play while you are building the rest of your track list. To add multiple tracks at one time, press the Edit key and the joystick simultaneously to place a checkmark beside each track that you want to add. If you choose to add one track at a time, select Options > Edit track list and then Options > Add sound clip to add other songs to the track list. 4 When you are done building the track list, press Back and Yes to save changes. The track list is given a default name and is automatically saved to phone memory. You can scroll to the track list in Gallery and select Options >
Rename to give it a different name or Options > Move to folder to move it to another location in phone memory or on your memory card. PLAY A TRACK LIST Select Menu > Gallery and locate the track list. Scroll to the track list (in phone memory or on your memory card) and press the joystick to begin playing it. Options in track list: Pause, Edit track list, Clip details, Settings, Help, and Exit. MODIFY A TRACK LIST Open the track list, and select Options > Edit track list and then Options > Add sound clip to add clips to the track list. To delete clips from the track list, scroll to a clip, and select Options > Delete. 48 Copyright 2004 Nokia
Messaging 7 Messaging Select Menu > Messaging. In Messaging you can create, send, receive, view, edit, and organize:
text messages multimedia messages e-mail messages smart messages (special text messages containing data) Options in the Messaging main view: Create message, Connect (shown if you have defined settings for the mailbox) or Disconnect (shown if there is an active connection to the mailbox), SIM messages, Cell broadcast, Service commands, Settings, Help, and Exit. Text messages and multimedia messages use shared memory. See "Shared memory"
on page 3. When you open Messaging, you can see the New message function and a list of default folders:
InboxContains received messages except e-mail and cell broadcast messages. E-mail messages are stored in the Mailbox. You can read cell broadcast messages by selecting Options > Cell broadcast. My foldersFor organizing your messages into folders. MailboxWhen you open this folder, you can either connect to your remote mailbox to retrieve your new e-mail messages or view your previously retrieved e-mail messages offline. After you have defined settings for a new mailbox, the name given to that mailbox will replace Mailbox in the main view. See "E-mail" on page 63. DraftsStores drafts of messages that have not been sent. SentStores the last 15 messages that have been sent. To change the number of messages to be saved, see Sent messages on page 65. Note: Messages or data that have been sent by an infrared or Bluetooth connection are not saved in the Draft or Sent folders. Nokia 6620 User Guide
Copyright 2004 Nokia
OutboxTemporary storage place for messages waiting to be sent. ReportsYou can request the network to send you a delivery report of the text messages, smart messages, and multimedia messages you have sent. To turn on delivery report reception, select Options > Settings >
Text message or Multimedia message, scroll to Receive report, and select Yes. Note: Receiving a delivery report of a multimedia message that has been sent to an e-mail address might not be possible. Note: Before you create a multimedia message, write an e-mail, or connect to your remote mailbox, you must have the correct connection settings in place. See "Write and send messages" on page 53. See "Settings needed for multimedia messaging" on page 54.
WRITE TEXT You can key in text in two different ways, using the method traditionally used in mobile phones or another method called predictive text input. Traditional text input The indicator text using traditional text input. is shown on the top right of the display when you are writing and indicate the selected case. Press a number key (19), repeatedly until the desired character appears. Note that there are more characters available for a number key than are printed on the key. Icons:
means that the first letter of the next word is written in upper case, and all other letters will automatically be written in lower case. To insert a number, press and hold the corresponding number key. To switch between letter and number mode, press and hold the # key. If the next letter is located on the same key as the present one, wait until the cursor appears (or scroll right to end the time-out period), and then key in the letter. If you make a mistake, press the Clear key to remove a character. Press and hold the Clear key to clear more than one character. The most common punctuation marks are available under the 1 key. Press the indicates number mode. 50 Copyright 2004 Nokia
Messaging 1 key repeatedly to reach the desired punctuation mark. You can also press the
* key to open a list of special characters. Use the joystick to move through the list and press Select to select a character. To insert a space, press the 0 key. To move the cursor to the next line, press the 0 key three times. To switch between upper and lower case, press the # key. Predictive text input To activate predictive text input, press the Edit key and select Dictionary on, or press the # key twice quickly when writing text. This will activate predictive text input for all editors in the phone. The indicator is shown at the top of the display. 1 Write the desired word by pressing the keys 29. Press each key only once for one letter. The word changes after every key press. For example, to write Nokia when English dictionary is selected, press:
the 6 key for N the 6 key for o the 5 key for k the 4 key for i the 2 key for a The word suggestion changes after each key press. 2 When you have finished the word, check that it is correct. If the word is correct, you can confirm it by scrolling right or by pressing the 0 key to insert a space. The underlining disappears and you can begin to write a new word. If the word is not correct, you have the following options:
Press the * key repeatedly to view the matching words the dictionary has found one by one. Press the Edit key and select Dictionary > Matches to view a list of matching words. Scroll to the word you want to use and press the joystick to select it. If the ? character is shown after the word, the word you intended to write is not in the dictionary. To add a word to the dictionary, press Spell, key in the word (max. 32 letters) using traditional text input, and press OK. The word is added to the dictionary. When the dictionary becomes full, a new word replaces the oldest added word. Nokia 6620 User Guide
Copyright 2004 Nokia
To remove the ? and clear characters one by one from the word, press the Clear key. TIPS ON PREDICTIVE TEXT INPUT To erase a character, press the Clear key. Press and hold the Clear key to clear more than one character. To change between the different character cases Abc, abc, and ABC, press the
# key. Note that if you press the # key twice quickly the predictive text input is turned off. To insert a number in letter mode, press and hold the desired number key, or press the Edit key and select number mode, key in the numbers you want, and press OK. The most common punctuation marks are available under the 1 key. Press the 1 key repeatedly to reach the desired punctuation mark. Press and hold the * key to open a list of special characters. Use the joystick to scroll through the list and press Select to select a character. Or press the Edit key and select Insert symbol. Note: The predictive text input will try to guess which commonly used punctuation mark (.,?!) is needed. The order and availability of the punctuation marks depend on the language of the dictionary. Press the * key repeatedly to view the matching words the dictionary has found one by one. When a word has been entered with predictive text on, you can press the Edit key, select Dictionary, and select:
Matches to view a list of words that correspond to your key presses. Scroll to the desired word and press the joystick. Insert word to add a word (max. 32 letters) to the dictionary by using traditional text input. When the dictionary becomes full, a new word replaces the oldest added word. Edit word to open a view where you can edit the word, available only if the word is active (underlined). Off to turn off predictive text input for all editors in the phone. WRITING COMPOUND WORDS Write the first half of a compound word and confirm it by scrolling right. Write the last part of the compound word and complete the compound word by pressing the 0 key to add a space. 52 Copyright 2004 Nokia
Messaging Copy and paste text If you want to copy text to the clipboard, the following is the easiest method:
1 To select letters and words, press and hold the Edit key. At the same time, scroll right or left. As the selection moves, text is highlighted. To select lines of text, press and hold the Edit key. At the same time scroll down or up. To end the selection, release the joystick while still holding the Edit key. To copy the text to the clipboard, while still holding the Edit key, press Copy. Or, release the Edit key and then press it once to open a list of editing commands, for example, Copy or Cut. If you want to remove the selected text from the document, press the Clear key. To paste the text into a document, press and hold the Edit key and press Paste. Or, press the Edit key once and select Paste. 2 3 4
WRITE AND SEND MESSAGES Note: This function can only be used if it is supported by your network operator or service provider. Only devices that offer compatible, picture message, multimedia message, or e-mail features can receive and display these messages. Devices that do not have multimedia features may receive details of a link to a web page. Note: Before you can create a multimedia message, write an e-mail message, or connect to your remote mailbox, you must have the correct connection settings in place. See Write and send messages on page 53 and Settings needed for multimedia messaging on page 54. Options in the text message editor: Send, Add recipient, Insert, Delete, Check names, Message details, Sending options, Help, and Exit. 1 Select New message, and then select one of the following options:
Text message if you want to create a text message. To send a picture message, select Options > Insert > Picture. Note: Each picture message is made up of several text messages. Therefore, sending one picture message may cost more than sending one text message. Multimedia message if you want to send a multimedia message (MMS). Nokia 6620 User Guide
Copyright 2004 Nokia
Note: When you are sending a multimedia message to any phone other than Nokia 6620, it is recommended to use a smaller image size and a sound clip that is no longer than 15 seconds. The default setting is Image size: Small. When you are sending a multimedia message to an e-mail address or another Nokia 6620, if possible use the larger image size
(network dependent). To change the setting, select Messaging >
Options > Settings > Multimedia message > Image size > Large. Important:Copyright protections may prevent some images, ringtones, and other content from being copied, modified, transferred or forwarded.
E-mail if you want to send an e-mail. If you have not set up your e-mail account, you will be prompted to do so. 2 Press the joystick to select recipient(s) from the Contacts directory or write the phone number or e-mail address of the recipient in the To: field if you are sending an MMS or e-mail to the recipient. Press the # key to add a semicolon
(;) to separate each recipient. Scroll down to move to the message field. 3 4 Write the message. Note: Your phone supports the sending of multiple text messages at the same time; therefore, the normal 160 character limit for one text message can be exceeded. If your text exceeds 160 characters, it will be sent in two or more messages and message sending may cost you more. To add a media object to a multimedia message, select Options > Insert >
Image or New Image, Sound clip or New sound clip, Video clip, or New presentation. Select the item you want to add. When sound has been added, icon is shown in the navigation bar. If you select Insert > New sound the clip, Recorder opens and you can record a new sound. The sound is automatically saved and a copy is inserted in the message. To send the message, select Options > Send or press the Send key. 5 SETTINGS NEEDED FOR MULTIMEDIA MESSAGING You may receive the settings as a smart message from your network operator or service provider. See "Smart messages" on page 56. For availability of and subscription to data services, please contact your network operator or service provider. Select Messaging > Options > Settings > Multimedia message. Open Access point in use and select the access point you created. See "Multimedia messages"
on page 62. 54 Copyright 2004 Nokia Messaging SETTINGS NEEDED FOR E-MAIL Before you can send, receive, retrieve, reply to, and forward e-mail to a separate e-
mail account, you must:
Configure an Internet access point (IAP) correctly. See "Connection" on page 68. Define your e-mail settings correctly. See "E-mail" on page 63. Note: Follow the instructions given by your remote mailbox and Internet service provider.
VIEW A MULTIMEDIA PRESENTATION When you have received a multimedia message that includes a presentation, select Play presentation. The presentation will open and start. A multimedia message containing presentation content can still be viewed as a standard multimedia message. Objects within the presentation may not start automatically. If, for example, a video does not play when the presentation starts, move to the video clip object and press the joystick. All objects can be selected individually and opened.
INBOXRECEIVING MESSAGES Options in Inbox: Open, Create message, Delete, Message details, Move to folder, Mark/Unmark, Help, and Exit. When there are unread messages in Inbox, the icon changes to In Inbox, the message icons tell you what kind of a message it is. Here are some of the icons that you may see:
. for an unread text message for an unread smart message for an unread multimedia message for an unread service message for data received by infrared for data received by Bluetooth connection for an unknown message type Nokia 6620 User Guide
Copyright 2004 Nokia
View multimedia objects Options in the Objects view: Open, Save, Send, Call, and Exit. To see what kinds of media objects have been included in the multimedia message, open the message and select Options > Objects. In the Objects view you can view files that have been included in the multimedia message. You can choose to save the file in your phone or to send it, for example, by Bluetooth connection or infrared connection to another compatible device. Important: Multimedia message objects may contain viruses or otherwise be harmful to your phone or PC. Do not open any attachment if you are not sure of the trustworthiness of the sender. See "Certif. (certificate) management" on page 75. Smart messages Your phone can receive many kinds of smart messages, text messages that contain data (also called Over-The-Air (OTA) messages). To open a received smart message, open Inbox, scroll to the smart message (
), and press the joystick. Picture messageTo save the picture in the Picture messages folder in the Gallery for later use, select Options > Save picture. If you receive a vCard file that has a picture attached, the picture will be saved to Contacts as well. Business cardTo save the contact information, select Options > Save business card. Note: If certificates or sound files are attached to business cards, they will not be saved. Ringing toneTo save the ringing tone to the Gallery, select Options > Save. Operator logoTo save the logo, select Options > Save. The operator logo can now be seen in the standby mode instead of the network operators own identification. Calendar entryTo save the invitation to Calendar, select Options > Save to Calendar. Browser messageTo save the bookmark, select Options > Save to bookmarks. The bookmark is added to the Bookmarks list in browser services. If the message contains both browser access point settings and bookmarks, to save the data select Options > Save all. Or, select Options > View details to view the bookmark and access point information separately. If you do not want to save all data, select a setting or bookmark, open the details, and select Options > Save to Settings or Save to bookmarks depending on what you are viewing. 56 Copyright 2004 Nokia
Messaging E-mail notificationTells you how many new e-mails you have in your remote mailbox. An extended notification may list more detailed information such as subject, sender, attachments, and so on. In addition, you can receive a text message service number, voice mail number, profile settings for remote synchronization, access point settings for the browser, multimedia messaging or e-mail, access point login script settings, or e-mail settings. To save the settings, select Options > Save to SMS sett., Save to Voice mail, Save to Settings, or Save to e-mail sett.. Service messages (network service) Service messages can be, for example, notifications of news headlines, and they may contain a text message or address of a browser service. For availability and subscription, contact your service provider.
MY FOLDERS In My folders you can organize your messages into folders, create new folders, and rename and delete folders. Templates folder You can use the Templates folder to create text templates for messages that you send often. To create a new template, select Options > New template.
REMOTE MAILBOX (NETWORK SERVICE) When you open this folder, you can connect to your remote mailbox to:
Retrieve new e-mail headings or messages. View your previously retrieved e-mail headings or messages offline. If you select New message > Create > E-mail or Mailbox in the Messaging main view and you have not set up your e-mail account, you will be prompted to do so. See "Write and send messages" on page 53. When you create a new mailbox, the name you give to the mailbox automatically replaces Mailbox in the Messaging main view. You can have several mailboxes
(max. six). Nokia 6620 User Guide
Copyright 2004 Nokia
Open the mailbox When you open the mailbox, you can choose whether you want to view the previously retrieved e-mail messages and e-mail headings offline or connect to the e-mail server. When you scroll to your mailbox and press the joystick, the phone asks you if you want to Connect to mailbox? Select Yes to connect to your mailbox or No to view previously retrieved e-mail messages offline. Another way to start a connection is to select Options > Connect. Retrieve e-mail messages If you are offline, select Options > Connect to start a connection to a remote mailbox. 1 When you have an open connection to a remote mailbox, select Options > Retrieve e-mail, and select one of the following:
New to retrieve all new e-mail messages to your phone. Selected to retrieve only the e-mail messages that have been marked. Use the Mark/Unmark > Mark / Unmark commands to select messages one by one. See "Actions common to all applications"
on page 18. All to retrieve all messages from the mailbox. To cancel retrieving, press Cancel. After you have retrieved the e-mail messages, you can continue viewing them online. Select Options > Disconnect to close the connection and view the messages offline. To open an e-mail message, scroll to the e-mail you want to view and press the joystick. If the e-mail message has not been retrieved (arrow in the icon is pointing outwards) and you are offline and select Open, you will be asked if you want to retrieve this message from the mailbox. To view e- mail attachments, open a message that has the attachment indicator can retrieve, open, or save attachments, in supported formats. You can also send attachments by infrared or Bluetooth connection. and select Options > Attachments. In the Attachments view, you 2 3 58 Copyright 2004 Nokia
Messaging Important: E-mail attachments may contain viruses or otherwise be harmful to your phone or PC. Do not open any attachment if you are not sure of the trustworthiness of the sender. See "Certif. (certificate) management" on page 75. Note: If your mailbox uses the IMAP4 protocol, you can decide whether to retrieve e-mail headings only, messages only, or messages and attachments. With the POP3 protocol, the options are e-mail headings only or messages and attachments. See "E-mail" on page 63. Delete e-mail messages To delete an e-mail from the phone while still retaining it in the remote mailbox, select Options > Delete > Phone only. Note: The phone mirrors the e-mail headings in the remote mailbox. So, although you delete the message content, the e-mail heading stays in your phone. If you want to remove the heading as well, you have to first delete the e-mail message from your remote mailbox and then make a connection from your phone to the remote mailbox again to update the status. To delete an e-mail from both the phone and the remote mailbox, select Options >
Delete > Phone and server. Note: If you are offline, the e-mail will be deleted first from your phone. During the next connection to the remote mailbox, it will be automatically deleted from the remote mailbox. If you are using the POP3 protocol, messages marked to be deleted are removed only after you have closed the connection to the remote mailbox. UNDELETE E-MAIL MESSAGES WHEN OFFLINE To cancel deleting an e-mail from both the phone and server, scroll to an e-mail that has been marked to be deleted during the next connection (
), and select Options > Undelete. Disconnect When you are online, select Options > Disconnect to end the data call or GPRS connection to the remote mailbox.
OUTBOX Outbox is a temporary storage place for messages that are waiting to be sent. Status of the messages in Outbox:
Nokia 6620 User Guide
Copyright 2004 Nokia SendingA connection is being made and the message is being sent. Waiting / QueuedFor example, if there are two similar types of messages in Outbox, one of them is waiting until the first one is sent. Resend at (time)Sending has failed. The phone will try to send the message again after a time-out period. Press Send if you want to restart the sending immediately. DeferredYou can set documents to be on hold while they are in Outbox. Scroll to a message that is being sent and select Options > Defer sending. FailedThe maximum number of sending attempts has been reached. If you were trying to send a text message, open the message and check that the Sending settings are correct.
VIEW MESSAGES ON A SIM CARD Select Messaging > Options > SIM messages. Before you can view SIM messages, you need to copy them to a folder in your phone. See "Actions common to all applications" on page 18.
CELL BROADCAST (NETWORK SERVICE) Select Messaging > Options > Cell broadcast. You may be able to receive messages on various topics, such as weather or traffic conditions from your service provider. For available topics and relevant topic numbers, contact your service provider. In the main view you can see:
for new, subscribed messages and The status of the topic:
unsubscribed messages. The topic number, topic name, and whether it has been flagged (
follow-up. You will be notified when messages belonging to a flagged topic have arrived. for new,
) for Options in Cell broadcast: Open, Subscribe /Unsubscribe, Hotmark / Unhotmark, Topic, Settings, Help, and Exit. Note: A packet data (GPRS) connection may prevent cell broadcast reception. Contact your network operator for the correct GPRS settings. See "GPRS" on page 71. 60 Copyright 2004 Nokia
SERVICE COMMAND EDITOR Select Messaging > Options > Service commands. Key in and send service requests (also known as USSD commands) for network services to your service provider (for example, a request for activation commands). Messaging
SETTINGS The Messaging settings have been divided into groups according to the different message types. Scroll to the settings you want to edit and press the joystick. Text messages Select Messaging > Options > Settings > Text message to open the following list of settings:
Message centersLists all the message centers that have been defined. Msg. center in use (Message center in use)Defines which message center is used for delivering text messages and smart messages such as picture messages. Receive report (delivery report)When this network service is set to Yes, the status of the sent message (Pending, Failed, Delivered) is shown in the Reports. Note: Receiving a delivery report of a multimedia message that has been sent to an e-mail address might not be possible. Message validityIf the recipient of a message cannot be reached within the validity period, the message is removed from the message service center. Note that the network must support this feature. Maximum time is the maximum amount of time allowed by the network. Message sent asThe options are Text, Fax, Paging, and E-mail. For further information, contact your network operator. Note: Change this option only if you are sure that your message center is able to convert text messages into these other formats. Preferred connectionYou can send text messages over the normal GSM network or by GPRS, if supported by the network. Reply via same ctr. (network service)By setting this option to Yes, if the recipient replies to your message, the return message is sent using the same message service center number. Note that this may not work between all operators. Nokia 6620 User Guide
Copyright 2004 Nokia
Options when editing message center settings: New msg. center, Edit, Delete, Help, and Exit. Multimedia messages Select Messaging > Options > Settings > Multimedia message to open the following list of settings:
Access point in use (Must be defined)Select which access point is used as the preferred connection for the multimedia message center. See "Settings needed for multimedia messaging" on page 54. Note: If you receive multimedia message settings in a smart message and save them, the received settings are automatically used for the Access point. See "Smart messages" on page 56. Multimedia receptionSelect:
Only in home net. if you want to receive multimedia messages only when you are in your home network. When you are outside your home network, multimedia message reception is turned off. Always on if you always want to allow the reception of multimedia messages. Off if you do not want to receive multimedia messages or advertisements at all. Important: If the settings Only in home net. or Always on have been selected, your phone can make an active data call or GPRS connection without your knowledge. On receiving msg.Select:
Retr. immediately if you want the phone to try to retrieve multimedia messages instantly. If there are messages with Deferred status, they will be retrieved as well. Defer retrieval if you want the multimedia messaging center to save the message to be retrieved later. When you want to retrieve the message, set On receiving msg. to Retr. immediately. Reject message if you want to reject multimedia messages. The multimedia message center will delete the messages. Allow anon. messagesSelect No, if you want to reject messages coming from an anonymous sender. Receive advertsDefine whether you want to allow reception of multimedia message advertisements or not. Receive reportSet to Yes if you want the status of the sent message
(Pending, Failed, Delivered) to be shown in the Reports. 62 Copyright 2004 Nokia
Messaging Deny report sendingChoose Yes if you do not want your phone to send delivery reports of received multimedia messages. Message validity (network service)If the recipient of a message cannot be reached within the validity period, the message is removed from the multimedia message center. Maximum time is the maximum amount of time allowed by the network. Image sizeDefine the size of the image in a multimedia message. The options are Small (max. of 160x120 pixels) and Large (max. 640x480 pixels). Default speakerChoose Loudspeaker or Handset, depending on whether you want the sounds in a multimedia message to be played through the loudspeaker or the earpiece. E-mail Select Messaging > Options > Settings > E-mail. Open Mailbox in use to select which mailbox you want to use. SETTINGS FOR MAILBOXES Options when editing e-mail settings: Edit, New mailbox, Delete, Help, and Exit. Select Mailboxes to open a list of mailboxes that have been defined. If no mailboxes have been defined, you will be prompted to do so. The following list of settings is shown (this information is available from your e-mail service provider):
Mailbox nameWrite a descriptive name for the mailbox. Access point in use (Must be defined)The Internet access point (IAP) used for the mailbox. Choose an IAP from the list. See "Connection" on page 68. My e-mail address (Must be defined)Write the e-mail address given to you by your service provider. The address must contain the @ character. Replies to your messages are sent to this address. Outgoing mail server (Must be defined)Write the IP address or host name of the computer that sends your e-mail. Send message (network service)Define how e-mail is sent from your phone:
ImmediatelyA connection to the mailbox is started immediately after you have selected Send. During next conn.E-mail is sent when you connect to your remote mailbox the next time. Send copy to selfSelect Yes to save a copy of the e-mail to your remote mailbox and to the address defined in My e-mail address. Include signatureSelect Yes if you want to attach a signature to your e-mail messages and to start to write or edit a signature text. Nokia 6620 User Guide
Copyright 2004 Nokia
User nameWrite your user name, given to you by your service provider. PasswordWrite your password. If you leave this field blank, you will be prompted for the password when you try to connect to your remote mailbox. Incoming mail server (Must be defined)The IP address or host name of the computer that receives your e-mail. Mailbox typeDefines the e-mail protocol your remote mailbox service provider recommends. The options are POP3 and IMAP4. Note: This setting can be selected only once and cannot be changed if you have saved or exited from the mailbox settings. SecurityUsed with the POP3, IMAP4, and SMTP protocols to secure the connection to the remote mailbox. APOP secure loginUsed with the POP3 protocol to encrypt the sending of passwords to the remote e-mail server. Not shown if IMAP4 is selected for Mailbox type. Retrieve attachment (not shown if the e-mail protocol is set to POP3)To retrieve e-mail with or without attachments. Retrieve headersTo limit the number of e-mail headers you want to retrieve to your phone. The options are All and User defined. Used with the IMAP4 protocol only. Service messages When you select Messaging > Options > Settings > Service message, the following list of settings opens:
Service messagesChoose whether or not you want to allow reception of service messages. Authentic. neededChoose if you want to receive service messages only from authorized sources. Cell broadcast (network service) Check with your service provider about whether Cell broadcast is available and what the available topics and related topic numbers are. Select Messaging >
Options > Settings > Cell broadcast to change the settings:
ReceptionOn or Off. LanguageAll allows you to receive cell broadcast messages in every possible language. Selected allows you to choose in which languages you wish to receive cell broadcast messages. If the language you prefer could not be found in the list, select Other. Topic detectionIf you receive a message that does not belong to any of the 64 Copyright 2004 Nokia
Messaging existing topics, Topic detection > On allows you to save the topic number automatically. The topic number is saved to the topic list and shown without a name. Choose Off if you do not want to save new topic numbers automatically. Sent messages Select Messaging > Options > Settings > Other to open the following list of settings:
Save sent messagesChoose if you want to save a copy of every text message, multimedia message, or e-mail that you have sent to the Sent items folder. No. of saved msgs.Define how many sent messages will be saved to the Sent items folder at a time. The default limit is 20 messages. When the limit is reached, the oldest message is deleted. Memory in useDefine the memory store. Choices are phone memory or memory card, if one is used. Nokia 6620 User Guide
Copyright 2004 Nokia
8 Tools
SETTINGS Select Menu > Tools > Settings. 1 2 Scroll to a setting group and press the joystick to open it. Scroll to a setting you want to change and press the joystick to:
Switch between options if there are only two (On/Off). Open a list of options or an editor. Open a slider view (scroll right or left to increase or decrease the value, respectively). You may be able to receive some settings from your service provider in a short message. See "Smart messages" on page 56. Phone GENERAL Phone languageYou can change the language for the display texts in your phone. This change may also affect the format used for date and time and the separators used, for example, in calculations. There are three languages installed in your phone. If you select Automatic, the phone selects the language according to the information on your SIM card. After you have changed the display text language, you must restart the phone. Note: Changing the settings for Phone language or Writing language affects every application in your phone and the change remains effective until you change these settings again. Writing languageYou can change the writing language of your phone permanently. Changing the language affects:
The characters available when you press any key (19). The predictive text dictionary used. The special characters that are available when you press the * and 1 keys. 66 Copyright 2004 Nokia
Tools DictionaryTo set predictive text input On or Off for all editors in the phone. Select a language for entering predictive text from the list available. You can also change this setting when you are in an editor. Press the Edit key and select Dictionary > Dictionary on or Off. Welcome note or logo The welcome note or logo is displayed briefly each time you switch on the phone. Select Default if you want to use the default image or animation. Select Text to write a welcome note (max. 50 letters). Select Image to select a photo or picture from the Gallery. Orig. phone settingsYou can reset some of the settings to their original values. To do this, you need the lock code. See "Security" on page 73. After resetting the settings, the phone may take a longer time to power on. All documents and files that you have created are left as they are. STANDBY MODE Left selection key and Right selection keyYou can change the shortcuts that appear over the Left selection key and Right selection key in the standby mode. In addition to the applications, you can have the shortcut point to a function, for example, New message. Note: You can only have shortcuts to pre-installed applications and functions. DISPLAY Screen saver timeoutThe screen saver is activated when the screen saver time-out period is over. When the screen saver is active, the display is cleared and you can see the screen saver bar. To deactivate the screen saver press any key. Call SEND MY CALLER ID (NETWORK SERVICE) This network service allows you to set your phone number to be displayed (Yes) or hidden (No) from the person to whom you are calling. Or, the value may be set by your network operator or service provider when you make a subscription. CALL WAITING (NETWORK SERVICE) The network will notify you of a new incoming call while you have a call in progress. Select Activate to request the network to activate call waiting, Cancel to request the network to deactivate call waiting, or Check status to check if the function is active or not. Nokia 6620 User Guide
Copyright 2004 Nokia AUTOMATIC REDIAL When this setting is activated, your phone will make a maximum of ten attempts to connect the call after an unsuccessful call attempt. Press the End key to stop automatic redialing. SUMMARY AFTER CALL Activate this setting if you want the phone to briefly display the duration of the last call. 1-TOUCH DIALING Select On and the numbers assigned to the 1-touch dialing keys (29) can be dialed by pressing and holding the key. See "Assign 1-touch dialing keys" on page 31. ANYKEY ANSWER Select On, and you can answer an incoming call by briefly pressing any key, except the Right selection key, the Power key, and the End key. LINE IN USE (NETWORK SERVICE) This setting is shown only if the SIM card supports two subscriber numbers, that is, two phone lines. Select which phone line (Line 1 or Line 2) you want to use for making calls and sending short messages. Calls on both lines can be answered irrespective of the selected line. Note: You will not be able to make calls if you select Line 2 and have not subscribed to this network service. To prevent line selection, select Line change > Disable if supported by your SIM card. To change this setting, you need the PIN2 code. Connection ACCESS POINTS An access point is the point where your phone connects to the Internet by way of a data call or packet data connection. An access point can be provided, for example, by a commercial Internet service provider (ISP), service provider, or network operator. Note: Many service providers will require you to use an Internet access point (IAP) for your default access point. Other service providers allow you to use a WAP access point. Contact your service provider for more information. To define settings for access points, select Menu > Tools > Settings >
Connection > Access points. 68 Copyright 2004 Nokia Here you can see a short explanation for every setting that may be needed for different data connections and access points. Start to fill in the settings from the top because depending on what data connection you select (Data bearer) only certain setting fields are available:
Tools Connection nameGive a descriptive name for the connection. Data bearerThe options are GPRS and Data call. Depending on which data connection you select, only certain setting fields are available. Fill in all fields marked with Must be defined, or with an asterisk. Other fields can be left empty, unless you have been instructed otherwise by your service provider. Note: To be able to use a data connection, the network service provider must support this feature, and if necessary, activate it for your SIM card. Access point name (for packet data only)The access point name is needed to establish a connection to the GPRS network. You obtain the access point name from your network operator or service provider. Dial-up number (for Data call only)The modem telephone number of the access point. User nameWrite a user name if required by the service provider. The user name may be needed to make a data connection and is usually provided by the service provider. The user name is often case-sensitive. Prompt passwordIf you must key in a new password every time you log on to a server or if you do not want to save your password to the phone, choose Yes. PasswordA password may be needed to make a data connection and is usually provided by the service provider. The password is often case-sensitive. When you are writing the password, the characters you enter are shown briefly and then changed to asterisks (*). The easiest way to enter numbers is to press and hold the digit you want to enter and then continue entering letters. AuthenticationNormal / Secure. HomepageDepending on what you are setting up, write either:
The service address. The address of the multimedia messaging center. Data call type (for GSM data only)Analogue, ISDN v.110, or ISDN v.120 defines whether the phone uses an analogue or digital connection. This setting depends on both your GSM network operator and Internet service provider
(ISP) because some GSM networks do not support certain types of ISDN connections. For details, contact your ISP. If ISDN connections are available, they establish connections more quickly than analogue methods. Maximum data speed (for GSM data only)The options are Automatic / 9600 Nokia 6620 User Guide
Copyright 2004 Nokia
/ 14400 / 19200 / 28800 / 38400 / 43200, depending on what you have chosen in Data call type. This option allows you to limit the maximum connection speed when GSM data is used. Higher data rates may cost more, depending on the service provider. Note: The speeds above represent the maximum speed at which your connection will operate. During the connection, the operating speed may be less, depending on network conditions. Options > Advanced settings:
Phone IP addressThe IP address of your phone. Primary name serverThe IP address of the primary DNS server. Second. name serverThe IP address of the secondary DNS server. Proxy serv. addressThe IP address of the proxy server. Proxy port numberThe port number of the proxy server. If you need to enter these settings, contact your Internet service provider. The following settings are shown if you have selected data call as the connection type:
Use callbackThis option allows a server to call you back once you have made the initial call. Contact your service provider to subscribe to this service. Note: Charges may apply for certain types of received calls, such as roaming calls. Contact your GSM network operator for more information. Note: The phone expects the callback call to use the same data call settings that were used in the callback-requesting call. The network must support that type of call in both directions, to and from the phone. Callback typeThe options are Use server no. / Use other no.. Ask your service provider for the correct setting to use; it will depend on the service providers configuration. Callback numberKey in your phones data phone number which the dial back server uses. Usually, this number is the data call phone number of your phone. Use PPP compressionWhen set to Yes, this option speeds up the data transfer, if supported by the remote PPP server. If you have problems with establishing a connection, try setting this to No. Contact your service provider for guidance. Use login scriptThe options are Yes / No. Login scriptInsert the login script. Modem initialization (Modem initialization string)Controls your phone using modem AT commands. If required, enter characters specified by your service provider or Internet service provider. 70 Copyright 2004 Nokia
Tools GPRS Select Menu > Tools > Settings > Connection > GPRS. GPRS connectionIf you select When available and you are in a network that supports packet data, the phone registers to the GPRS network and sending short messages will be done by GPRS. Also, starting an active packet data connection, for example, to send and receive e-mail, is quicker. If you select When needed, the phone will use a packet data connection only if you start an application or action that needs it. The GPRS connection can be closed after it is not used by any application. If there is no GPRS coverage and you have chosen When available, the phone will periodically try to establish a packet data connection. Access pointThe access point name is needed when you want to use your phone as a packet data modem to your computer. See "Use your phone as a modem" on page 116. About GPRS GPRS (general packet radio service) is a network service that allows mobile phones to be used for sending and receiving data over an IP-based network. GPRS is a data bearer that enables wireless access to data networks, such as the Internet. Note: The Nokia 6620 phone is capable of using an EGPRS (enhanced GPRS) network connection. EGPRS is also known as EDGE (enhanced data rates for global evolution) and is similar to GPRS, but the connection is faster. For more information on availability of EGPRS and data transfer speed, contact your service provider. The applications that may use GPRS are multimedia, IM and text messaging, streaming, browsing sessions, e-mail, remote SyncML, Java application downloading, and the PC dial-up (such as Internet and e-mail). To use GPRS technology, you must first do the following:
Contact your service provider for availability and subscription to the GPRS service. Save the GPRS settings for each of the applications used over GPRS.
For information on pricing, contact your service provider. Note: When you select GPRS as a data bearer, the phone uses GPRS instead of GPRS, if this is available in the network. You cannot select between GPRS and GPRS but for some applications you may be able to select either GPRS or GSM data (CSD). DATA CALL Select Menu > Tools > Settings > Connection > Data call. Nokia 6620 User Guide
Copyright 2004 Nokia The Data call settings affect all access points using a data call. Online timeIf there are no actions the data call is dropped automatically after a time-out period. The options are User defined (in which case you enter a time) or Unlimited. Date and time Select Menu > Tools > Settings > Date and time. The Date and time settings allow you to define the date and time used in your phone, as well as change the date and time format and separators. Clock type > Analogue or DigitalChanges the clock shown in the standby mode. See "Clock" on page 88. Auto time updateAllows the network to update time, date, and time zone information to your phone (network service). For the Auto time update setting to take effect, the phone needs to be restarted. Check any alarms because they may be affected by Auto time update. Clock alarm toneChanges the tone played when the clock reaches an alarm time. GMT offsetChanges the time zone for the clock time. Daylight-savingSets daylight saving time on or off. Call blocking (network service) Call blocking allows you to restrict outgoing and incoming calls with your phone. For this function, you need the blocking password, which you can obtain from your service provider. 1 Scroll to one of the blocking options. 2 Select Menu > Tools > Settings > Call blocking > Options > Activate to request the network to set call blocking on, Cancel to set the selected call restriction off, or Check status to check if the calls are blocked or not. Select Options > Edit blockings passw. to change the blocking password. Select Options > Cancel all blockings to cancel all active call blockings. You cannot have blocking of incoming calls and call forwarding or fixed dialing active at the same time. See "Call forwarding (network service)" on page 24. See also Security on page 73. When calls are blocked, calls still may be possible to certain official emergency numbers. Note: When calls are blocked, calls may be possible to certain emergency numbers in some networks (e.g., 911 or other official emergency numbers). Note: Call blocking affects all calls, including data calls. 72 Copyright 2004 Nokia
1 2 | Manual b | Users Manual | 2.05 MiB |
Tools Network OPERATOR SELECTION Choose Automatic to set the phone to automatically search for and select one of the cellular networks available in your area. Or, choose Manual if you want to select the desired network manually from a list of networks. If the connection to the manually selected network is lost, the phone will sound an error tone and ask you to select a network again. The selected network must have a roaming agreement with your home network, that is, the operator whose SIM card is in your phone. CELL INFO DISPLAY Select On to set the phone to indicate when it is used in a cellular network based on Micro Cellular Network (MCN) technology and to activate cell info reception. Enhancement Scroll to an enhancement folder and open the settings:
Select Default profile to select the profile you want to be activated each time when you connect a certain enhancement to your phone. See "Change the profile" on page 78. Select Automatic answer to set the phone to answer an incoming call automatically after five seconds time. If the Incoming call alert is set to Beep once or Silent, automatic answer cannot be used, and you must answer the phone manually. If you are using an enhancement such as a loopset, headset, or TTY adapter, you must activate it separately by selecting Menu > Tools > Settings >
Enhancement > Enhancement in use > Headset, Loopset, or TTY. If you have activated a loopset, the headset will use the same settings as the loopset. See also Enhancement indicators on page 15. Security PHONE AND SIM If your phone requests a security code, refer to the following explanations to determine what you should enter:
PIN code (4 to 8 digits)The PIN (Personal Identification Number) code protects your SIM card against unauthorized use. The PIN code is usually supplied with the SIM card. After three consecutive incorrect PIN code entries, the PIN code is blocked. If the PIN code is blocked, you need to unblock the PIN code before you can use Nokia 6620 User Guide
Copyright 2004 Nokia
the SIM card again. See also the information below about the PUK code. PIN2 code (4 to 8 digits)The PIN2 code is supplied with some SIM cards and is required to access some functions, such as fixed dialing numbers (FDN). Lock code (5 digits)The lock code can be used to lock the phone and keypad to avoid unauthorized use. Note: The factory setting for the lock code is 12345. To avoid unauthorized use of your phone, change the lock code. Keep the new code secret and in a safe place separate from your phone. PUK and PUK2 codes (8 digits)The PUK (Personal Unblocking Key) code is required to change a blocked PIN code. The PUK2 code is required to change a blocked PIN2 code. If the codes are not supplied with the SIM card, contact the operator whose SIM card is in your phone for the codes. You can change the following codes: lock code, PIN code, and PIN2 code. These codes can only include the numbers from 0 to 9. Note: Avoid using access codes similar to emergency numbers, such as 911, to prevent accidental dialing of the emergency number. PIN code requestWhen the PIN code request is active, the code is requested each time the phone is switched on. Note that deactivating the PIN code request may not be allowed by some SIM cards. PIN code / PIN2 code / Lock codeOpen this setting if you want to change the code. Autolock periodYou can set an autolock period, a time-out after which the phone is automatically locked and can be used only if the correct lock code is entered. Key in a number for the time-out in minutes or select None to turn off the autolock period. To unlock the phone, key in the lock code. Note: When the phone is locked, calls may be possible to the emergency number programmed into your phone (e.g. 911 or other official emergency number). Lock if SIM changedSelect Yes if you want the phone to ask for the lock code when an unknown, new SIM card is inserted into your phone. The phone maintains a list of SIM cards that are recognized as the owners cards. Fixed dialingYou can restrict your outgoing calls to selected phone numbers, if supported by your SIM card. You need the PIN2 code for this function. When this function is active, you can only call those phone numbers that are included in the fixed dialing list or which begin with the same digit(s) as a phone number on the list. Press the joystick to set Fixed dialing on. 74 Copyright 2004 Nokia
Tools Options in the Fixed dialing view: Open, Call, Activ. fixed dialing/Deact. fixed dialing, New contact, Edit, Delete, Add to Contacts, Add from Contacts, Find, Mark/
Unmark, Help, and Exit. Note: When fixed dialing is activated, calls still may be possible to the official emergency number programmed into your phone. To add new numbers to the Fixed dialing list, select Options > New contact or Add from Contacts. Closed user group (network service)You can specify a group of people whom you can call and who can call you. For more information, contact your network operator or service provider. Select Default to activate the default group agreed on with the network operator, On if you want to use another group (you need to know the group index number), or Off. Note: When calls are limited to closed user groups, calls still may be possible to the official emergency number programmed into your phone. Confirm SIM services (network service)Sets the phone to display confirmation messages when you are using a SIM card service. Restore serverTo reset your connection settings allowing you to receive new settings from your service provider. CERTIF. (CERTIFICATE) MANAGEMENT Options in the certificate management main view: Certificate details, Delete, Trust settings, Mark/Unmark, Help, and Exit. In the Certif. management main view, you can see a list of authority certificates that have been stored in your phone. Scroll right to see a list of personal certificates, if available. Authority certificates are used by some browser services, such as banking services, for checking signatures or server certificates or other authority certificates. Server certificates are used to improve security in the connection between the phone and the gateway. The phone receives the server certificate from the service provider before the connection is established, and its validity is checked using the authority certificates saved in the phone. Server certificates are not saved. Server certificates may be needed, for example, when you:
Want to connect to an online bank or another site or remote server for actions that involve transferring confidential information. Want to decrease the risk of viruses or other malicious software and be sure of the authenticity of software when downloading and installing software. Nokia 6620 User Guide
Copyright 2004 Nokia
Important: Even if the use of certificates makes the risks involved in remote connections and software installation considerably smaller, they must be used correctly in order to benefit from increased security. The existence of a certificate does not offer any protection by itself; the certificate manager must contain correct, authentic, or trusted certificates for increased security to be available. Important: Certificates have a restricted lifetime. If Expired certificate or Certificate not valid yet is shown even if the certificate should be valid, check that the current date and time in your phone are correct. CHANGE THE TRUST SETTINGS OF AN AUTHORITY CERTIFICATE Scroll to an authority certificate and select Options > Trust settings. Depending on the certificate, a list of the applications that can use the selected certificate is shown. For example:
Application manager / YesThe certificate is able to certify the origin of new software. Internet / YesThe certificate is able to certify e-mail and imaging servers. Important: Before changing these settings, you must make sure that you really trust the owner of the certificate and that the certificate really belongs to the listed owner.
FILE MANAGER Select Menu > Tools > File Mngr. Options in the File manager main view: Open, Send, Delete, Move to folder, Copy to folder, New folder, Mark/Unmark, Rename, Find, Receive via infrared, View details, Memory details, Help, and Exit. In File manager you can browse, open, and manage files and folders in the phone memory or on the memory card, if you use one. Open File manager to see a list of the folders in the phone memory. Scroll right to see the folders on the memory card, if you use one. You can browse, open, and create folders, mark, copy and move items to folders. See "Actions common to all applications" on page 18. 76 Copyright 2004 Nokia
Tools View memory consumption If you have a memory card installed on your phone, you will have a choice of two memory views, one for the phone memory and one for the memory card. Scroll right or left to move from one memory tab to another. To check memory consumption of the current memory select Options >Memory details. The phone calculates the approximate amount of free memory for storing data and installing new applications. In the memory views, you can view the memory consumption of the different data groups: Calendar, Contacts, Documents, Messages, Images, Sound files, Video clips, Applications, Mem. in use, and Free memory. Note: If the phone memory is getting low, remove some files, or move them to the memory card. See "Troubleshooting" on page 119. Nokia 6620 User Guide
Copyright 2004 Nokia 9 Personalization
PROFILES Select Menu > Profiles. In Profiles, you can adjust and customize the phone tones for different events, environments, or caller groups. You can see the currently selected profile at the top of the display in the standby mode. If the General profile is in use, only the current date is shown. Options in the Profiles main view: Activate, Personalize, Create new, Delete profile, Tone download, Help, and Exit. Change the profile 1 2 Shortcut: To change the profile in the standby mode, press the Power key briefly, scroll to the profile you want to activate, and press OK. Offline profile Offline profile lets you use features on the phone without connecting to the GSM wireless network. Select Menu > Profiles. A list of profiles opens. In the Profiles list, scroll to a profile and select Options > Activate. Important: In Offline profile you cannot make any calls, including emergency calls, or use other features that require network coverage. When you activate the Offline profile GSM is turned off, as indicated by the icon in the signal strength indicator. All GSM wireless phone signals to and from the phone are prevented. Note: In areas where mobile phone use is prohibited, use of a Bluetooth connection may also be prohibited. Therefore, consult the relevant authorities before using a Bluetooth connection. 78 Copyright 2004 Nokia Personalization Customize profiles 1 To modify a profile, scroll to the profile in the Profiles list and select Options >
Personalize. A list of profile settings opens. Scroll to the setting you want to change and press the joystick to open the choices:
2 icon next to the tone name. Ringing toneSets the ringing tone for voice calls, choose a ringing tone from the list. Press any key to stop the sound. If a memory card is used, tones stored on it have the Ringing tones use shared memory. See
"Shared memory" on page 3. You can also change ringing tones in Contacts. See "Add a ringing tone for a contact card or group"
on page 29. Ringing typeWhen Ascending is selected, the ringing volume starts from level one and increases level by level to the set volume level. Ringing volumeSets the volume level for the ringing and message alert tones. Message alert toneSets the tone for messages. IM alert toneSets the tone for instant messages. Vibrating alertSets the phone to vibrate at incoming voice calls and messages. Keypad tonesSets the volume level for keypad tones. Warning tonesInstructs the phone to sound a warning tone, for example, when the battery is running out of power. Alert forSets the phone to ring only upon calls from phone numbers that belong to a selected contact group. Phone calls coming from people outside the selected group will have a silent alert. You can select All calls, or you can select items from a list of contact groups, if you have created them. See "Creating contact groups" on page 32. Profile nameYou can rename a profile and give it any name you want. The General and Offline profiles cannot be renamed.
THEMES Select Menu > Themes. Nokia 6620 User Guide
Copyright 2004 Nokia
You can change the look of your phone display by activating a theme. A theme can include the idle screen wallpaper, color palette, screen saver, and icons and background image in Go to. Edit a theme for more detailed personalization. When you open Themes you will see a list of the available themes. The currently active theme is indicated by a check mark. Scroll right to see the themes on the memory card, if you use one. To preview a theme, scroll to the theme and select Options > Preview. Press the Left selection key to activate the theme. You can activate the theme without previewing it by selecting Options > Apply from the main view. Options in the Themes main view: Preview, Apply, Edit, Copy to mem. card, Copy to phone mem., Theme downloads, Delete, Help, and Exit. Edit themes To personalize themes further, you can group together elements from other themes or images from the Gallery:
1 2 Scroll to a theme, select Options > Edit. Scroll to the following items, and select Options > Change to modify them:
Wallpaper to choose an image to use as a background image in the standby mode. You can select an image from one of the available themes or from the Gallery, where your own images are saved. Color palette to change the color used on the display. Screen savers to select what is shown on the screen saver bar: the time and date or text you have written yourself. The location and background color of the screen saver bar changes in one minute intervals. Also, the screen saver changes to indicate the number of new messages or missed calls. You can set the time that elapses before the screen saver is activated. See "Standby mode" on page 67. Icons to select a different icon set from any one of the themes. Note: All pre-installed themes have the same icon set. 80 Copyright 2004 Nokia
Personalization Image in Go to to choose an image to use as a background image in Go to. You can select an image from one of the available themes or from the Gallery, where your own images are saved. Select Options > Set to select the current setting. You can also preview the selected item by selecting Options > Preview. Note that you cannot preview all elements. 3 Restore themes To restore the currently selected theme back to its original settings, select Options > Restore orig. theme when editing a theme.
GO TO Press Go to (Right selection key) in the standby mode or select Menu > Go to. Use Go to for storing shortcuts, links to your favorite photos, video clips, notes, Recorder sound files, browser bookmarks, and saved browser pages. Options in the Go to main view: Open, Edit shortcut name, Shortcut icon, Delete shortcut, Move, List view / Grid view, Help, and Exit. The default shortcuts:
opens the Notes editor opens the Calendar to the current date opens the Messaging Inbox Shortcuts can be added only from pre-installed applications and functions. Not all applications have this functionality. 1 Open the application and scroll to the item that you want to add as a shortcut to Go to. Select Options > Add to Go to and press OK. 2 Note: A shortcut in Go to is automatically updated if you move the item to which it is pointing, for example, from one folder to another. Nokia 6620 User Guide
Copyright 2004 Nokia
Hints on using shortcuts:
To open a shortcut, scroll to the icon and press the joystick. The file is opened in the corresponding application. To delete a shortcut, scroll to the shortcut you want to remove and select Options > Delete shortcut. Removing a shortcut does not affect the file to which it refers. To change the shortcut name, select Options > Edit shortcut name. Write the new name. This change affects only the shortcut, not the file or item to which the shortcut refers. 82 Copyright 2004 Nokia
10 Extras
WALLET Extras Select Menu > Extras > Wallet. Wallet provides you with a storage area for your personal information, such as credit and debit card numbers, addresses, and other useful data (for example, user names and passwords). The information stored in the wallet can be easily retrieved while browsing to automatically fill in online forms on browser pages, for example, when the service asks for credit card details. Data in the wallet is encrypted and protected with a wallet code that you define. You can group wallet data into profiles that can be accessed, for example, for making purchases online. Because of the nature of the wallet, it will automatically close after 5 minutes. Enter the wallet code to regain access to the contents. You can change this automatic time-out period, if required. See "Wallet settings" on page 85. Options in the wallet main view: Open, Settings, Help, and Exit. Enter the wallet code Each time you open the wallet you will be prompted for a wallet code. When you open the wallet for the first time, you must create your own access code:
1 Enter a code of your choice (410 alphanumeric characters) and press OK. You will be prompted to verify the code. Enter the same code and press OK. Do not give your wallet code to anyone else. 2 Note: If you enter the wallet code incorrectly on three consecutive attempts, the wallet application is blocked for five minutes. The block time increases if further incorrect wallet codes are entered. Important: If you forget your wallet code, you will have to reset the code, and you will lose all information stored in the wallet. See "Reset the wallet and wallet code" on page 86. Nokia 6620 User Guide
Copyright 2004 Nokia Store personal card details Options when viewing or editing card details: Delete, Help, and Exit. 1 2 Select the Cards category from the main wallet menu. Select a type of card from the list:
Payment cardsCredit and debit cards. Loyalty cardsMembership and store cards. Online acc. cardsPersonal user names and passwords to online services. Address cardsBasic contact details for home/office. User info cardsCustomized personal preferences for online services. Select Options > Create new. An empty form opens. Fill in the fields and press Done. 3 4 You can also receive card information directly to the phone from a card issuer or service provider (if they offer this service). You will be notified to which category the card belongs. Save or discard the card. You can view and rename a saved card, but you cannot edit it. You can open, edit, or delete the fields in the card. Any changes will be saved upon exiting. Create personal notes Personal notes are a means of storing sensitive information, for example, a bank account number. You can access the data in a personal note from the browser. You can also send a note as a message. 1 2 3 Select the Personal notes category from the main wallet menu. Select Options > Create new. An empty note opens. Press any key from 1 to 0 to start writing. Press the Clear key to clear characters. Press Done to save. Create a wallet profile Once you have stored your personal details, you can combine them together into a wallet profile. Use a wallet profile to retrieve wallet data from different cards and categories to the browser. 1 2 3 Select the Wallet profiles category from the main wallet menu. Select Options > Create new. A new wallet profile form opens. Fill in the fields as indicated below and press Done. Some of the fields must contain data selected from the wallet. You must save the data under the relevant category before creating a wallet profile or else the profile cannot be created. 84 Copyright 2004 Nokia
Extras Profile nameChoose and enter a name for the profile. Payment cardSelect a card from the Payment card category. Loyalty cardSelect a card from the Loyalty card category. Online access cardSelect a card from the Online acc. card category. Shipping addressSelect an address from the Address card category. Billing addressBy default this is the same as the Shipping address. If you require a different address, select one from the Address card category. User info cardSelect a card from the User info card category. Receive e-receiptSelect a destination from the Address card category. Deliver e-receiptSelect To phone, To e-mail, or To pho. & e-mail. Phone ID sendingSet to On or Off. Defines whether or not your unique phone identification is sent with the wallet profile (for future development dependent on RFID-based ticketing). Retrieve information from wallet to your browser When using online mobile services supporting the wallet functionality, you can upload the data stored in your wallet to automatically enter your details into an online form. For example, by uploading your payment card details, you do not need to key in the card number and expiration date each time you need them (depending on the content being browsed). Also, you can retrieve your user name and password stored as an access card when connecting to a mobile service that requires authentication. See "Purchase an item" on page 103. View ticket details You can receive notifications of tickets purchased online with the browser. Received notifications are stored in the wallet. To view the notifications:
1 2 Options in the Tickets main view: View, Delete, Rename, Mark / Unmark, Help, and Exit. Select the Tickets category from the main wallet menu. Select Options > View. Note: None of the fields within the notification can be modified. Wallet settings Select Options > Settings from the main wallet menu to modify the following items:
Wallet codeChange your wallet code. You will be prompted to enter the current code, create a new code, and verify the new code. Phone IDSet the phone ID code, type, and sending options (for future development dependent on RFID-based ticketing). Nokia 6620 User Guide
Copyright 2004 Nokia
Automatic closeChange the automatic time-out period (160 minutes). After the time-out period has elapsed, the wallet code must be re-entered to gain access to the contents. Reset the wallet and wallet code Important: This operation erases all contents of the wallet. Key in *#7370925538# in the standby mode. Enter the phone lock code, and press OK. See "Security" on page 73. You will be asked to confirm the erasing of data. Press OK. To reset both the contents of the wallet and the wallet code:
1 2 3 When opening the wallet again, you must enter a new wallet code. See "Enter the wallet code" on page 83.
CALCULATOR Select Menu > Extras > Calculator Options in Calculator: Last result, Memory, Clear screen, Help, and Exit. 1 Enter the first number of your calculation. To add a decimal, press the # key. Press the Clear key to erase a mistake in the number. Scroll to an arithmetic function and press the joystick to select it. Enter the second number. To execute the calculation, scroll to and press the joystick. 2 3 4 and Press and hold the Clear key to clear the result of the previous calculation. Use to view previous calculations and move in the sheet. Note: This calculator has limited accuracy and is designed for simple calculations.
CONVERTER Select Menu > Extras > Converter. In Converter, you can convert measures such as Length from one unit to another, for example, Yards to Meters. Note: The Converter has limited accuracy and rounding errors may occur. 86 Copyright 2004 Nokia
Extras Convert units Options in Converter: Conversion type, Currency rates (not applicable to other units), Help, and Exit. Note: To make currency conversions, you must first set the exchange rate. See "Set a base currency and exchange rates" on page 87. 1Scroll to the Type field and press the joystick to open a list of measures. 2 3 4 5 6 Scroll to the measure you want to use and press OK. Scroll to the first Unit field and press the joystick to open a list of available units. Select the unit from which you want to convert and press OK. Scroll to the next Unit field and select the unit to which you want to convert. Scroll to the first Amount field and key in the value you want to convert. Press the # key to add a decimal and press the * key to insert the +, - (for temperature), and E (exponent) symbols. The other Amount field changes automatically to show the converted value. Note: The conversion order changes if you write a value in the second Amount field. The result is shown in the first Amount field. Set a base currency and exchange rates Before you can make currency conversions, you need to choose a base currency
(usually your domestic currency) and add exchange rates. Note: The rate of the base currency is always 1. The base currency determines the conversion rates of the other currencies. 1 2 3 4 Select Currency as the measure type and select Options > Currency rates. A list of currencies opens and you can see the current base currency at the top. To change the base currency, scroll to the currency (usually your domestic currency), and select Options > Set as base curr.. Important: When you change base currency, all previously set exchange rates are reset to zero and you must enter new rates. Add exchange rates, scroll to the currency, and key in a new rate, that is, how many units of the currency equal one unit of the base currency you have selected. After you have inserted all the needed exchange rates, you can make currency conversions. See "Convert units" on page 87. Nokia 6620 User Guide
Copyright 2004 Nokia
NOTES Select Menu > Extras > Notes. You can link notes to Go to and send them to other devices. Plain text files (TXT format) you receive can be saved to Notes. Press any key from 1 to 0 to start to write. Press the Clear key to clear letters. Press Done to save.
CLOCK Select Menu > Extras > Clock. Options in Clock: Set alarm, Reset alarm, Remove alarm, Settings, Help, and Exit. Change clock settings To change the time or date, select Options > Settings in Clock. Set an alarm 1 2 To set a new alarm, select Options > Set alarm. Enter the alarm time and press OK. When the alarm is active, the is shown. indicator To cancel an alarm, select Clock and select Options > Remove alarm. Stop an alarm Press Stop to turn off the alarm. Press any key or Snooze to stop the alarm for five minutes, after which it will resume. You can do this a maximum of five times. If the alarm time is reached while the phone is switched off, the phone switches itself on and starts sounding the alarm tone. If you press Stop, you receive a message asking whether you want to activate the phone for calls. Press No to switch off the phone or Yes to make and receive calls. Note: Do not press Yes when wireless phone use is prohibited or when it may cause interference or danger. Personalize the alarm tone 1 2 To personalize the alarm tone, select Options > Settings. Select Clock alarm tone. When you scroll through the list of tones, you can stop on a tone to listen to 88 Copyright 2004 Nokia Extras it before you make your selection. Press Select to select the current tone. 3
RECORDER Select Menu > Extras > Recorder. Options in Recorder: Record sound clip, Delete, Rename sound clip, Send, Go to Gallery, Settings, Add to Go to, Help, and Exit. Note: Obey all local laws governing recording of calls. Do not use this feature illegally. The voice recorder allows you to record telephone conversations and voice memos. If you are recording a telephone conversation, both parties will hear a tone every five seconds during recording. Recorded files are stored in the Gallery. See "Gallery" on page 45. Select Options > Record sound clip and scroll to a function and press the joystick to select it. Use:
to record to pause to stop to fast forward to fast rewind to play an opened sound file Note: The recorder cannot be used when a data call or GPRS connection is active.
VOICE COMMANDS Select Menu > Tools > Voice com.. Options in the Voice commands main view: Add voice command, Open, New application, Playback, Change, Delete, Delete all, Help, and Exit. You can use Voice commands to start applications and profiles, and to dial numbers from Contacts, without having to look at your phone display. You record a word, or words, (voice command) and then say this voice command to open an application, activate a profile, or dial a number. Note: You can have only one voice command per item. Any spoken word(s) can be a voice command. Nokia 6620 User Guide
Copyright 2004 Nokia When recording, hold the phone at a short distance away from your mouth. After the starting tone, say clearly the word, or words, you want to record as a voice command. Before using voice commands, note that:
Voice commands are not language dependent. They are dependent on the speakers voice. Voice commands are sensitive to background noise. Record and use them in a quiet environment. Very short voice commands are not accepted. Use longer words and avoid similarities between different voice commands. Note: You must say the voice command exactly as you said it when you recorded it. This may be difficult in, for example, a noisy environment or during an emergency, so you should not rely solely upon voice commands in all circumstances. Add a voice command to an application Note: To add a voice command to a profile, the Profiles folder must be opened and a specific profile selected. 1 2 3 4 In the Voice commands main view, scroll to the application to which you want to add a voice command, and select Options > Add voice command. The text Press Start, then speak after tone is displayed. Press Start to record a voice command. The phone sounds a starting tone and the note Speak now is displayed. Say the voice command. The phone will stop recording after approximately 5 seconds. After recording, the phone plays the recorded command and the note Playing voice command is displayed. If you do not want to save the recording, press Quit. 5 When the voice command has been successfully saved, the note Voice command saved is displayed and a beep sounds. A symbol to the application. can be seen next ADD AN APPLICATION TO THE LIST You can assign voice commands to other applications that are not listed in the Voice commands main view. 90 Copyright 2004 Nokia
Extras 1 2 3 In the Voice commands main view, select Options > New application. Available applications are displayed. Scroll to the application that you want to add and press Select. Add a voice command to the new application. See "Add a voice command to an application" on page 90. Use a voice command to start an application 1 In the standby mode, press and hold the Right selection key. A short tone is played and the note Speak now is displayed. 2 When you are starting an application by saying a voice command, hold the phone at a short distance away from your mouth and say the voice command clearly. The phone plays the original voice command and starts the application. If the phone plays the wrong voice command, press Retry. 3 Replay, erase, or change a voice command To replay, erase, or change a voice command, scroll to the item that has a voice command (indicated by
), select Options >:
Playback to listen to the voice command again. Delete to erase the voice command. Change to record a new voice command. Press Start to record.
INSTANT MESSAGING (IM) (NETWORK SERVICE) Select Menu > IM. Options in the IM main view: Open, Login, Logout, Settings, Help, and Exit. Nokia 6620 User Guide
Copyright 2004 Nokia
IM allows you to converse with other people using instant messages and join discussion forums (IM groups) with specific topics. Once you have registered with an IM service, you can log in to the service providers IM server. Note: Check the availability of IM services, pricing, and tariffs with your network operator and/or service provider. Service providers will also give you instructions on how to use their services. This User Guide shows examples of IM icons and their descriptions. The icons and display text may appear differently on your phone, depending on which IM service you use. If you have any questions about the differences in the various IM service providers display text and icons, contact your wireless service provider Before using IM To access an IM service you need to save the settings for that service. You may receive the settings from the network operator or service provider that offers the service. See "Smart messages" on page 56. You can also key in the settings manually. See "IM servers" on page 96. Connect to an IM server 1 Go to Menu > IM to connect to an IM server. You can change the default IM server. See "IM servers" on page 96. Once the connection has been established, key in your user ID and password and press the joystick, or press Cancel to stay offline. When you are offline, your phone is not connected to the IM server and you cannot send or receive messages. To log in later, select Options > Login. To log out, select Options > Logout. 2 3 Note: You obtain the user ID and password from your service provider. Modify your IM settings Select Options > Settings > IM settings from the main IM menu screen. Use screen nameSelect Yes to key in a nickname (max. 10 characters). IM presenceTo prevent others from seeing if you are online, select Not active. Reload user statusTo choose how to update information about whether your IM contacts are online or offline. Select Automatically or Manually. When you select Automatically, you must then select the contacts on which you want 92 Copyright 2004 Nokia
Extras to receive automatic status updates. Block invitationsTo block all IM invitations sent to you, select Yes. IM invitations are sent by IM users who want you to join their IM groups. Message speedSelect the speed at which new messages are displayed. Login typeTo choose whether to log in to a IM server automatically or by entering your user ID and password manually each time you start IM. Join and leaving an IM group Go to the IM groups view. A list of IM groups that you have saved or are currently joined to is shown. The icon next to a group indicates whether it is:
A group that you have saved and are currently joined to. A group that you have saved but are not currently joined to. A group that you are currently joined to but have not saved. Options in the IM groups view: Open, Join group, Create new group, Leave IM group, IM group, Search, Settings, Help, and Exit. To join an IM group: Scroll to a group on the list and press the joystick. To join an IM group not on the list but for which you know the group ID, select Options >
Join group. Key in the group ID and press the joystick. To leave the IM group: Select Options > Leave IM group. You can scroll to a group, press Options > IM group and then select: Save as favorite, Remove group, View members to see who are currently joined to the group, IM group info to see the group ID, topic, members, editing rights in the group, and whether sending private messages is allowed in the group, and IM group settings to view and edit the IM groups settings. See "Edit IM group settings" on page 96. Search for IM groups and users Go to the IM groups view and select Options > Search > Groups or Users. You can search for Groups by Group name, Topic, and Members (user ID). For groups that you have found you can select Join and Save group. You can search for Users by Users name, User ID, Phone number, and E-mail address. For users that you have found, you can select Add to IM contacts to save the contact, and Add to blocked list to block (or unblock) messages from the contact. When the search result is displayed, you can select Options > New search, More results from the same search, and Previous results to see your previous search result. Nokia 6620 User Guide
Copyright 2004 Nokia
Chat in an IM group Once you have joined an IM group, you can view the messages that are exchanged in the group, and send your own messages. Options while in an IM group chat: Send, Send invitation, Send private message, Reply, Leave IM group, IM group, Record convers./Stop recording, Help, and Exit. To send a message, write the message and press the joystick. To send a private message to a member (if allowed in the group), select Options > Send private message, select the recipient, write the message, and press the joystick. To reply to a private message sent to you, select Options > Reply. To invite IM contacts who are online to join the IM group (if allowed in the group), select Options > Send invitation, select the contacts you want to invite, write the invitation message, and press the joystick. RECORD MESSAGES To record the messages that are exchanged in an IM group or during an individual conversation, select Options > Record convers.. Key in the name for the message file and press the joystick. To stop recording, select Options > Stop recording. The recorded message files are saved to Notes. See "Notes" on page 88. BLOCK MESSAGES To prevent receiving messages from certain IM users, select Options > Blocking options and then select:
Add to blocked listTo block messages from the currently selected user. Add ID to list manuallyKey in the user ID of the user and press the joystick. View blocked listTo see the users whose messages are blocked. UnblockSelect the user that you want to remove from the blocked list and press the joystick. Start and view individual conversations Go to the Conversations view for a list of the IM users with whom you have an ongoing conversation. Options in the Conversations view: Open, Add to IM contacts, New conversation, IM group, Blocking options, End conversation, Settings, Help, and Exit. To start a new conversation, select Options > New conversation and then select:
Select recipientTo see a list of your saved IM contacts that are currently online. Scroll to the contact and press the joystick. 94 Copyright 2004 Nokia
Enter user IDKey in the user ID and press the joystick. The user ID is provided by the service provider to those who register to the service. Extras Options while having a conversation: Send, Add to IM contacts, Record convers./Stop recording, Blocking options, End conversation, Settings, Help, and Exit To view an ongoing conversation, scroll to the user and press the joystick. To continue the conversation, write your message and press the joystick. To return to the conversations list without closing the conversation, press Back. To close the conversation, select Options > End conversation. Icon:
user. next to a user indicates that you have received a new message from that Note: Ongoing conversations are automatically closed when you exit IM. To save a user to your IM contacts, scroll to the user and select Options > Add to IM contacts. To send automatic replies to incoming messages, select Options > Set auto reply on. Key in the text and press Done. You can view received messages normally. IM contacts Go to the IM contacts view to see a list of your saved IM contacts. is shown next to contacts that are currently online, and for contacts that are offline. Options in the IM contacts view: Open, View conversation, Switch tracking on, Belongs to groups, New IM contact, Edit, Delete, Reload user status, Blocking options, Search, Settings, Help, and Exit. To create a new contact, select Options > New IM contact. Fill in the Nickname, Name, and User ID fields and press Done. You can scroll to a contact and press the joystick to view contact details. Press Options and select:
EditTo edit the contacts details. View conversationTo start a new conversation or continue an ongoing conversation with the contact. Switch tracking onTo be notified every time the IM contact goes online or offline. Belongs to groupsTo see which groups the IM contact has joined. Reload user statusTo update information about whether the contact is online or offline. This option is not available if you have set the Reload user status to Automatically in IM settings. Nokia 6620 User Guide
Copyright 2004 Nokia
Edit IM group settings You can edit the settings for an IM group if you have created the group or if the creator of the group has given you editing rights. Go to the IM groups view, scroll to the desired group and select Options > IM group > IM group settings. CREATE A NEW IM GROUP Go to the IM groups view and select Options > Create new group. Key in the settings for the group:
Group name, Group topic, and a Welcome note that the participants see when they join the group. Group ID is created automatically and cannot be changed. Group size is the maximum number of members allowed to join the group. Allow search defines whether others can find the IM group by searching. Editing rights designates which contacts have permission to invite other contacts to join the group. Select the IM group members to whom you want to give editing rights. Group members - See "Restrict access to an IM group" on page 96. Allow private msgs. - To allow or prevent private messaging between members. RESTRICT ACCESS TO AN IM GROUP You can make an IM group closed by creating a Group members list. Only the users on the list are allowed to join the group. Go to the IM groups view, scroll to the group and select Options > IM group > IM group settings > Group members >
Selected only. To add a user to the list, select Add and IM contact or Enter user ID. To remove a user from the list, scroll to the user and select Remove. To clear the list and allow all IM users to join the group again, select Remove all. IM servers Select Options > Settings > Server settings. You may receive the settings as a smart message from the service provider that offers the IM service. To change the IM server you wish to connect to, select Server in use. To add a new server to your list of IM servers, select IM servers > Options >
Create new server. Key in or select the settings: Server name and Access point in use to connect to the server, URL address of the IM server, your User ID, and login Password. See "Connection" on page 68. 96 Copyright 2004 Nokia
Extras Note: You obtain the user ID and password from your service provider when you register to the service. If you do not know your user ID or password, contact your service provider.
MEMORY CARD Select Menu > Extras > Memory. Options in the memory card: Backup phone mem., Restore from card, Format mem. card, Memory card name, Set password / Change password / Remove password, Memory details, Help, and Exit. If you have a memory card, you can use it to backup information from phone memory and to store your multimedia files such as video clips, sound files, photos, messaging data, etc. Only use MMC cards with this device. Other memory cards, such as Secure Digital (SD) cards, do not fit in the MMC card slot and are not compatible with this device. Attempts to use a non-compatible memory card may damage the memory card as well as the phone, and data stored on the non-compatible card may be corrupted. For details on inserting a memory card into the phone, see Insert the memory card on page 10. Details on how you can use the memory card with other features and applications of your phone are given in the sections describing these features and applications. The memory card in the sales package may contain promotional material of third parties, which you can delete. Important: Keep all memory cards out of the reach of small children. Format memory card Important: When a memory card is formatted, all data on the card is permanently lost. Some memory cards are supplied pre-formatted and others require formatting. Consult your retailer to find out if you must format the memory card before you can use it. Select Options > Format mem. card., and select Yes to confirm. When formatting is complete, key in a name for the memory card (max. 11 letters or numbers). Nokia 6620 User Guide
Copyright 2004 Nokia Back up and restoring information To back up information from phone memory to the memory card, select Options >
Backup phone mem.. To restore information from the memory card to phone memory, select Options >
Restore from card. Note: You can only backup the phone memory and restore it to the same model of phone. Lock the memory card You can set a password to lock your memory card against unauthorized use. Select Options > Set password. You will be asked to enter and confirm your password. The password can be up to eight characters long. Note: The password is stored in your phone and you dont have to enter it again while you are using the memory card on the same phone. If you want to use the memory card on another phone, you will be asked for the password. Unlock a memory card If you insert another password protected memory card in your phone, you will be prompted to enter the password of the card. To unlock the card, select Options >
Unlock memory card. Note: Once the password is removed, the memory card is unlocked and can be used on another phone without a password. Check memory consumption You can check the memory consumption of different data groups and the available memory for installing new applications or software on your memory card. Select Options > Memory details. 98 Copyright 2004 Nokia 11 Web Browser and Applications Web Browser and Applications
WEB (MOBILE BROWSER) Select Menu > Web or press and hold the 0 key in the standby mode. Various service providers maintain pages specifically designed for mobile phones, offering services that can be, for example, news, weather reports, banking, travel information, entertainment, and games. With the mobile browser you can view these services as WAP pages written in WML, XHTML pages written in XHTML, or a mixture of both. Note: Check the availability of services, pricing, and tariffs with your network operator and/or service provider. Service providers will also give you instructions on how to use their services. Basic steps for accessing Save the settings that are needed to access the browser service that you want to use. See "Set up the phone for the browser service" on page 99. Make a connection to the service. See "Make a connection" on page 100. Start browsing the web pages. See "Browse" on page 101. End the connection to the service. See "End a connection" on page 104. Set up the phone for the browser service RECEIVE SETTINGS IN A SMART MESSAGE You may receive service settings in a special text message, a so-called smart message, from the network operator or service provider that offers the service. See
"Smart messages" on page 56. For more information, contact your network operator or service provider. KEY IN THE SETTINGS MANUALLY Follow the instructions given to you by your service provider. 1 Select Settings > Connection settings > Access points and define the settings for an access point. See "Connection" on page 68. Nokia 6620 User Guide
Copyright 2004 Nokia
2 Select Web > Options > Add bookmark. Write a name for the bookmark and the address of the browser page defined for the current access point. Make a connection Once you have stored all the required connection settings, you can access browser pages. There are three different ways to access browser pages:
) of your service provider. Select the homepage (
Select a bookmark from the Bookmarks view. Press the keys 29 to start to write the address of a browser service. The Go to field at the bottom of the display is immediately activated and you can continue writing the address there. After you have selected a page or written the address, press the joystick to start downloading the page. View bookmarks Note: Your phone may have some pre-installed bookmarks for sites not affiliated with Nokia. Nokia does not warrant or endorse these sites. If you choose to access them, you should take the same precautions for security or content, as you would with any site. In the Bookmarks view, you can see bookmarks pointing to different kinds of browser pages. Bookmarks are indicated by the following icons:
The starting page defined for the browser access point. If you use another browser access point for browsing, the starting page is changed accordingly. The last visited page. When the phone is disconnected from the service, the address of the last visited page is kept in memory until a new page is visited during the next connection. When you scroll through bookmarks, you can see the address of the highlighted bookmark in the Go to field at the bottom of the display. A bookmark showing the title. An adaptive bookmark. See "Bookmarks added automatically" on page 101. 100 Copyright 2004 Nokia
Web Browser and Applications Options in the Bookmarks view (when a bookmark or folder is selected): Open, Download, Back to page, Send, Go to web address / Find bookmark, Add bookmark, Edit, Delete, Read service msgs., Disconnect, Move to folder, New folder, Mark/
Unmark, Rename, Clear cache, Details, Add to Go to, Settings, Help, and Exit. ADD BOOKMARKS MANUALLY 1 2 In the Bookmarks view, select Options > Add bookmark. Start to fill in the fields. Only the address must be defined. The default access point is assigned to the bookmark if no other one is selected. Press the * key to enter special characters such as /, ., :, and @. Press the Clear key to clear characters. Select Options > Save to save the bookmark. 3 BOOKMARKS ADDED AUTOMATICALLY When you visit a web page, your browser automatically saves a bookmark in the Adaptive Bookmarks folder (
), which is located in the list of bookmarks when you open the Web application. Adaptive bookmarks can be renamed and deleted, but they cannot be moved. To modify adaptive bookmarks settings, select Options > Preferences > Adaptive Bookmarks, and select On, Hide Folder, or Off. Browse On a browser page, new links appear underlined in blue and previously visited links in purple. Images that act as links have a blue border around them. Options when browsing: Open, Service options, Bookmarks, History, Go to web address, View image, Read service msgs., Save as bookmark, Send bookmark, Reload, Disconnect, Normal display/Vertical display, Show images, Clear cache, Save page, Find, Details, Settings, Help, and Exit. KEYS AND COMMANDS USED IN BROWSING To open a link, press the joystick. To scroll the view, use the joystick. To enter letters and numbers in a field, press the 09 keys. Press the * key to enter special characters such as /, ., :, and @. Press the Clear key to clear characters. To go to the previous page while browsing, press Back. If Back is not available, select Options > History to view a chronological list of the pages you have visited during a browsing session. The history list is cleared each time a session is closed. Nokia 6620 User Guide
Copyright 2004 Nokia
To check boxes and make selections, press the joystick. To retrieve the latest content from the server, select Options > Reload. To open a sublist of commands or actions for the currently open browser page, select Options > Service options. Press and hold the End key to disconnect from a browser service and to quit browsing. SAVE BOOKMARKS To save a bookmark while browsing, select Options > Save as bookmark. To save a bookmark received in a smart message, open the message in the Inbox in Messaging and select Options > Save to bookmarks. See "Smart messages" on page 56. VIEW SAVED PAGES Options in the Saved pages view: Open, Back to page, Reload, Delete, Read service msgs., Disconnect, Move to folder, New folder, Mark/Unmark, Rename, Clear cache, Details, Add to Go to, Settings, Help, and Exit. If you regularly browse pages containing information which doesnt change very often, you can save and then browse them when offline. To save a page, while browsing select Options >
Save page. Saved pages are indicated by the icon. In the saved pages view you can also create folders to store your saved browser pages. Folders containing saved browser pages are indicated by the view, scroll right in the Bookmarks view. In the Saved pages view, press the joystick to open a saved page. To start a connection to the browser service and to retrieve the page again, select Options > Reload. icon. To open the Saved pages Note: The phone stays online after you reload the page. Download You can download items such as ringing tones, images, operator logos, software, and video clips through the mobile browser. These items can be provided free or you can purchase them. 102 Copyright 2004 Nokia
Web Browser and Applications Once downloaded, items are handled by the respective applications on your phone
(for example, a downloaded photo will be saved in the Gallery). Note: Only install software from sources that offer adequate protection against harmful software. CLEAR THE CACHE The information or services you have accessed are stored in the cache memory of the phone. A cache is a buffer memory that is used to store data temporarily. If you have tried to access or have accessed confidential information requiring passwords
(for example, your bank account), empty the cache after each use. The information or services you have accessed are stored in the cache. To empty the cache, select Options > Clear cache. PURCHASE AN ITEM To download the item:
1 2 Carefully read all the information provided. If the online content is compatible, you can use your wallet information to make the purchase:
1 Scroll to the link and select Options > Open. Choose the appropriate option to purchase the item, for example, Buy. Select Open wallet. You will be prompted for your wallet code. See "Enter the wallet code" on page 83. Select the appropriate card category from your wallet. Select Fill in. This will upload the selected wallet information. 2 3 If the wallet does not contain all information necessary for the purchase, you will be requested to enter the remaining details manually. Note: Copyright protections may prevent some images, ringing tones, and other content from being copied, modified, transferred, or forwarded. Nokia 6620 User Guide
Copyright 2004 Nokia CHECK AN ITEM BEFORE DOWNLOADING You can see details about an item before you download it. Details about an item may include the price, a brief description, and size. 1 Scroll to the link and select Options > Open. Details about the item are displayed on your phone. If you want to continue with the downloading, press Accept, or if you want to cancel the download, press Cancel. End a connection Select Options > Disconnect, or press and hold the End key to quit browsing and to return to the standby mode. 2 Note: If you have accessed confidential information during browsing, you should clear the cache. See "Clear the cache" on page 103. Browser settings Select Options > Settings, and then select one of the following options:
Default access pointIf you want to change the default access point, press the joystick to open a list of available access points. The current default access point is highlighted. See "Connection" on page 68. Show imagesChoose if you want to view pictures when you are browsing. If you choose No, you can later load images during browsing by selecting Options > Show images. Text wrappingChoose Off if you dont want the text in a paragraph to automatically wrap, or On if you do. If text is not wrapped, the ends of lines may be truncated. Font sizeYou can choose five text sizes in the browser: Smallest, Small, Normal, Large, and Largest. Default encodingTo make sure your browser pages display text characters correctly, select one of the following: ISO8859-1 for Western European languages, ISO8859-2 for Central European languages, ISO8859-4 for Baltic languages, ISO8859-5 for Cyrillic-based languages, ISO8859-7 for Greek language, ISO8859-9 for Turkish language. Adaptive bookmarksYou can select On, Hide Folder, or Off. When you select Hide Folder, bookmarks are still added automatically to the Adaptive Bookmarks folder. See "Bookmarks added automatically" on page 101. 104 Copyright 2004 Nokia
Web Browser and Applications Full screenSelect Normal, Softkeys only, or Full screen. CookiesAllow /Reject. You can enable or disable the receiving and sending of cookies (a means of content providers to identify users and their preferences for frequently used content). Security notificationsChoose to Hide or Show security notifications. Sent DTMFAlways / First sending only. Choose whether you want to confirm before the phone sends DTMF tones during a voice call. For example, you can make a voice call while you are viewing a browser page, send DTMF tones while a voice call is in progress, and save in Contacts a name and phone number from a browser page. See "Options during a call" on page 23. WalletChoose On if you want the wallet to open automatically when a compatible browser page is opened.
CONFIGURATION MANAGER The configuration manager service helps you easily configure your phone connection settings. Configuration manager directs you to a WAP site where you select the type of connection settings you want to request (WAP, MMS, E-mail, or Internet). You enter information that the site needs to process your request, for example, your country, network (i.e., service provider), phone model (Nokia 6620), etc. Your request is then processed, and the settings are sent to you in a smart message. When you open the message, your settings are automatically configured in your phone. You must then select Options > Save settings. For more information on configuring settings in your phone, see Connection on page 68 and Set up the phone for the browser service on page 99. Note: There is no charge for using the configuration manager service, but the normal WAP connection and SMS charges do apply. Contact your service provider for details. To use the configuration manager service:
1 Select Menu > Configs. The Configurations window is displayed. Read through the Configuration info message, and select OK to continue. The Help screen is displayed. 2 Nokia 6620 User Guide
Copyright 2004 Nokia
3 4 5 Note: Selecting OK in the Configuration info message means that you acknowledge that you will not be charged for using the configuration manager service itself but that you will be charged for the WAP connection and also the incoming smart message in some cases. If you are unsure about how you are charged for these services, select Cancel on the Configuration info screen, and contact your service provider for details before proceeding any further. Read through the Help screen, and select OK. If your phone requests permission to make a connection to the server, select Yes. Your phone establishes a WAP connection to the Nokia OTA tool site. Scroll down and highlight the configuration settings you want to request (WAP, MMS, E-mail, or Internet), and press the joystick. Follow the screen prompts to enter all information that is necessary for the configuration manager service to identify the settings you need. Scroll to the different fields and buttons, and press the joystick to select screen items. The items you are prompted to define depend on whether you are requesting settings for WAP, MMS, E-mail, or Internet. The last screen prompts you to enter your mobile phone number so that the service knows where to send your settings message. 6 When you receive the settings message, simply open the message, and the settings will be automatically configured in your phone.
APPLICATION MANAGER Select Menu > Tools > App. Mngr In Application manager you can install new Symbian operating system applications
(SIS files) and Java applications (Java MIDlets and MIDlet suites). You can also update and uninstall applications from the phone and monitor the installation history. Applications in Application manager use shared memory. See "Shared memory" on page 3. Options in the Application manager main view: Install, View details, View certificate, Update, Go to web address, Remove, View log, Send log, Settings, App. downloads, Help, and Exit. 106 Copyright 2004 Nokia Web Browser and Applications When you open Application manager, you can see a list of:
Applications saved in Application manager. Partially installed applications (indicated by
). Fully installed applications that you can remove
(indicated by
). Note: You can only use Symbian operating system applications with a .SIS extension. Note: Your phone supports J2MEJava applications. Do not download PersonalJava applications to your phone;
they cannot be installed. Install applicationsgeneral information You can install applications that are specifically intended for this phone and suitable for the Symbian operating system. Note: If you install an application that is not intended specifically for this phone, it may function and look different from what was originally intended. Applications may be downloaded to your phone during browsing, received as attachments in multimedia messages or e-mails, or received by Bluetooth connection or by infrared from another device, for example a phone or a compatible PC. If you are using PC Suite to transfer the application, place it in the Installs folder in the File manager. Important: Only install applications from sources that offer adequate protection against viruses and other harmful software. To increase protection, the application installation system uses digital signatures and certificates for applications. Do not install the application if Application manager gives a security warning during installation. Important: If you install an application that contains an update or repair to an existing application, you can only restore the original application if you have the original application or a full backup copy of the removed application. To restore the original application, first remove the updated or repaired application and then install again from the original application or the backup copy. Nokia 6620 User Guide
Copyright 2004 Nokia
During installation, the phone checks the integrity of the application to be installed. The phone shows information about the checks being carried out, and you are given options on whether to continue or cancel the installation. Once the phone has checked the integrity of the application, it is installed on your phone. INSTALL APPLICATIONS Open Application manager, scroll to the application, and select Options > Install to start the installation. You can also search the phone memory or the memory card, select the application, and press the joystick to start the installation. Some applications may give the option of partial installation, allowing you to select the particular components of an application that you want to install. If you are installing an application without a digital signature or a certificate, the phone warns you of the risks. Continue installation only if you are absolutely sure of the origin and contents of the application. INSTALL JAVA APPLICATIONS The .JAR file is required for installation. If it is missing, the phone may ask you to download it. If there is no access point defined for Application manager, you will be asked to select one. When you are downloading the .JAR file, you may need to enter a user name and password to access the server. You obtain these from the supplier or manufacturer of the application. To start a data connection and to view extra information about the application, scroll to it and select Options > Go to web address. To start a data connection and check if there is an update available for the application, scroll to it and select Options > Update. JAVA SETTINGS To change the default access point that a Java application uses for downloading extra data, select Options > Settings > Access point. See "Access points" on page 68. To change the security settings that determine the actions that a Java application is permitted to do, select Options > Settings. Note: Not all Java applications permit you to change the security settings. Remove an application 1 2 Scroll to the application and select Options > Remove. Press Yes to confirm the removal. 108 Copyright 2004 Nokia
Web Browser and Applications Important: If you remove an application, you can only re-install it if you have the original application or a full backup of the removed application. If you remove an application, you may no longer be able to open documents created with that application. If another application depends on the application that you removed, the other application may stop working. Refer to the documentation of the installed application for details. Nokia 6620 User Guide
Copyright 2004 Nokia 12 Connectivity
BLUETOOTH CONNECTION Select Menu > Connect. > Bluetooth Note: There may be restrictions on using Bluetooth devices in some locations. Check with your local authorities or service provider. Note: This phone is designed to be compliant with and to adopt Bluetooth Specification 1.1. However, interoperability between the phone and other products with Bluetooth wireless technology depends also on the profiles and protocols used. For more information on the compatibility between Bluetooth devices, please consult your dealer. Bluetooth technology enables cost-free wireless connections between electronic devices within a maximum range of 10 metres. A Bluetooth connection can be used to send images, videos, texts, business cards, calendar notes, or to connect wirelessly to devices using Bluetooth technology, such as computers. Since devices using Bluetooth technology communicate using radio waves, your phone and the other devices do not need to be in direct line-of-sight. The two devices only need to be within a maximum of 10 metres of each other, although the connection can be subject to interference from obstructions such as walls or from other electronic devices. Using Bluetooth technology consumes the battery and the phones operating time will be reduced. Take this into account when performing other operations with your phone. There may be restrictions on using devices using Bluetooth technology. Check with your local authorities. When you activate a Bluetooth connection for the first time, you are asked to give a name to your phone. 110 Copyright 2004 Nokia Connectivity Bluetooth connection settings BluetoothSelect On if you want to use a Bluetooth connection. If you select Off, all active Bluetooth connections are ended, and Bluetooth connection cannot be used for sending or receiving data. My phones visibilityIf you select Shown to all, your phone can be found by other devices during device search. If you select Hidden, your phone cannot be found by other devices. My phones nameDefine a name for your phone. Note: After you have set your Bluetooth connection to be active and changed My phone's visibility to All, your phone and this name can be seen by other devices. Send data by Bluetooth connection 1 2 Note: Your phone can only have one active Bluetooth connection at a time. Open an application where the item you wish to send is stored. For example, to send a photo to another device, open the Gallery application. Scroll to the item you want to send, and select Options > Send > Via Bluetooth. The phone starts to search for devices within range. Devices using Bluetooth technology that are within range start to appear on the display one by one. You can see a device icon, the device name, the device type, or a short name. Paired devices are shown with
. A paired device is one where a Bluetooth connection already exists between your phone and the other device. To interrupt the search, press Stop. The device list freezes and you can start to form a connection to one of the devices already found. Note: When searching for devices, some devices may show only the unique device addresses. To find out the unique address of your phone, enter the code *#2820# in the standby mode. Nokia 6620 User Guide
Copyright 2004 Nokia
Note: If you have searched for devices earlier, a list of the devices that were found previously is shown first. To start a new search, select More devices. If you switch off the phone, the list of devices is cleared and the device search needs to be started again before sending data. 3 4 Scroll to the device with which you want to connect and press Select. The item you are sending is copied to Outbox and the note Connecting is shown. Pairing (if not required by the other device, go to step 5.) If the other device requires pairing before data can be transmitted, a tone sounds and you are asked to enter a passcode. Create your own passcode (1-16 characters long, numeric) and agree with the owner of the other device to use the same code. This passcode is used only once and you do not have to memorize it. After pairing, the device is saved to the Paired devices view. Note: Pairing means authentication. The users of the devices using Bluetooth technology should agree together what the passcode is, and use the same passcode for both devices in order to pair them. Devices that do not have a user interface have a preset passcode. See "Paired devices view" on page 113. 5 When the connection has been successfully established, the note Sending data is shown. Data received by Bluetooth connection can be found in the Inbox folder in Messaging. See "Inboxreceiving messages" on page 55. Icons for different devices:
Computer Phone Audio/video Bluetooth device Note: If sending fails, the message or data will be deleted. The Drafts folder in Messaging does not store messages sent by Bluetooth connection. Check the status of the Bluetooth connection is shown in the standby mode, Bluetooth connection is active. When When When is blinking, your phone is trying to connect to the other device. is shown continuously, the Bluetooth connection is active. 112 Copyright 2004 Nokia
Connectivity Paired devices view Pairing with a device makes device searches easier and quicker. Paired devices are easier to recognize; they are indicated by Bluetooth connection main view, scroll right to open a list of paired devices (
in the search result list. In the
). To pair with a device: Select Options > New paired device. The phone starts a device search. Scroll to the device with which you want to pair and press Select. After you exchange passcodes, the device is added to the Paired devices list. To cancel pairing: Scroll to the device whose pairing you want to cancel and press the Clear key or select Options > Delete. If you want to cancel all pairings, select Options > Delete all. Note: If you are currently connected to a device and you delete the pairing with that device, the pairing is removed and the device connection is terminated, but the Bluetooth connection remains active. To set a device to be authorized or unauthorized: Scroll to the device, select Options, and then select one of the following:
Set as authorizedConnections between your phone and this device can be made without your knowledge. No separate acceptance or authorization is needed. Use this status for your own devices, for example, your PC, or devices that belong to someone you trust. The icon view. Set as unauthorizedConnection requests from this device need to be accepted separately every time. is added next to authorized devices in the Paired devices Receive data by Bluetooth connection When you receive data by Bluetooth connection, a tone is played, and you are asked if you want to accept the message. If you accept, the item is placed in the Inbox folder in Messaging. Messages received by Bluetooth connection are indicated by Close the Bluetooth connection A Bluetooth connection is disconnected automatically after sending or receiving data. See "Inboxreceiving messages" on page 55.
INFRARED CONNECTION Select Menu > Connect. > Infrared Nokia 6620 User Guide
Copyright 2004 Nokia
By infrared, you can send or receive data such as business cards and calendar notes to and from a compatible phone or data device. Do not point the IR (infrared) beam at anyones eye or allow it to interfere with other IR devices. This device is a Class 1 laser product. Note: Making or answering phone calls during a computer connection is not recommended because it might disrupt the operation. Send and receive data by infrared All items that are received by infrared are placed in the Inbox folder in Messaging. New infrared messages are indicated by
. See "Inboxreceiving messages" on page 55. 1 Make sure that the infrared ports of the sending and receiving devices are pointing at each other and that there are no obstructions between the devices. The preferable distance between the two devices is one meter at most. To find the infrared port, see Nokia 6620 phone at a glance on page v. The user of the receiving device activates the infrared port. To activate your phone infrared port to receive data, select Menu >
Connect. > Infrared and press the joystick. The user of the sending device selects the desired infrared function to start data transfer. To send data by infrared, select Options > Send > Infrared in an application. If data transfer is not started within one minute after the activation of the infrared port, the connection is cancelled and must be started again. 2 3 Note: When using Windows 2000 and you want to use infrared to transfer files between your phone and a compatible computer, select Control Panel and select Wireless Link. In the Wireless Link File Transfer tab, check the box for Allow others to send files to your computer using infrared. Check the status of the infrared connection When connection has been lost. When is ready to send and receive data by its infrared port. blinks, your phone is trying to connect to the other device or a is shown continuously, the infrared connection is active and your phone 114 Copyright 2004 Nokia Connectivity
USB CONNECTION If you use the DKU-2 data cable, connect the cable to the USB port on your computer and to the connector on your phone. Start using the data communications application on the computer. Note: Making or answering phone calls during a computer connection is not recommended because it might disrupt the operation.
CONNECTION MANAGER Select Menu > Connect. > Connection manager In Connection manager you can identify the status of multiple data connections, view details on the amount of data sent and received, for example, and end unused connections. Note: You can view details of data connections only. Voice calls are not listed. When you open Connection manager, you can see a list of:
Open data connections:
Data call GPRS The status of each connection. Amount of data uploaded and downloaded for each connection (GPRS connections only). The duration of each connection (GSM and high-speed data connections only). Note: The actual time invoiced for calls by your service provider may vary, depending upon network features, rounding-off for billing, and so forth. Options in the Connection manager main view when there are one or more connections: Details, Disconnect, Disconnect all, Help, and Exit. View connection details To view the details of a connection, scroll to a connection and select Options >
Details. The following information is displayed:
NameThe name of the Internet access point (IAP) in use, or Modem connection if the connection is a dial-up connection. Nokia 6620 User Guide
Copyright 2004 Nokia
BearerThe type of data connection: Data call, High sp. GSM, or GPRS. StatusThe current status of the connection. ReceivedThe amount of data, in bytes, received to the phone. SentThe amount of data, in bytes, sent from the phone. DurationThe length of time that the connection has been open. SpeedThe current speed of both sending and receiving data in kB/s (kilobytes per second). Dial-up (GSM)The dial-up number used, or Name (GPRS)access point name used. Shared (not displayed if the connection is not shared)The number of applications using the same connection. End connections Scroll to a connection and select Options > Disconnect to end that connection only, or select Options > Disconnect all to close all currently open connections.
CONNECT YOUR PHONE TO A COMPATIBLE COMPUTER For further information on how to make a connection to a compatible computer by infrared, USB, or Bluetooth connection, and how to install PC Suite, see the Installation Guide for PC Suite on the CD-ROM in the Install section. For further information on how to use PC Suite, see the help function on PC suite. Use the CD-ROM The CD-ROM should launch itself after you have inserted it into the CD-ROM drive of your compatible PC. If not, proceed as follows:
1 2 Click the Window Start button and select Programs > Windows Explorer. On the CD-ROM drive, locate a file called setup.exe and double-click it. The CD-ROM interface opens. You can find PC Suite in the Install section. Double-click PC Suite for Nokia 6620. The installation wizard will guide you through the installation process. 3 Use your phone as a modem Use your phone as a modem to connect to the Internet with a compatible PC, or to send and receive faxes. Select Menu >
Connect. > Modem. 116 Copyright 2004 Nokia
Detailed instructions can be found in Quick Guide for Modem Options for Nokia 6620 on the CD-ROM supplied with the phone.
SYNCREMOTE SYNCHRONIZATION Connectivity Select Menu > Sync. The Sync application enables you to synchronize your calendar or contacts with various calendar and address book applications on a compatible computer or on the Internet. Synchronization takes place over a GSM data call or packet data connection. The synchronization application uses SyncML technology for synchronization. For information on SyncML compatibility, please contact the supplier of the calendar or address book application with which you want to synchronize your phone data. Create a new synchronization profile Options in the Sync main view: Synchronize, New sync profile, Edit sync profile, Delete, View log, Help, and Exit. 1 If no profiles have been defined, the phone asks you if you want to create a new profile. Select Yes. To create a new profile in addition to existing ones, select Options > New sync profile. Choose whether you want to use the default setting values or copy the values from an existing profile to be used as the basis for the new profile. Define the following:
Sync profile nameWrite a descriptive name for the profile. Access pointSelect the access point you want to use for the data connection. Host addressContact your service provider or system administrator for the correct values. PortContact your service provider or system administrator for the correct values. User nameYour user ID for the synchronization server. Contact your service provider or system administrator for your correct ID. PasswordWrite your password. Contact your service provider or system 2 Nokia 6620 User Guide
Copyright 2004 Nokia 3 administrator for the correct value. Scroll right to select:
CalendarSelect Yes if you want to synchronize your calendar. Remote calendarEnter a correct path to the remote calendar on the server. Must be defined if the previous setting Calendar has been set to Yes. ContactsSelect Yes if you want to synchronize your contacts. Remote contactsEnter a correct path to the remote address book on the server. It must be defined if the previous setting Contacts has been set to Yes. Press Done to save the settings. 4 Synchronize data In the Sync main view, you can see the different profiles, and what kind of data will be synchronized: Calendar, Contacts, or both. 1 In the main view, scroll to a profile and select Options > Synchronize. The status of the synchronization is shown at the bottom of the screen. To cancel synchronization before it is finished, press Cancel. You are notified when the synchronization has been completed. After synchronization is complete, press View log, or select Options > View log to open a log file showing the synchronization status (Complete or Incomplete) and how many calendar or contact entries have been added, updated, deleted, or discarded (not synchronized) in the phone or on the server. 2 118 Copyright 2004 Nokia Troubleshooting 13 Troubleshooting
SIM CARD A SIM (Subscriber Identity Module) card is required for your Nokia GSM phone to operate. The SIM card is supplied by your service provider and has your mobile phone number and all subscriber account information programmed on it. You can save contact information from your Contacts list on the SIM card so that when you use the SIM card in another GSM phone or terminal, your phone number and contacts will be available to you on the SIM card rather than stored in phone memory. The SIM card in the Nokia 6620 phone is located under the battery in the top left corner. The SIM card must be inserted under the hood and the gold contacts on the card must make direct contact with the gold contacts in the card slot. See Insert the SIM card on page 9.
MEMORY LOW When one of the following notes is shown, the phone memory is low and you must delete some data: Not enough memory to perform operation. Delete some data first. or Memory low. Delete some data. To view what kind of data you have and how much memory the different data groups consume, select Tools > File Mngr >
Options > Memory details. You may want to delete the following items regularly to avoid memory getting low:
Messages from the Inbox, Drafts, and Sent folders in Messaging. Retrieved e-mail messages from the phone memory. Saved browser pages. Images, video clips, and sound clips in the Gallery. If you want to delete contact information, calendar notes, call timers, call cost timers, game scores, or any other data, go to the respective application to remove the data. If you are deleting multiple items and one of the following notes is shown again:
Not enough memory to perform operation. Delete some data first. or Memory low. Delete some data., try deleting items one by one (starting from the smallest item). Nokia 6620 User Guide
Copyright 2004 Nokia
Clear calendar memory To remove more than one event at a time, go to the Month view and select Options > Delete entry and one of the following:
Before dateTo delete all calendar notes which take place before a certain date. Enter the date before which all calendar notes will be deleted. All entriesTo delete all calendar notes. Erase log information To erase all the log contents, Recent calls register, and Messaging delivery reports permanently, go to Logs, scroll right, and select Options > Clear log or select Settings > Log duration > No log.
DIFFERENT WAYS TO STORE DATA Use PC Suite to make a backup copy of all data to your computer. See "Connect your phone to a compatible computer" on page 116. Send images to your e-mail address and then save the images to your computer. Send data by infrared or Bluetooth connection to another compatible device. Store data on a compatible memory card.
Q&A Phone display Q. Why do missing, discolored or bright dots appear on the screen every time I turn on my phone?
This is a characteristic of this type of display. Some displays may contain pixels or dots that remain on or off. This is normal, not a fault. A. Camera Q. Why do images look smudgy?
A. Check that the camera lens protection window is clean. See "Care and maintenance" on page 128. 120 Copyright 2004 Nokia
Troubleshooting Bluetooth connection Q. Why cant I end a Bluetooth connection?
A. If another device is pairing with your phone but not sending data, and leaves the device connection open, then the only way to disconnect it is to deactivate the Bluetooth link altogether. Select Menu > Connect. > Bluetooth and select the setting Bluetooth > Off. Q. Why cant I find a device using Bluetooth technology. A. Check that both have activated their Bluetooth connections. Check that the distance between the two devices is not over 10 meters or that there are no walls or other obstructions between the devices. Check that the other device is not in Hidden mode. Check that both devices are compatible. Multimedia messaging Q. What should I do when the phone tells me that it cannot receive a multimedia message because memory is full?
The amount of memory needed is indicated in the error message: Not enough memory to retrieve message. Delete some data first. To view what kind of data you have and how much memory the different data groups consume, select Tools > File Mngr > Options > Memory details. Q. How can I end the data connection when the phone starts a data connection again and again? The notes: Retrieving message or Trying to retrieve message again are shown briefly. What is happening?
The phone is trying to retrieve a multimedia message from the multimedia messaging center. Check that the settings for multimedia messaging have been defined correctly and that there are no mistakes in phone numbers or addresses. Select Messaging > Options > Settings > Multimedia message. To stop the phone from making a data connection, you have the following options. Select Messaging and select Options > Settings > Multimedia message, and then:
Select On receiving msg. > Defer retrieval if you want the multimedia messaging center to save the message to be retrieved later, for example, after you have checked the settings. After this change, the phone still needs to send information notes to the network. When you want to retrieve the message, select Retr. immediately. Select On receiving msg. > Reject message if you want to reject all incoming A. A. Nokia 6620 User Guide
Copyright 2004 Nokia multimedia messages. After this change, the phone needs to send information notes to the network and the multimedia messaging center will delete all multimedia messages that are waiting to be sent to you. Select Multimedia reception > Off if you want to ignore all incoming multimedia messages. After this change the phone will not make any network connections related to multimedia messaging. Messaging Q. Why cant I select a contact?
A. If you cannot select a contact in the Contacts directory, the contact card does not have a phone number or an e-mail address. Add the missing information to the contact card in the Contacts application. Calendar Q. Why are the week numbers missing?
A. If you have changed the Calendar settings so that the week starts on a day other than Monday, then the week numbers will not be shown. Browser services Q. No valid access point defined. Define one in Web settings. A. Insert the proper browser settings. Contact your service provider for instructions. Log Q. Why does the log appear empty?
A. You may have activated a filter, and no communication events fitting that filter have been logged. To see all events in Logs, select Options > Filter > All communication. PC connectivity Q. Why do I have problems in connecting the phone to my PC?
A. Make sure that PC Suite is installed and running on your PC. See the Installation guide for PC Suite on the CD-ROM in the Install section. For further information on how to use PC Suite, see the help function of PC suite. Security codes Q. What is my password for the lock code, PIN code, or PUK code?
A. The default lock code is 12345. If you forget or lose the lock code, contact your phone dealer. 122 Copyright 2004 Nokia Troubleshooting If you forget or lose a PIN or PUK code or if you have not received such a code, contact your service provider. For information about passwords, contact your access point provider, for example, a commercial Internet service provider (ISP), service provider, or network operator. Application not responding Q. How do I close an application that is not responding?
A. Open the application switching window by pressing and holding the Menu key. Then scroll to the application, and press the Clear key to close the application. Nokia 6620 User Guide
Copyright 2004 Nokia 14 Reference information
BATTERY INFORMATION Your device is powered by a rechargeable battery. The full performance of a new battery is achieved only after two or three complete charge and discharge cycles. The battery can be charged and discharged hundreds of times but it will eventually wear out. When the talk and standby times are noticeably shorter than normal, buy a new battery. Use only Nokia approved batteries, and recharge your battery only with Nokia approved chargers designated for this device. Unplug the charger from the electrical plug and the device when not in use. Do not leave the battery connected to a charger. Overcharging may shorten its lifetime. If left unused, a fully charged battery will lose its charge over time. Temperature extremes can affect the ability of your battery to charge. Use the battery only for its intended purpose. Never use any charger or battery that is damaged. Do not short-circuit the battery. Accidental short-circuiting can occur when a metallic object such as a coin, clip, or pen causes direct connection of the positive
(+) and negative (-) terminals of the battery. (These look like metal strips on the battery.) This might happen, for example, when you carry a spare battery in your pocket or purse. Short-circuiting the terminals may damage the battery or the connecting object. Leaving the battery in hot or cold places, such as in a closed car in summer or winter conditions, will reduce the capacity and lifetime of the battery. Always try to keep the battery between 59F and 77F (15C and 25C). A device with a hot or cold battery may not work temporarily, even when the battery is fully charged. Battery performance is particularly limited in temperatures well below freezing. Do not dispose of batteries in a fire! Dispose of batteries according to local regulations. Please recycle when possible. Do not dispose as household waste.
ENHANCEMENTS A few practical rules about accessories and enhancements:
Keep all accessories and enhancements out of the reach of small children. When you disconnect the power cord of any accessory or enhancement, grasp and pull the plug, not the cord. Check regularly that enhancements installed in a vehicle are mounted and are operating properly. 124 Copyright 2004 Nokia
Installation of any complex car enhancements must be made by qualified personnel only. Reference information
ENHANCEMENTS, BATTERIES, AND CHARGERS Check the model number of any charger before use with this device. This device is intended for use when supplied with power from ACP-12U or LCH-12. Warning: Use only batteries, chargers, and enhancements approved by Nokia for use with this particular model. The use of any other types may invalidate any approval or warranty, and may be dangerous. For availability of approved enhancements, please check with your dealer. When you disconnect the power cord of any enhancement, grasp and pull the plug, not the cord. Your device and its enhancements may contain small parts. Keep them out of reach of small children. Battery The 850 mAh, Li-Ion based BL-5C battery provides power in a thin and light package. It provides a talk time of up to 24 hours and up to 150200 hours standby time. Charging time is 1 hour and 35 minutes. Variation in operation times will occur depending on SIM card, network and usage settings, usage style and environments. Talk time is reduced by 5 percent if Enhanced Full Rate is active, and increased by up to 30 percent if Half Rate is active. Nokia 6620 User Guide
Copyright 2004 Nokia
Chargers The Nokia 6620 uses the ACP-12U standard charger and mobile chargers LCH-9 and LCH-12. The LCH-12 mobile charger can be used with 12 Vdc or 24 Vdc. The Nokia 3620 and Nokia 3660 phones are also compatible with the ACP-12U and ACP-8U travel chargers. ACP-12U Other compatible enhancements Headset audio Standard headset (HS-5) Stereo headset (HDS-3) Retractable headset (HS-10) Boom headset (HDB-4) FM radio headset (HS-2R)
Wireless Headsets (HDW-2 and HS-3W) Inductive loopset (LPS-4) (See Inductive Loopset LPA-4 on page 127.) Phone adapter (HDA-10) (See Phone Adapter HDA-10 on page 127.) Car
Mobile charger (LCH-12)
Mobile holder (MBC-19)
Wireless Car Kit (CK-1W) Headrest Handsfree (BHF-3) Data Connectivity cable (DKU-2)
Memory card 128 MB (DTS-128) Imaging Nokia Image Viewer (SU-2) Picture Frame (SU-4) Nokia Digital Pen (SU-1B) 126 Copyright 2004 Nokia
Reference information INDUCTIVE LOOPSET LPA-4 The LPA-4 Loopset gives people with T-coil equipped hearing aids the ability to make and receive calls without noise interference. The Loopset is easy to use and gives hearing-impaired users clear access to digital telephony. You wear the Loopset around your neck, connect it to your phone, and speak directly toward the microphone. If you are using a Loopset, you must activate it on your mobile phone by selecting Menu > Tools > Settings >
Enhancement > Enhancement in use > Loopset. Note: The Loopset can be purchased separately as an enhancement. For operating instructions, refer to the booklet that comes with the LPA-4. For more information, see Accessibility solutions on page 6. PHONE ADAPTER HDA-10 The HDA-9 Phone Adapter is a Nokia enhancement that allows you to connect your mobile phone to a Telecommunications Device for the Deaf (TTY/TDD) to make a call in digital mode. If you are using a Phone Adapter, you must activate it on your mobile phone by selecting Menu > Tools > Settings > Enhancement > Enhancement in use >
TTY. In addition to the Nokia 6620 phone, youll need the following for TTY/TDD communication:
18 in. A TTY/TDD device that is cellular ready or cellular compatible A cable for connecting the TTY/TDD to your phone, usually supplied by the manufacturer of the TTY/TDD device The Phone Adapter (HDA-10), which can be purchased separately as an accessory at www.nokia.com For more information, see Accessibility solutions on page 6. Nokia 6620 User Guide
Copyright 2004 Nokia
CARE AND MAINTENANCE Your device is a product of superior design and craftsmanship and should be treated with care. The suggestions below will help you protect your warranty coverage and enjoy your device for many years. Keep the device dry. Precipitation, humidity, and all types of liquids or moisture can contain minerals that will corrode electronic circuits. If your device does get wet, remove the battery and allow the device to dry completely before replacing it. Do not use or store the device in dusty, dirty areas. Its moving parts and electronic components can be damaged. Do not store the device in hot areas. High temperatures can shorten the life of electronic devices, damage batteries, and warp or melt certain plastics. Do not store the device in cold areas. When the device returns to its normal temperature, moisture can form inside the device and damage electronic circuit boards. Do not attempt to open the device other than as instructed in this guide. Do not drop, knock, or shake the device. Rough handling can break internal circuit boards and fine mechanics. Do not use harsh chemicals, cleaning solvents, or strong detergents to clean the device. Do not paint the device. Paint can clog the moving parts and prevent proper operation. Use a soft, clean, dry cloth to clean any lenses (such as camera, proximity sensor, and light sensor lenses). Use only the supplied or an approved replacement antenna. Unauthorized antennas, modifications, or attachments could damage the device and may violate regulations governing radio devices. All of the above suggestions apply equally to your device, battery, charger, or any enhancement. If any device is not working properly, take it to the nearest authorized service facility for service.
ADDITIONAL SAFETY INFORMATION Operating environment Remember to follow any special regulations in force in any area and always switch off your device when its use is prohibited or when it may cause interference or danger. Use the device only in its normal operating positions. To maintain 128 Copyright 2004 Nokia
Reference information compliance with radio frequency exposure guidelines only use accessories approved by Nokia for use with this device. When the device is on and being worn on the body, always use an approved carrying case. Parts of the device are magnetic. Metallic materials may be attracted to the device, and persons with a hearing aid should not hold the device to the ear with the hearing aid. Always secure the device in its holder, because metallic materials may be attracted by the earpiece. Do not place credit cards or other magnetic storage media near the device, because information stored on them may be erased. Medical devices Operation of any radio transmitting equipment, including wireless phones, may interfere with the functionality of inadequately protected medical devices. Consult a physician or the manufacturer of the medical device to determine if they are adequately shielded from external RF energy or if you have any questions. Switch off your phone in health care facilities when any regulations posted in these areas instruct you to do so. Hospitals or health care facilities may be using equipment that could be sensitive to external RF energy. PACEMAKERS Pacemaker manufacturers recommend that a minimum separation of 6 in
(15.3 cm) be maintained between a wireless phone and a pacemaker to avoid potential interference with the pacemaker. These recommendations are consistent with the independent research by and recommendations of Wireless Technology Research. To minimize the potential for interference, persons with pacemakers should Always keep the device more than 6 in (15.3 cm) from their pacemaker when the device is switched on Not carry the device in a breast pocket Hold the device to the ear opposite the pacemaker If you have any reason to suspect that interference is taking place, switch off your device immediately. HEARING AID Some digital wireless devices may interfere with some hearing aids. If interference occurs, consult your service provider. Vehicles RF signals may affect improperly installed or inadequately shielded electronic systems in motor vehicles such as electronic fuel injection systems, electronic antiskid (antilock) braking systems, electronic speed control systems, air bag systems. For more information, check with the manufacturer or its representative of your vehicle or any equipment that has been added. Nokia 6620 User Guide
Copyright 2004 Nokia
Only qualified personnel should service the device, or install the device in a vehicle. Faulty installation or service may be dangerous and may invalidate any warranty that may apply to the device. Check regularly that all wireless device equipment in your vehicle is mounted and operating properly. Do not store or carry flammable liquids, gases, or explosive materials in the same compartment as the device, its parts, or enhancements. For vehicles equipped with an air bag, remember that an air bags inflate with great force. Do not place objects, including installed or portable wireless equipment in the area over the air bag or in the air bag deployment area. If in-vehicle wireless equipment is improperly installed and the air bag inflates, serious injury could result. Potentially explosive environments Switch off your device when in any area with a potentially explosive atmosphere and obey all signs and instructions. Potentially explosive atmospheres include areas where you would normally be advised to turn off your vehicle engine. Sparks in such areas could cause an explosion or fire resulting in bodily injury or even death. Switch off the device at refuelling points such as near gas pumps at service stations. Observe restrictions on the use of radio equipment in fuel depots, storage, and distribution areas, chemical plants or where blasting operations are in progress. Areas with a potentially explosive atmosphere are often but not always clearly marked. They include below deck on boats, chemical transfer or storage facilities, vehicles using liquefied petroleum gas (such as propane or butane), and areas where the air contains chemicals or particles such as grain, dust or metal powders. FCC regulations prohibit using your wireless device while in the air. The use of wireless telephones in an aircraft may be dangerous to the operation of the aircraft, disrupt the wireless telephone network, and may be illegal. Failure to observe these instructions may lead to suspension or denial of telephone services to the offender, legal action, or both.
EMERGENCY CALLS Important:Wireless phones, including this phone, operate using radio signals, wireless networks, landline networks, and user-programmed functions. Because of this, connections in all conditions cannot be guaranteed. You should never rely solely on any wireless phone for essential communications like medical emergencies. To make an emergency call:
1 If the phone is not on, switch it on. Check for adequate signal strength. Some networks may require that a valid SIM card is properly inserted in the phone. Press the End key as many times as needed to clear the display and ready the 2 130 Copyright 2004 Nokia Reference information 3 phone for calls. Key in the official emergency number for your present location. Emergency numbers vary by location. Press the Send key. 4 If certain features are in use, you may first need to turn those features off before you can make an emergency call. Consult this guide or your service provider. When making an emergency call, give all the necessary information as accurately as possible. Your wireless phone may be the only means of communication at the scene of an accident. Do not end the call until given permission to do so.
CERTIFICATION INFORMATION (SAR) THIS MODEL PHONE MEETS THE GOVERNMENTS REQUIREMENTS FOR EXPOSURE TO RADIO WAVES. Your wireless phone is a radio transmitter and receiver. It is designed and manufactured not to exceed the emission limits for exposure to radio frequency
(RF) energy set by the Federal Communications Commission of the U.S. Government. These limits are part of comprehensive guidelines and establish permitted levels of RF energy for the general population. The guidelines are based on standards that were developed by independent scientific organizations through periodic and thorough evaluation of scientific studies. The standards include a substantial safety margin designed to assure the safety of all persons, regardless of age and health. The exposure standard for wireless mobile phones employs a unit of measurement known as the Specific Absorption Rate, or SAR. The SAR limit set by the FCC is 1.6W/kg.* Tests for SAR are conducted using standard operating positions accepted by the FCC with the phone transmitting at its highest certified power level in all tested frequency bands. Although the SAR is determined at the highest certified power level, the actual SAR level of the phone while operating can be well below the maximum value. This is because the phone is designed to operate at multiple power levels so as to use only the power required to reach the network. In general, the closer you are to a wireless base station antenna, the lower the power output. Before a phone model is available for sale to the public, it must be tested and certified to the FCC that it does not exceed the limit established by the government-adopted requirement for safe exposure. The tests are performed in positions and locations (for example, at the ear and worn on the body) as required by the FCC for each model. Nokia 6620 User Guide
Copyright 2004 Nokia The highest SAR value for this model phone as reported to the FCC when tested for use at the ear is 1.06 W/kg, and when worn on the body, as described in this user guide, is 1.22 W/kg. (Body-worn measurements differ among phone models, depending upon available enhancements and FCC requirements). While there may be differences between the SAR levels of various phones and at various positions, they all meet the government requirement. The FCC has granted an Equipment Authorization for this model phone with all reported SAR levels evaluated as in compliance with the FCC RF exposure guidelines. SAR information on this model phone is on file with the FCC and can be found under the Display Grant section of http://www.fcc.gov/oet/fccid after searching on FCC ID QURNHL-12. For body worn operation, this phone has been tested and meets the FCC RF exposure guidelines for use with a carry case, belt clip, or holder that contains no metal and that positions the handset a minimum of 5/8 inch (1.5 cm) from the body. Use of other carry cases, belt clips, or holders may not ensure compliance with FCC RF exposure guidelines. If you do not use a body-worn accessory and are not holding the phone at the ear, position the handset a minimum of 5/8 inch
(1.5 cm) from your body when the phone is switched on.
*In the United States and Canada, the SAR limit for mobile phones used by the public is 1.6 watts/kilogram (W/kg) averaged over one gram of tissue. The standard incorporates a substantial margin of safety to give additional protection for the public and to account for any variations in measurements. SAR values may vary depending on national reporting requirements and the network band. For SAR information in other regions please look under product information at www.nokia.com. 132 Copyright 2004 Nokia
NOKIA 6620 TECHNICAL INFORMATION Reference information Feature Weight Size Frequency Range Transmitter Output Power Specification 4.4 oz (124 g) with 900-mAh Li-lon battery 117 cc Lowband 850 824849 MHz (TX) 869894 MHz (RX) Highband 1800 17101785 MHz (TX) 18051880 MHz (RX) Highband 1900 18501910 MHz (TX) 19301990 MHz (RX) Lowband up to 2 W Highband up to 1 W Battery Voltage 3.7 V nominal Operating Temperature 14F to + 131F
(-10C to + 55C) Memory Locations Up to Nokia 6620 User Guide
Copyright 2004 Nokia 134 Copyright 2004 Nokia
Nokia ONE-YEAR LIMITED WARRANTY 2 3 4 5 6 7 Nokia Inc. (Nokia) warrants that this cellular phone (Product) is free from defects in material and workmanship that result in Product failure during normal usage, according to the following terms and conditions:
1 The limited warranty for the Product extends for ONE (1) year beginning on the date of the purchase of the Product. This one year period is extended by each whole day that the Product is out of your possession for repair under this warranty. The limited warranty extends only to the original purchaser (Consumer) of the Product and is not assignable or transferable to any subsequent purchaser/
end-user. The limited warranty extends only to Consumers who purchase the Product in the United States of America. During the limited warranty period, Nokia will repair, or replace, at Nokias sole option, any defective parts, or any parts that will not properly operate for their intended use with new or refurbished replacement items if such repair or replacement is needed because of product malfunction or failure during normal usage. No charge will be made to the Consumer for any such parts. Nokia will also pay for the labor charges incurred by Nokia in repairing or replacing the defective parts. The limited warranty does not cover defects in appearance, cosmetic, decorative or structural items, including framing, and any non-
operative parts. Nokias limit of liability under the limited warranty shall be the actual cash value of the Product at the time the Consumer returns the Product for repair, determined by the price paid by the Consumer for the Product less a reasonable amount for usage. Nokia shall not be liable for any other losses or damages. These remedies are the Consumers exclusive remedies for breach of warranty. Upon request from Nokia, the Consumer must prove the date of the original purchase of the Product by a dated bill of sale or dated itemized receipt. The Consumer shall bear the cost of shipping the Product to Nokia in Melbourne, Florida. Nokia shall bear the cost of shipping the Product back to the Consumer after the completion of service under this limited warranty. The Consumer shall have no coverage or benefits under this limited warranty if any of the following conditions are applicable:
a) The Product has been subjected to abnormal use, abnormal conditions, improper storage, exposure to moisture or dampness, unauthorized modifications, unauthorized connections, unauthorized repair, misuse, neglect, abuse, accident, alteration, improper installation, or other acts which are not the fault of Nokia, including damage caused by shipping. The Product has been damaged from external causes such as collision b) Nokia 6620 User Guide
Copyright 2004 Nokia with an object, or from fire, flooding, sand, dirt, windstorm, lightning, earthquake or damage from exposure to weather conditions, an Act of God, or battery leakage, theft, blown fuse, or improper use of any electrical source, damage caused by computer or internet viruses, bugs, worms, Trojan Horses, cancelbots or damage caused by the connection to other products not recommended for interconnection by Nokia. c) Nokia was not advised in writing by the Consumer of the alleged defect d) e) or malfunction of the Product within fourteen (14) days after the expiration of the applicable limited warranty period. The Product serial number plate or the enhancement data code has been removed, defaced or altered. The defect or damage was caused by the defective function of the cellular system or by inadequate signal reception by the external antenna, or viruses or other software problems introduced into the Product. 8 Nokia does not warrant uninterrupted or error-free operation of the Product. If a problem develops during the limited warranty period, the Consumer shall take the following step-by-step procedure:
a) The Consumer shall return the Product to the place of purchase for repair or replacement processing. If a is not convenient because of distance (more than 50 miles) or for other good cause, the Consumer shall ship the Product prepaid and insured to:
Nokia Inc., Attn: Repair Department 795 West Nasa Blvd. Melbourne, FL 32901 The Consumer shall include a return address, daytime phone number and/
or fax number, complete description of the problem, proof of purchase and service agreement (if applicable). Expenses related to removing the Product from an installation are not covered under this limited warranty. The Consumer will be billed for any parts or labor charges not covered by this limited warranty. The Consumer will be responsible for any expenses related to reinstallation of the Product. b) c) d) e) Nokia will repair the Product under the limited warranty within 30 days after receipt of the Product. If Nokia cannot perform repairs covered under this limited warranty within 30 days, or after a reasonable number of attempts to repair the same defect, Nokia at its option, will provide a replacement Product or refund the purchase price of the Product less a reasonable amount for usage. In some states the Consumer may have the right to a loaner if the repair of the Product takes more than ten (10) days. Please contact the Customer Service Center at Nokia at the telephone 136 Copyright 2004 Nokia f) number listed at the end of this warranty if you need a loaner and the repair of the Product has taken or is estimated to take more than ten (10) days. If the Product is returned during the limited warranty period, but the problem with the Product is not covered under the terms and conditions of this limited warranty, the Consumer will be notified and given an estimate of the charges the Consumer must pay to have the Product repaired, with all shipping charges billed to the Consumer. If the estimate is refused, the Product will be returned freight collect. If the Product is returned after the expiration of the limited warranty period, Nokias normal service policies shall apply and the Consumer will be responsible for all shipping charges. 9 You (the Consumer) understand that the product may consist of refurbished equipment that contains used components, some of which have been reprocessed. The used components comply with Product performance and reliability specifications. 10 ANY IMPLIED WARRANTY OF MERCHANTABILITY, OR FITNESS FOR A PARTICULAR PURPOSE OR USE, SHALL BE LIMITED TO THE DURATION OF THE FOREGOING LIMITED WRITTEN WARRANTY. OTHERWISE, THE FOREGOING LIMITED WARRANTY IS THE CONSUMERS SOLE AND EXCLUSIVE REMEDY AND IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESS OR IMPLIED. NOKIA SHALL NOT BE LIABLE FOR SPECIAL, INCIDENTAL, PUNITIVE OR CONSEQUENTIAL DAMAGES, INCLUDING BUT NOT LIMITED TO LOSS OF ANTICIPATED BENEFITS OR PROFITS, LOSS OF SAVINGS OR REVENUE, LOSS OF DATA, PUNITIVE DAMAGES, LOSS OF USE OF THE PRODUCT OR ANY ASSOCIATED EQUIPMENT, COST OF CAPITAL, COST OF ANY SUBSTITUTE EQUIPMENT OR FACILITIES, DOWNTIME, THE CLAIMS OF ANY THIRD PARTIES, INCLUDING CUSTOMERS, AND INJURY TO PROPERTY, RESULTING FROM THE PURCHASE OR USE OF THE PRODUCT OR ARISING FROM BREACH OF THE WARRANTY, BREACH OF CONTRACT, NEGLIGENCE, STRICT TORT, OR ANY OTHER LEGAL OR EQUITABLE THEORY, EVEN IF NOKIA KNEW OF THE LIKELIHOOD OF SUCH DAMAGES. NOKIA SHALL NOT BE LIABLE FOR DELAY IN RENDERING SERVICE UNDER THE LIMITED WARRANTY, OR LOSS OF USE DURING THE PERIOD THAT THE PRODUCT IS BEING REPAIRED. Nokia 6620 User Guide
Copyright 2004 Nokia 11 Some states do not allow limitation of how long an implied warranty lasts, so the one year warranty limitation may not apply to you (the Consumer). Some states do not allow the exclusion or limitation of incidental and consequential damages, so certain of the above limitations or exclusions may not apply to you (the Consumer). This limited warranty gives the Consumer specific legal rights and the Consumer may also have other rights which vary from state to state. 12 Nokia neither assumes nor authorizes any authorized service center or any other person or entity to assume for it any other obligation or liability beyond that which is expressly provided for in this limited warranty including the provider or seller of any extended warranty or service agreement. 13 This is the entire warranty between Nokia and the Consumer, and supersedes all prior and contemporaneous agreements or understandings, oral or written, relating to the Product, and no representation, promise or condition not contained herein shall modify these terms. 14 This limited warranty allocates the risk of failure of the Product between the Consumer and Nokia. The allocation is recognized by the Consumer and is reflected in the purchase price. 15 Any action or lawsuit for breach of warranty must be commenced within eighteen (18) months following purchase of the Product. 16 Questions concerning this limited warranty may be directed to:
Nokia Inc. Attn: Customer Service 7725 Woodland Center Blvd., Ste. 150 Tampa, FL 33614 Telephone: 1-888-NOKIA-2U (1-888-665-4228) Facsimile: (813) 287-6612 TTY/TDD Users Only: 1-800-24-NOKIA (1-800-246-6542) 17 The limited warranty period for Nokia supplied attachments and accessories is specifically defined within their own warranty cards and packaging. 138 Copyright 2004 Nokia Appendix A Message from the CTIA
(Cellular Telecommunications
& Internet Association) to all users of mobile phones.
&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ$OO5LJKWV
5HVHUYHG&RQQHFWLFXW$YHQXH1:6XLWH:DVKLQJWRQ'&
3KRQH
[ 139 ]
6DIHW\LVWKHPRVWLPSRUWDQWFDOO\RXZLOOHYHUPDNH
A Guide to Safe and Responsible Wireless Phone Use 7HQVRIPLOOLRQVRISHRSOHLQWKH86WRGD\WDNHDGYDQWDJHRIWKHXQLTXH
FRPELQDWLRQRIFRQYHQLHQFHVDIHW\DQGYDOXHGHOLYHUHGE\WKHZLUHOHVVWHOHSKRQH
4XLWHVLPSO\WKHZLUHOHVVSKRQHJLYHVSHRSOHWKHSRZHUIXODELOLW\WRFRPPXQLFDWH
E\YRLFHDOPRVWDQ\ZKHUHDQ\WLPHZLWKWKHERVVZLWKDFOLHQWZLWKWKHNLGV
ZLWKHPHUJHQF\SHUVRQQHORUHYHQZLWKWKHSROLFH(DFK\HDU$PHULFDQVPDNH
ELOOLRQVRIFDOOVIURPWKHLUZLUHOHVVSKRQHVDQGWKHQXPEHUVDUHUDSLGO\JURZLQJ
%XWDQLPSRUWDQWUHVSRQVLELOLW\DFFRPSDQLHVWKRVHEHQHILWVRQHWKDWHYHU\ZLUHOHVV
SKRQHXVHUPXVWXSKROG:KHQGULYLQJDFDUGULYLQJLV\RXUILUVWUHVSRQVLELOLW\$
ZLUHOHVVSKRQHFDQEHDQLQYDOXDEOHWRROEXWJRRGMXGJPHQWPXVWEHH[HUFLVHGDW
DOOWLPHVZKLOHGULYLQJDPRWRUYHKLFOHZKHWKHURQWKHSKRQHRUQRW
7KHEDVLFOHVVRQVDUHRQHVZHDOOOHDUQHGDVWHHQDJHUV'ULYLQJUHTXLUHVDOHUWQHVV
FDXWLRQDQGFRXUWHV\,WUHTXLUHVDKHDY\GRVHRIEDVLFFRPPRQVHQVHNHHS\RXU
KHDGXSNHHS\RXUH\HVRQWKHURDGFKHFN\RXUPLUURUVIUHTXHQWO\DQGZDWFKRXW
IRURWKHUGULYHUV,WUHTXLUHVREH\LQJDOOWUDIILFVLJQVDQGVLJQDOVDQGVWD\LQJZLWKLQ
WKHVSHHGOLPLW,WPHDQVXVLQJVHDWEHOWVDQGUHTXLULQJRWKHUSDVVHQJHUVWRGRWKH
VDPH
%XWZLWKZLUHOHVVSKRQHXVHGULYLQJVDIHO\PHDQVDOLWWOHPRUH7KLVEURFKXUHLVD
FDOOWRZLUHOHVVSKRQHXVHUVHYHU\ZKHUHWRPDNHVDIHW\WKHLUILUVWSULRULW\ZKHQ
EHKLQGWKHZKHHORIDFDU:LUHOHVVWHOHFRPPXQLFDWLRQVLVNHHSLQJXVLQWRXFK
VLPSOLI\LQJRXUOLYHVSURWHFWLQJXVLQHPHUJHQFLHVDQGSURYLGLQJRSSRUWXQLWLHVWR
KHOSRWKHUVLQQHHG
:KHQLWFRPHVWRWKHXVHRIZLUHOHVVSKRQHVVDIHW\LV\RXUPRVWLPSRUWDQWFDOO
Wireless Phone "Safety Tips"
%HORZDUHVDIHW\WLSVWRIROORZZKLOHGULYLQJDQGXVLQJDZLUHOHVVSKRQHZKLFK
VKRXOGEHHDV\WRUHPHPEHU
*HWWRNQRZ\RXUZLUHOHVVSKRQHDQGLWVIHDWXUHVVXFKDVVSHHGGLDODQGUHGLDO
&DUHIXOO\UHDG\RXULQVWUXFWLRQPDQXDODQGOHDUQWRWDNHDGYDQWDJHRIYDOXDEOH
IHDWXUHVPRVWSKRQHVRIIHULQFOXGLQJDXWRPDWLFUHGLDODQGPHPRU\$OVRZRUN
WRPHPRUL]HWKHSKRQHNH\SDGVR\RXFDQXVHWKHVSHHGGLDOIXQFWLRQZLWKRXW
WDNLQJ\RXUDWWHQWLRQRIIWKHURDG
:KHQDYDLODEOHXVHDKDQGVIUHHGHYLFH$QXPEHURIKDQGVIUHHZLUHOHVVSKRQH
DFFHVVRULHVDUHUHDGLO\DYDLODEOHWRGD\:KHWKHU\RXFKRRVHDQLQVWDOOHGPRXQWHG
GHYLFHIRU\RXUZLUHOHVVSKRQHRUDVSHDNHUSKRQHDFFHVVRU\WDNHDGYDQWDJHRI
WKHVHGHYLFHVLIDYDLODEOHWR\RX
3RVLWLRQ\RXUZLUHOHVVSKRQHZLWKLQHDV\UHDFK0DNHVXUH\RXSODFH\RXU
ZLUHOHVVSKRQHZLWKLQHDV\UHDFKDQGZKHUH\RXFDQJUDELWZLWKRXWUHPRYLQJ
\RXUH\HVIURPWKHURDG,I\RXJHWDQLQFRPLQJFDOODWDQLQFRQYHQLHQWWLPHLI
SRVVLEOHOHW\RXUYRLFHPDLODQVZHULWIRU\RX
6XVSHQGFRQYHUVDWLRQVGXULQJKD]DUGRXVGULYLQJFRQGLWLRQVRUVLWXDWLRQV/HW
WKHSHUVRQ\RXDUHVSHDNLQJZLWKNQRZ\RXDUHGULYLQJLIQHFHVVDU\VXVSHQGWKH
FDOOLQKHDY\WUDIILFRUKD]DUGRXVZHDWKHUFRQGLWLRQV5DLQVOHHWVQRZDQGLFH
[ 140 ]
FDQEHKD]DUGRXVEXWVRLVKHDY\WUDIILF$VDGULYHU\RXUILUVWUHVSRQVLELOLW\LV
WRSD\DWWHQWLRQWRWKHURDG
'RQRWWDNHQRWHVRUORRNXSSKRQHQXPEHUVZKLOHGULYLQJ,I\RXDUHUHDGLQJDQ
DGGUHVVERRNRUEXVLQHVVFDUGRUZULWLQJDWRGROLVWZKLOHGULYLQJDFDU\RX
DUHQRWZDWFKLQJZKHUH\RXDUHJRLQJ,WVFRPPRQVHQVH'RQWJHWFDXJKWLQD
GDQJHURXVVLWXDWLRQEHFDXVH\RXDUHUHDGLQJRUZULWLQJDQGQRWSD\LQJDWWHQWLRQ
WRWKHURDGRUQHDUE\YHKLFOHV
'LDOVHQVLEO\DQGDVVHVVWKHWUDIILFLISRVVLEOHSODFHFDOOVZKHQ\RXDUHQRW
PRYLQJRUEHIRUHSXOOLQJLQWRWUDIILF7U\WRSODQ\RXUFDOOVEHIRUH\RXEHJLQ\RXU
WULSRUDWWHPSWWRFRLQFLGH\RXUFDOOVZLWKWLPHV\RXPD\EHVWRSSHGDWDVWRS
VLJQUHGOLJKWRURWKHUZLVHVWDWLRQDU\%XWLI\RXQHHGWRGLDOZKLOHGULYLQJ
IROORZWKLVVLPSOHWLSGLDORQO\DIHZQXPEHUVFKHFNWKHURDGDQG\RXUPLUURUV
WKHQFRQWLQXH
'RQRWHQJDJHLQVWUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVWKDWPD\EHGLVWUDFWLQJ
6WUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVDQGGULYLQJGRQRWPL[WKH\DUH
GLVWUDFWLQJDQGHYHQGDQJHURXVZKHQ\RXDUHEHKLQGWKHZKHHORIDFDU0DNH
SHRSOH\RXDUHWDONLQJZLWKDZDUH\RXDUHGULYLQJDQGLIQHFHVVDU\VXVSHQG
FRQYHUVDWLRQVZKLFKKDYHWKHSRWHQWLDOWRGLYHUW\RXUDWWHQWLRQIURPWKHURDG
8VH\RXUZLUHOHVVSKRQHWRFDOOIRUKHOS<RXUZLUHOHVVSKRQHLVRQHRIWKH
JUHDWHVWWRROV\RXFDQRZQWRSURWHFW\RXUVHOIDQG\RXUIDPLO\LQGDQJHURXV
VLWXDWLRQVZLWK\RXUSKRQHDW\RXUVLGHKHOSLVRQO\WKUHHQXPEHUVDZD\'LDO
RURWKHUORFDOHPHUJHQF\QXPEHULQWKHFDVHRIILUHWUDIILFDFFLGHQWURDG
KD]DUGRUPHGLFDOHPHUJHQF\5HPHPEHULWLVDIUHHFDOORQ\RXUZLUHOHVVSKRQH
8VH\RXUZLUHOHVVSKRQHWRKHOSRWKHUVLQHPHUJHQFLHV<RXUZLUHOHVVSKRQH
SURYLGHV\RXDSHUIHFWRSSRUWXQLW\WREHD*RRG6DPDULWDQLQ\RXU
FRPPXQLW\,I\RXVHHDQDXWRDFFLGHQWFULPHLQSURJUHVVRURWKHUVHULRXV
HPHUJHQF\ZKHUHOLYHVDUHLQGDQJHUFDOORURWKHUORFDOHPHUJHQF\QXPEHU
DV\RXZRXOGZDQWRWKHUVWRGRIRU\RX
&DOOURDGVLGHDVVLVWDQFHRUDVSHFLDOZLUHOHVVQRQHPHUJHQF\DVVLVWDQFHQXPEHU
ZKHQQHFHVVDU\&HUWDLQVLWXDWLRQV\RXHQFRXQWHUZKLOHGULYLQJPD\UHTXLUH
DWWHQWLRQEXWDUHQRWXUJHQWHQRXJKWRPHULWDFDOOIRUHPHUJHQF\VHUYLFHV%XW
\RXVWLOOFDQXVH\RXUZLUHOHVVSKRQHWROHQGDKDQG,I\RXVHHDEURNHQGRZQ
YHKLFOHSRVLQJQRVHULRXVKD]DUGDEURNHQWUDIILFVLJQDODPLQRUWUDIILFDFFLGHQW
ZKHUHQRRQHDSSHDUVLQMXUHGRUDYHKLFOH\RXNQRZWREHVWROHQFDOOURDGVLGH
DVVLVWDQFHRURWKHUVSHFLDOQRQHPHUJHQF\ZLUHOHVVQXPEHU
&DUHOHVVGLVWUDFWHGLQGLYLGXDOVDQGSHRSOHGULYLQJLUUHVSRQVLEO\UHSUHVHQWDKD]DUG
WRHYHU\RQHRQWKHURDG6LQFHWKH&HOOXODU7HOHFRPPXQLFDWLRQV,QGXVWU\
$VVRFLDWLRQDQGWKHZLUHOHVVLQGXVWU\KDYHFRQGXFWHGHGXFDWLRQDORXWUHDFKWR
LQIRUPZLUHOHVVSKRQHXVHUVRIWKHLUUHVSRQVLELOLWLHVDVVDIHGULYHUVDQGJRRG
FLWL]HQV$VZHDSSURDFKDQHZFHQWXU\PRUHDQGPRUHRIXVZLOOWDNHDGYDQWDJHRI
WKHEHQHILWVRIZLUHOHVVWHOHSKRQHV$QGDVZHWDNHWRWKHURDGVZHDOOKDYHD
UHVSRQVLELOLW\WRGULYHVDIHO\
7KHZLUHOHVVLQGXVWU\UHPLQGV\RXWRXVH\RXUSKRQHVDIHO\ZKHQGULYLQJ
)RUPRUHLQIRUPDWLRQSOHDVHFDOO6$)(
)RUXSGDWHVKWWSZZZZRZFRPFRPFRQVXPHULVVXHVGULYLQJ
DUWLFOHVFIP",'
[ 141 ]
[ 142 ]
Appendix B Message from the FDA
(U.S. Food and Drug Administration) to all users of mobile phones. July 18, 2001........For updates: http://www.fda.gov/cdrh/phones Nokia 6620 User Guide
Copyright 2003 Nokia U.S. Food and Drug Administration Consumer Update on Wireless Phones 1. Do wireless phones pose a health hazard?
7KHDYDLODEOHVFLHQWLILFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPVDUH
DVVRFLDWHGZLWKXVLQJZLUHOHVVSKRQHV7KHUHLVQRSURRIKRZHYHUWKDWZLUHOHVV
SKRQHVDUHDEVROXWHO\VDIH:LUHOHVVSKRQHVHPLWORZOHYHOVRIUDGLRIUHTXHQF\
HQHUJ\5)LQWKHPLFURZDYHUDQJHZKLOHEHLQJXVHG7KH\DOVRHPLWYHU\ORZ
OHYHOVRI5)ZKHQLQWKHVWDQGE\PRGH:KHUHDVKLJKOHYHOVRI5)FDQSURGXFH
KHDOWKHIIHFWVE\KHDWLQJWLVVXHH[SRVXUHWRORZOHYHO5)WKDWGRHVQRWSURGXFH
KHDWLQJHIIHFWVFDXVHVQRNQRZQDGYHUVHKHDOWKHIIHFWV0DQ\VWXGLHVRIORZOHYHO
5)H[SRVXUHVKDYHQRWIRXQGDQ\ELRORJLFDOHIIHFWV6RPHVWXGLHVKDYHVXJJHVWHG
WKDWVRPHELRORJLFDOHIIHFWVPD\RFFXUEXWVXFKILQGLQJVKDYHQRWEHHQFRQILUPHG
E\DGGLWLRQDOUHVHDUFK,QVRPHFDVHVRWKHUUHVHDUFKHUVKDYHKDGGLIILFXOW\LQ
UHSURGXFLQJWKRVHVWXGLHVRULQGHWHUPLQLQJWKHUHDVRQVIRULQFRQVLVWHQWUHVXOWV
2. What is FDAs role concerning the safety of wireless phones?
8QGHUWKHODZ)'$GRHVQRWUHYLHZWKHVDIHW\RIUDGLDWLRQHPLWWLQJFRQVXPHU
SURGXFWVVXFKDVZLUHOHVVSKRQHVEHIRUHWKH\FDQEHVROGDVLWGRHVZLWKQHZGUXJV
RUPHGLFDOGHYLFHV+RZHYHUWKHDJHQF\KDVDXWKRULW\WRWDNHDFWLRQLIZLUHOHVV
SKRQHVDUHVKRZQWRHPLWUDGLRIUHTXHQF\HQHUJ\5)DWDOHYHOWKDWLVKD]DUGRXV
WRWKHXVHU,QVXFKDFDVH)'$FRXOGUHTXLUHWKHPDQXIDFWXUHUVRIZLUHOHVVSKRQHV
WRQRWLI\XVHUVRIWKHKHDOWKKD]DUGDQGWRUHSDLUUHSODFHRUUHFDOOWKHSKRQHVVR
WKDWWKHKD]DUGQRORQJHUH[LVWV
$OWKRXJKWKHH[LVWLQJVFLHQWLILFGDWDGRQRWMXVWLI\)'$UHJXODWRU\DFWLRQV)'$
KDVXUJHGWKHZLUHOHVVSKRQHLQGXVWU\WRWDNHDQXPEHURIVWHSVLQFOXGLQJWKH
IROORZLQJ
6XSSRUWQHHGHGUHVHDUFKLQWRSRVVLEOHELRORJLFDOHIIHFWVRI5)RIWKHW\SH
HPLWWHGE\ZLUHOHVVSKRQHV
'HVLJQZLUHOHVVSKRQHVLQDZD\WKDWPLQLPL]HVDQ\5)H[SRVXUHWRWKHXVHU
WKDWLVQRWQHFHVVDU\IRUGHYLFHIXQFWLRQDQG
&RRSHUDWHLQSURYLGLQJXVHUVRIZLUHOHVVSKRQHVZLWKWKHEHVWSRVVLEOH
LQIRUPDWLRQRQSRVVLEOHHIIHFWVRIZLUHOHVVSKRQHXVHRQKXPDQKHDOWK
)'$EHORQJVWRDQLQWHUDJHQF\ZRUNLQJJURXSRIWKHIHGHUDODJHQFLHVWKDWKDYH
UHVSRQVLELOLW\IRUGLIIHUHQWDVSHFWVRI5)VDIHW\WRHQVXUHFRRUGLQDWHGHIIRUWVDWWKH
IHGHUDOOHYHO7KHIROORZLQJDJHQFLHVEHORQJWRWKLVZRUNLQJJURXS
1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK
(QYLURQPHQWDO3URWHFWLRQ$JHQF\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ 1DWLRQDO7HOHFRPPXQLFDWLRQVDQG,QIRUPDWLRQ$GPLQLVWUDWLRQ 7KH1DWLRQDO,QVWLWXWHVRI+HDOWKSDUWLFLSDWHVLQVRPHLQWHUDJHQF\ZRUNLQJJURXS
DFWLYLWLHVDVZHOO
)'$VKDUHVUHJXODWRU\UHVSRQVLELOLWLHVIRUZLUHOHVVSKRQHVZLWKWKH)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQ)&&$OOSKRQHVWKDWDUHVROGLQWKH8QLWHG6WDWHV
PXVWFRPSO\ZLWK)&&VDIHW\JXLGHOLQHVWKDWOLPLW5)H[SRVXUH)&&UHOLHVRQ)'$
144 Copyright 2003 Nokia
DQGRWKHUKHDOWKDJHQFLHVIRUVDIHW\TXHVWLRQVDERXWZLUHOHVVSKRQHV)&&DOVR
UHJXODWHVWKHEDVHVWDWLRQVWKDWWKHZLUHOHVVSKRQHQHWZRUNVUHO\XSRQ:KLOHWKHVH
EDVHVWDWLRQVRSHUDWHDWKLJKHUSRZHUWKDQGRWKHZLUHOHVVSKRQHVWKHPVHOYHVWKH
5)H[SRVXUHVWKDWSHRSOHJHWIURPWKHVHEDVHVWDWLRQVDUHW\SLFDOO\WKRXVDQGVRI
WLPHVORZHUWKDQWKRVHWKH\FDQJHWIURPZLUHOHVVSKRQHV%DVHVWDWLRQVDUHWKXVQRW
WKHVXEMHFWRIWKHVDIHW\TXHVWLRQVGLVFXVVHGLQWKLVGRFXPHQW
3. What kinds of phones are the subject of this update?
7KHWHUPZLUHOHVVSKRQHUHIHUVKHUHWRKDQGKHOGZLUHOHVVSKRQHVZLWKEXLOWLQ
DQWHQQDVRIWHQFDOOHGFHOOPRELOHRU3&6SKRQHV7KHVHW\SHVRIZLUHOHVVSKRQHV
FDQH[SRVHWKHXVHUWRPHDVXUDEOHUDGLRIUHTXHQF\HQHUJ\5)EHFDXVHRIWKHVKRUW
GLVWDQFHEHWZHHQWKHSKRQHDQGWKHXVHUVKHDG7KHVH5)H[SRVXUHVDUHOLPLWHGE\
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQVDIHW\JXLGHOLQHVWKDWZHUHGHYHORSHGZLWK
WKHDGYLFHRI)'$DQGRWKHUIHGHUDOKHDOWKDQGVDIHW\DJHQFLHV:KHQWKHSKRQHLV
ORFDWHGDWJUHDWHUGLVWDQFHVIURPWKHXVHUWKHH[SRVXUHWR5)LVGUDVWLFDOO\ORZHU
EHFDXVHDSHUVRQ V5)H[SRVXUHGHFUHDVHVUDSLGO\ZLWKLQFUHDVLQJGLVWDQFHIURPWKH
VRXUFH7KHVRFDOOHGFRUGOHVVSKRQHVZKLFKKDYHDEDVHXQLWFRQQHFWHGWRWKH
WHOHSKRQHZLULQJLQDKRXVHW\SLFDOO\RSHUDWHDWIDUORZHUSRZHUOHYHOVDQGWKXV
SURGXFH5)H[SRVXUHVIDUEHORZWKH)&&VDIHW\OLPLWV
4. What are the results of the research done already?
7KHUHVHDUFKGRQHWKXVIDUKDVSURGXFHGFRQIOLFWLQJUHVXOWVDQGPDQ\VWXGLHVKDYH
VXIIHUHGIURPIODZVLQWKHLUUHVHDUFKPHWKRGV$QLPDOH[SHULPHQWVLQYHVWLJDWLQJ
WKHHIIHFWVRIUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHVFKDUDFWHULVWLFRIZLUHOHVV
SKRQHVKDYH\LHOGHGFRQIOLFWLQJUHVXOWVWKDWRIWHQFDQQRWEHUHSHDWHGLQRWKHU
ODERUDWRULHV$IHZDQLPDOVWXGLHVKRZHYHUKDYHVXJJHVWHGWKDWORZOHYHOVRI5)
FRXOGDFFHOHUDWHWKHGHYHORSPHQWRIFDQFHULQODERUDWRU\DQLPDOV+RZHYHUPDQ\
RIWKHVWXGLHVWKDWVKRZHGLQFUHDVHGWXPRUGHYHORSPHQWXVHGDQLPDOVWKDWKDG
EHHQJHQHWLFDOO\HQJLQHHUHGRUWUHDWHGZLWKFDQFHUFDXVLQJFKHPLFDOVVRDVWREH
SUHGLVSRVHGWRGHYHORSFDQFHULQWKHDEVHQFHRI5)H[SRVXUH2WKHUVWXGLHV
H[SRVHGWKHDQLPDOVWR5)IRUXSWRKRXUVSHUGD\7KHVHFRQGLWLRQVDUHQRW
VLPLODUWRWKHFRQGLWLRQVXQGHUZKLFKSHRSOHXVHZLUHOHVVSKRQHVVRZHGRQWNQRZ
ZLWKFHUWDLQW\ZKDWWKHUHVXOWVRIVXFKVWXGLHVPHDQIRUKXPDQKHDOWK
7KUHHODUJHHSLGHPLRORJ\VWXGLHVKDYHEHHQSXEOLVKHGVLQFH'HFHPEHU
%HWZHHQWKHPWKHVWXGLHVLQYHVWLJDWHGDQ\SRVVLEOHDVVRFLDWLRQEHWZHHQWKHXVHRI
ZLUHOHVVSKRQHVDQGSULPDU\EUDLQFDQFHUJOLRPDPHQLQJLRPDRUDFRXVWLF
QHXURPDWXPRUVRIWKHEUDLQRUVDOLYDU\JODQGOHXNHPLDRURWKHUFDQFHUV1RQH
RIWKHVWXGLHVGHPRQVWUDWHGWKHH[LVWHQFHRIDQ\KDUPIXOKHDOWKHIIHFWVIURP
ZLUHOHVVSKRQH5)H[SRVXUHV+RZHYHUQRQHRIWKHVWXGLHVFDQDQVZHUTXHVWLRQV
DERXWORQJWHUPH[SRVXUHVVLQFHWKHDYHUDJHSHULRGRISKRQHXVHLQWKHVHVWXGLHV
ZDVDURXQGWKUHH\HDUV
5. What research is needed to decide whether RF exposure from wireless phones poses a health risk?
$FRPELQDWLRQRIODERUDWRU\VWXGLHVDQGHSLGHPLRORJLFDOVWXGLHVRISHRSOHDFWXDOO\
XVLQJZLUHOHVVSKRQHVZRXOGSURYLGHVRPHRIWKHGDWDWKDWDUHQHHGHG/LIHWLPH
DQLPDOH[SRVXUHVWXGLHVFRXOGEHFRPSOHWHGLQDIHZ\HDUV+RZHYHUYHU\ODUJH
QXPEHUVRIDQLPDOVZRXOGEHQHHGHGWRSURYLGHUHOLDEOHSURRIRIDFDQFHU
SURPRWLQJHIIHFWLIRQHH[LVWV(SLGHPLRORJLFDOVWXGLHVFDQSURYLGHGDWDWKDWLV
GLUHFWO\DSSOLFDEOHWRKXPDQSRSXODWLRQVEXWRUPRUH\HDUVIROORZXSPD\EH
Nokia 6620 User Guide
Copyright 2003 Nokia QHHGHGWRSURYLGHDQVZHUVDERXWVRPHKHDOWKHIIHFWVVXFKDVFDQFHU7KLVLV
EHFDXVHWKHLQWHUYDOEHWZHHQWKHWLPHRIH[SRVXUHWRDFDQFHUFDXVLQJDJHQWDQGWKH
WLPHWXPRUVGHYHORSLIWKH\GRPD\EHPDQ\PDQ\\HDUV7KHLQWHUSUHWDWLRQRI
HSLGHPLRORJLFDOVWXGLHVLVKDPSHUHGE\GLIILFXOWLHVLQPHDVXULQJDFWXDO5)
H[SRVXUHGXULQJGD\WRGD\XVHRIZLUHOHVVSKRQHV0DQ\IDFWRUVDIIHFWWKLV
PHDVXUHPHQWVXFKDVWKHDQJOHDWZKLFKWKHSKRQHLVKHOGRUZKLFKPRGHORI
SKRQHLVXVHG
6.What is FDA doing to find out more about the possible health effects of wireless phone RF?
)'$LVZRUNLQJZLWKWKH861DWLRQDO7R[LFRORJ\3URJUDPDQGZLWKJURXSVRI
LQYHVWLJDWRUVDURXQGWKHZRUOGWRHQVXUHWKDWKLJKSULRULW\DQLPDOVWXGLHVDUH
FRQGXFWHGWRDGGUHVVLPSRUWDQWTXHVWLRQVDERXWWKHHIIHFWVRIH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)
)'$KDVEHHQDOHDGLQJSDUWLFLSDQWLQWKH:RUOG+HDOWK2UJDQL]DWLRQ,QWHUQDWLRQDO
(OHFWURPDJQHWLF)LHOGV(0)3URMHFWVLQFHLWVLQFHSWLRQLQ$QLQIOXHQWLDO
UHVXOWRIWKLVZRUNKDVEHHQWKHGHYHORSPHQWRIDGHWDLOHGDJHQGDRIUHVHDUFKQHHGV
WKDWKDVGULYHQWKHHVWDEOLVKPHQWRIQHZUHVHDUFKSURJUDPVDURXQGWKHZRUOG7KH
3URMHFWKDVDOVRKHOSHGGHYHORSDVHULHVRISXEOLFLQIRUPDWLRQGRFXPHQWVRQ(0)
LVVXHV
)'$DQGWKH&HOOXODU7HOHFRPPXQLFDWLRQV&,QWHUQHW$VVRFLDWLRQ&7,$KDYHD
IRUPDO&RRSHUDWLYH5HVHDUFKDQG'HYHORSPHQW$JUHHPHQW&5$'$WRGR
UHVHDUFKRQZLUHOHVVSKRQHVDIHW\)'$SURYLGHVWKHVFLHQWLILFRYHUVLJKWREWDLQLQJ
LQSXWIURPH[SHUWVLQJRYHUQPHQWLQGXVWU\DQGDFDGHPLFRUJDQL]DWLRQV&7,$
IXQGHGUHVHDUFKLVFRQGXFWHGWKURXJKFRQWUDFWVWRLQGHSHQGHQWLQYHVWLJDWRUV7KH
LQLWLDOUHVHDUFKZLOOLQFOXGHERWKODERUDWRU\VWXGLHVDQGVWXGLHVRIZLUHOHVVSKRQH
XVHUV7KH&5$'$ZLOODOVRLQFOXGHDEURDGDVVHVVPHQWRIDGGLWLRQDOUHVHDUFK
QHHGVLQWKHFRQWH[WRIWKHODWHVWUHVHDUFKGHYHORSPHQWVDURXQGWKHZRUOG
7. How can I find out how much radiofrequency energy exposure I can get by using my wireless phone?
$OOSKRQHVVROGLQWKH8QLWHG6WDWHVPXVWFRPSO\ZLWK)HGHUDO&RPPXQLFDWLRQV
&RPPLVVLRQ)&&JXLGHOLQHVWKDWOLPLWUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHV
)&&HVWDEOLVKHGWKHVHJXLGHOLQHVLQFRQVXOWDWLRQZLWK)'$DQGWKHRWKHUIHGHUDO
KHDOWKDQGVDIHW\DJHQFLHV7KH)&&OLPLWIRU5)H[SRVXUHIURPZLUHOHVVWHOHSKRQHV
LVVHWDWD6SHFLILF$EVRUSWLRQ5DWH6$5RIZDWWVSHUNLORJUDP:NJ7KH
)&&OLPLWLVFRQVLVWHQWZLWKWKHVDIHW\VWDQGDUGVGHYHORSHGE\WKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLF(QJLQHHULQJ,(((DQGWKH1DWLRQDO&RXQFLORQ
5DGLDWLRQ3URWHFWLRQDQG0HDVXUHPHQW7KHH[SRVXUHOLPLWWDNHVLQWR
FRQVLGHUDWLRQWKHERG\VDELOLW\WRUHPRYHKHDWIURPWKHWLVVXHVWKDWDEVRUEHQHUJ\
IURPWKHZLUHOHVVSKRQHDQGLVVHWZHOOEHORZOHYHOVNQRZQWRKDYHHIIHFWV
0DQXIDFWXUHUVRIZLUHOHVVSKRQHVPXVWUHSRUWWKH5)H[SRVXUHOHYHOIRUHDFKPRGHO
RISKRQHWRWKH)&&7KH)&&ZHEVLWHKWWSZZZIFFJRYRHWUIVDIHW\JLYHV
GLUHFWLRQVIRUORFDWLQJWKH)&&LGHQWLILFDWLRQQXPEHURQ\RXUSKRQHVR\RXFDQ
ILQG\RXUSKRQHV5)H[SRVXUHOHYHOLQWKHRQOLQHOLVWLQJ
8. What has FDA done to measure the radiofrequency energy coming from wireless phones?
146 Copyright 2003 Nokia 7KH,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((LVGHYHORSLQJDWHFKQLFDO
VWDQGDUGIRUPHDVXULQJWKHUDGLRIUHTXHQF\HQHUJ\5)H[SRVXUHIURPZLUHOHVV
SKRQHVDQGRWKHUZLUHOHVVKDQGVHWVZLWKWKHSDUWLFLSDWLRQDQGOHDGHUVKLSRI)'$
VFLHQWLVWVDQGHQJLQHHUV7KHVWDQGDUG5HFRPPHQGHG3UDFWLFHIRU'HWHUPLQLQJWKH
6SDWLDO3HDN6SHFLILF$EVRUSWLRQ5DWH6$5LQWKH+XPDQ%RG\'XHWR:LUHOHVV
&RPPXQLFDWLRQV'HYLFHV([SHULPHQWDO7HFKQLTXHVVHWVIRUWKWKHILUVWFRQVLVWHQW
WHVWPHWKRGRORJ\IRUPHDVXULQJWKHUDWHDWZKLFK5)LVGHSRVLWHGLQWKHKHDGVRI
ZLUHOHVVSKRQHXVHUV7KHWHVWPHWKRGXVHVDWLVVXHVLPXODWLQJPRGHORIWKHKXPDQ
KHDG6WDQGDUGL]HG6$5WHVWPHWKRGRORJ\LVH[SHFWHGWRJUHDWO\LPSURYHWKH
FRQVLVWHQF\RIPHDVXUHPHQWVPDGHDWGLIIHUHQWODERUDWRULHVRQWKHVDPHSKRQH
6$5LVWKHPHDVXUHPHQWRIWKHDPRXQWRIHQHUJ\DEVRUEHGLQWLVVXHHLWKHUE\WKH
ZKROHERG\RUDVPDOOSDUWRIWKHERG\,WLVPHDVXUHGLQZDWWVNJRUPLOOLZDWWVJ
RIPDWWHU7KLVPHDVXUHPHQWLVXVHGWRGHWHUPLQHZKHWKHUDZLUHOHVVSKRQH
FRPSOLHVZLWKVDIHW\JXLGHOLQHV
9. What steps can I take to reduce my exposure to radiofrequency energy from my wireless phone?
,IWKHUHLVDULVNIURPWKHVHSURGXFWVDQGDWWKLVSRLQWZHGRQRWNQRZWKDWWKHUH
LVLWLVSUREDEO\YHU\VPDOO%XWLI\RXDUHFRQFHUQHGDERXWDYRLGLQJHYHQSRWHQWLDO
ULVNV\RXFDQWDNHDIHZVLPSOHVWHSVWRPLQLPL]H\RXUH[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\5)6LQFHWLPHLVDNH\IDFWRULQKRZPXFKH[SRVXUHDSHUVRQUHFHLYHV
UHGXFLQJWKHDPRXQWRIWLPHVSHQWXVLQJDZLUHOHVVSKRQHZLOOUHGXFH5)H[SRVXUH
,I\RXPXVWFRQGXFWH[WHQGHGFRQYHUVDWLRQVE\ZLUHOHVVSKRQHHYHU\GD\\RX
FRXOGSODFHPRUHGLVWDQFHEHWZHHQ\RXUERG\DQGWKHVRXUFHRIWKH5)VLQFHWKH
H[SRVXUHOHYHOGURSVRIIGUDPDWLFDOO\ZLWKGLVWDQFH)RUH[DPSOH\RXFRXOGXVHD
KHDGVHWDQGFDUU\WKHZLUHOHVVSKRQHDZD\IURP\RXUERG\RUXVHDZLUHOHVVSKRQH
FRQQHFWHGWRDUHPRWHDQWHQQD
$JDLQWKHVFLHQWLILFGDWDGRQRWGHPRQVWUDWHWKDWZLUHOHVVSKRQHVDUHKDUPIXO%XW
LI\RXDUHFRQFHUQHGDERXWWKH5)H[SRVXUHIURPWKHVHSURGXFWV\RXFDQXVH
PHDVXUHVOLNHWKRVHGHVFULEHGDERYHWRUHGXFH\RXU5)H[SRVXUHIURPZLUHOHVV
SKRQHXVH
10. What about children using wireless phones?
7KHVFLHQWLILFHYLGHQFHGRHVQRWVKRZDGDQJHUWRXVHUVRIZLUHOHVVSKRQHV
LQFOXGLQJFKLOGUHQDQGWHHQDJHUV,I\RXZDQWWRWDNHVWHSVWRORZHUH[SRVXUHWR
UDGLRIUHTXHQF\HQHUJ\5)WKHPHDVXUHVGHVFULEHGDERYHZRXOGDSSO\WRFKLOGUHQ
DQGWHHQDJHUVXVLQJZLUHOHVVSKRQHV5HGXFLQJWKHWLPHRIZLUHOHVVSKRQHXVHDQG
LQFUHDVLQJWKHGLVWDQFHEHWZHHQWKHXVHUDQGWKH5)VRXUFHZLOOUHGXFH5)
H[SRVXUH6RPHJURXSVVSRQVRUHGE\RWKHUQDWLRQDOJRYHUQPHQWVKDYHDGYLVHGWKDW
FKLOGUHQEHGLVFRXUDJHGIURPXVLQJZLUHOHVVSKRQHVDWDOO)RUH[DPSOHWKH
JRYHUQPHQWLQWKH8QLWHG.LQJGRPGLVWULEXWHGOHDIOHWVFRQWDLQLQJVXFKD
UHFRPPHQGDWLRQLQ'HFHPEHU7KH\QRWHGWKDWQRHYLGHQFHH[LVWVWKDWXVLQJ
DZLUHOHVVSKRQHFDXVHVEUDLQWXPRUVRURWKHULOOHIIHFWV7KHLUUHFRPPHQGDWLRQWR
OLPLWZLUHOHVVSKRQHXVHE\FKLOGUHQZDVVWULFWO\SUHFDXWLRQDU\LWZDVQRWEDVHGRQ
VFLHQWLILFHYLGHQFHWKDWDQ\KHDOWKKD]DUGH[LVWV
11. What about wireless phone interference with medical equipment?
Nokia 6620 User Guide
Copyright 2003 Nokia 5DGLRIUHTXHQF\HQHUJ\5)IURPZLUHOHVVSKRQHVFDQLQWHUDFWZLWKVRPH
HOHFWURQLFGHYLFHV)RUWKLVUHDVRQ)'$KHOSHGGHYHORSDGHWDLOHGWHVWPHWKRGWR
PHDVXUHHOHFWURPDJQHWLFLQWHUIHUHQFH(0,RILPSODQWHGFDUGLDFSDFHPDNHUVDQG
GHILEULOODWRUVIURPZLUHOHVVWHOHSKRQHV7KLVWHVWPHWKRGLVQRZSDUWRIDVWDQGDUG
VSRQVRUHGE\WKH$VVRFLDWLRQIRUWKH$GYDQFHPHQWRI0HGLFDOLQVWUXPHQWDWLRQ
$$0,7KHILQDOGUDIWDMRLQWHIIRUWE\)'$PHGLFDOGHYLFHPDQXIDFWXUHUVDQG
PDQ\RWKHUJURXSVZDVFRPSOHWHGLQODWH7KLVVWDQGDUGZLOODOORZ
PDQXIDFWXUHUVWRHQVXUHWKDWFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVDUHVDIHIURP
ZLUHOHVVSKRQH(0,)'$KDVWHVWHGKHDULQJDLGVIRULQWHUIHUHQFHIURPKDQGKHOG
ZLUHOHVVSKRQHVDQGKHOSHGGHYHORSDYROXQWDU\VWDQGDUGVSRQVRUHGE\WKH,QVWLWXWH
RI(OHFWULFDODQG(OHFWURQLF(QJLQHHUV,(((7KLVVWDQGDUGVSHFLILHVWHVWPHWKRGV
DQGSHUIRUPDQFHUHTXLUHPHQWVIRUKHDULQJDLGVDQGZLUHOHVVSKRQHVVRWKDWQR
LQWHUIHUHQFHRFFXUVZKHQDSHUVRQXVHVDFRPSDWLEOHSKRQHDQGDDFFRPSDQLHG
KHDULQJDLGDWWKHVDPHWLPH7KLVVWDQGDUGZDVDSSURYHGE\WKH,(((LQ
)'$FRQWLQXHVWRPRQLWRUWKHXVHRIZLUHOHVVSKRQHVIRUSRVVLEOHLQWHUDFWLRQVZLWK
RWKHUPHGLFDOGHYLFHV6KRXOGKDUPIXOLQWHUIHUHQFHEHIRXQGWRRFFXU)'$ZLOO
FRQGXFWWHVWLQJWRDVVHVVWKHLQWHUIHUHQFHDQGZRUNWRUHVROYHWKHSUREOHP
12. Where can I find additional information?
)RUDGGLWLRQDOLQIRUPDWLRQSOHDVHUHIHUWRWKHIROORZLQJUHVRXUFHV
)'$ZHESDJHRQZLUHOHVVSKRQHV KWWSZZZIGDJRYFGUKSKRQHVLQGH[KWPO
)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&5)6DIHW\3URJUDP
KWWSZZZIFFJRYRHWUIVDIHW\
,QWHUQDWLRQDO&RPPLVVLRQRQ1RQ,RQL]LQJ5DGLDWLRQ3URWHFWLRQ KWWSZZZLFQLUSGH
:RUOG+HDOWK2UJDQL]DWLRQ:+2,QWHUQDWLRQDO(0)3URMHFW KWWSZZZZKRLQWHPI 1DWLRQDO5DGLRORJLFDO3URWHFWLRQ%RDUG8. KWWSZZZQUSERUJXN
July 18, 2001For updates: http://www.fda.gov/cdrh/phones 148 Copyright 2003 Nokia
Index Numerics 1-touch dialing Assigning numbers 31 Making calls 22 A Access codes, See Security code Access points 68 Accessibility solutions 6 See also Accessory (LPS-3 and HDA-9) Accessories, See Enhancements Alarm clock Alarm tone 88 Setting 88 Snooze 88 Turning off 88 Answering a call 23 Antenna 12 Application manager 106 Applications Adding voice commands 90 Installing applications 108 Java application settings 108 Removing files 108 Audio files, See Media files Automatic call answer 73 B Background image, See Themes Batteries 125 Battery Charging 11 Inserting 11 Blocking calls 72 Bluetooth connection 110 Closing the connection 113 Connection requests 112 Connection status indicators 112 Device icons 112 Pairing 112 Passcode 112 Receiving data 113 Sending data 111 Settings 111 Unique device address 111 Browser Access points 68 Bookmarks 100 Adaptive 101 Adding 101 Icons 100 Browsing 101 Connecting 100 Ending connections 104 Icons 100 Service message settings 64 Service messages 57 WAP pages 99 XHTML pages 99 C Cache, clearing 103 Calculator 86 Calendar 34 Nokia 6620 User Guide
Copyright 2004 Nokia Alarm tone 37 Deleting many entries simultaneously 120 Remote synchronization 118 Settings 37 Views 35 Call blocking 72 Call lists, See Logs Call register, See Log Call timers 26 Calls 1-touch dialing 22 Answering 23 Conference calls 22 Dialed 25 Duration timers 26 Forwarding 23 International 21 Making a call 21 Missed 25 Options during a call 23 Received 25 Rejecting 23 Settings 67 Settings for forwarding 24 Transferring 23 Using the Contacts directory 21 Cameras 39 Memory card 41 Memory consumption 41 Self-timer 40 Settings 40 Taking pictures 39 Video recorder 41 CD-ROM 116 Cell broadcast messages (info service) 60 Cell info display 73 Certificates Management 75 Trust settings 76 Chargers 125 Clearing memory Calendar entries 120 Log information 120 Clock 88 Alarm 88 Settings 88 Code Access, See Security code PIN, See PIN code Security, See Security code Computer connections 116 Conference calls 22 Connecting to a PC 116 Connection Bluetooth 110 Indicators, See Icons Infrared 113 Manager 115 Settings 68 USB 115 Viewing details 115 Contact cards Assigning 1-touch dialing numbers 31 Assigning default numbers and 150 Copyright 2004 Nokia addresses 29 Creating 28 Data import 38 Inserting images 28 Remote synchronization 118 Ringing tones Adding 29 For contact group 29 For individual contact 29 Removing 29 Voice tags 29, 30 Contact groups 31 Converter 86 Adding exchange rates 87 Converting currencies 87 Converting units 87 Copying SIM card to phone memory 29 Text 53 Customer care 6 D Data connections to network Ending 116 Data import 38 Date, settings 72 Delivery reports 50 Dialed numbers 25 Display settings 67 See also Themes Downloading files to the Gallery 47 E Editing Contact cards 28 Text 50 Themes 80 EGPRS, See GPRS E-mail Deleting 59 Remote mailbox 57 Retrieving 58 Settings 63 Undeleting 59 Enhancements Activating 73 Descriptions 125 HDA-9 Phone Adapter 127 LPS-3 Loopset 127 Rules for use 124 Settings 73 Erasing Log 26 Recent calls log 25 F File formats RealOne Player 44 SIS file 107 File manager 76 Files, opening 46 Fixed dialing 74 Folders Creating 18 Opening 46 Organizing 18 Forwarding calls 23 Nokia 6620 User Guide
Copyright 2004 Nokia G Gallery 45 Downloading files from the Internet 47 Folders 46 Picture messages 46 Uploading images 47 Wallpaper images 46 GIF animations 43 Go to (shortcuts) Adding a shortcut 81 Using shortcuts 81 GPRS 71 GSM data connections 115 H Handsfree use, See Loudspeaker Help 17 I Icons 14 Activity 14 Bluetooth connection 112 Browser 100 Data connection 15 Enhancement 15 GPRS connection 115 In standby mode 14 Infrared connection 114 Messaging 55 Voice volume 15 Idle state, See Standby mode Image server 47 Images 46 Adding to a contact card 28 Full screen 43 Keyboard shortcuts when viewing images 43 Memory consumption 41 Moving the focus 43 Wallpapers folder 46 Zooming 43 Importing data from other Nokia phones 38 Indicators, See Icons Infrared connection 113 Inserting Battery 11 Memory card 10 SIM card 9 Installing Applications 108 Java files 108 Instant Messaging (IM) 91 Group conversations 93, 94 IM contacts 95 Individual conversations 94 Settings 92, 96 Internet access points (IAP), See Access points Internet service provider (ISP), See Access points J Java Installing applications 108 Settings 108 Joystick, using to move in menus 16 152 Copyright 2004 Nokia K Keyguard 20 Keypad lock, See Keyguard Keys, phone key definitions v L Language For writing 66 Setting phone language 66 Listening to messages, See Voice mail Lock code 12, 74 Lock keypad, See Keyguard Locking memory card (using password) 98 Log Data counter 25 Erasing contents 26 Filtering 26 General (all calls and connections) 26 Recent, missed, and received calls 25 Settings 26 Loopset, See Enhancements Loudspeaker Activating 19 Turning off 19 M Mail E-mail 57 Voice mail 21 Making calls 21 Media files File formats 44 Mute 45 Playing 44 Seek 45 Track list 44 Media gallery, See Gallery Memory card 97 Backup 98 Cameras 41 Consumption 98 Format 97 Inserting 10 Password (Lock/Unlock) 98 Restore 98 Video clips 97 Memory low Check memory consumption 98 Troubleshooting 119 Memory, viewing details 77 Menu 16 Menu key v, 16 Rearranging the main Menu 16 Messaging Delivery reports 50 Inbox 55 Main view 49 Messages on the SIM card 60 My folders 57 Outbox 59 Sent folder settings 65 Settings 61 Text messages 53 Writing text 50 Nokia 6620 User Guide
Copyright 2004 Nokia Missed calls 25 Mobile browser, See Browser Modem, using your phone as 116 Mp3 track list, See Track list Multimedia presentation 55 Music files, See Media files Mute Active call 23 Media files 45 Ringing tone on incoming call 23 My folders 57 N Navigation bar 17 Network Services 2 Notes 88 O Options lists 17 Organizing the main Menu 16 Outbox 59 P Packet data (GPRS) Connection timer 26 Data counter 25, 26 Settings 71 Pasting text 53 PC Suite 116 Personal notes 84 Personalize Alarm clock tone 88 Calendar alarm tone 37 Phone Adapter, See Enhancements Phone display, See Themes Phone illustration v Phonebook, See Contact cards Picture messages 46 Pictures, taking 39 PIN code Unblocking 73 Using when powering on 12 Playing media files 44 Power on and off 12 Predictive text input How to use 51 Tips 52 Turning off 52 Presence 32 Profiles 78 Renaming 79 Settings 79 Purchasing downloads 103 Q Quick guide vi R RealOne Player 43 File formats 44 Playing media files 44 Settings 45 Streaming live content 44 Received calls 25 Receiving Data by Bluetooth connection 113 Data by infrared connection 154 Copyright 2004 Nokia 114 Ringing tones, Operator logos, and settings, see Smart messages Recent calls log, see Log Recorder 89 Recording Sounds 89 Videos 41 Voice commands 90 Register your phone 4 Rejecting calls 23 Remote mailbox 57 Remote synchronization 117 Removing an application 108 Reports 50 Ringing tones Adding a personal ringing tone Changing 79 Muting 23 Receiving in a smart message 29 56 S Screen saver Display 80 Settings 67 Scrolling, with joystick 16 Search for an item 19 Security PIN, lock, and PUK codes 73 Security certificates 75 Settings 73 Security code 73, 122 Seek for media files 45 Self-timer (for camera) 40 Sending Data by Bluetooth connection 111 114 Data by infrared connection Service command editor 61 Setting the time and date 13 Settings 66 Applications (Java) 108 Bluetooth connection 111 Calendar 37 Call blocking 72 Call forwarding 24 Cameras 40 Cell broadcast (info service) 64 Certificates 75 Clock 88 Connection 68 Data call (GPRS) 71 Date and time 72 Display 67 E-mail 63 Enhancements 73 Fixed dialing 74 General 66 Lock code 74 Log 26 Messaging 61 Messaging, Sent folder 65 Phone settings 66 PIN code 73 Nokia 6620 User Guide
Copyright 2004 Nokia RealOne Player 45 Security 73 Security codes 73 Sounds (customizing Profiles) 79 Text messages 61 Video recorder 42 Wallet 85 Shared memory 3 Shortcuts Adding menu shortcuts 81 Using the Go to menu 81 When viewing images 43 SIM card Copying names and numbers 29 Definition 119 Inserting 9 Messages 60 SIS file 107 Smart messages 56 Snooze 88 Software Installing applications 108 Removing applications 108 Transferring an application to your phone 107 Sound clips 46 Sound files, See Media files Speed dialing, See 1-touch dialing Standby mode Screen description 13 Settings 67 Stopping alarm clock 88 Storing data 120 Subscribed contacts (Presence) 31 Switching between applications 17 Synchronization 117 SyncML 117 T Templates folder 57 Text Copying and pasting 53 Input 50 Messages, writing and sending 53 Templates 57 Themes 79 Editing 80 Restoring 81 Wallpapers folder 46 Thumbnails, in a contact card 28 Tickets 85 Time and date settings 72 To-do 37 Tools Application manager 106 File manager 76 Settings 66 Voice mail 21 Track list 47 Traditional text input 50 Transferring calls 23 Troubleshooting 119 156 Copyright 2004 Nokia TTY/TDD communication 6, 127 U Unit converter 86 Uploading images 47 USB 115 USSD commands 61 V Video clips Opening 46 Saving 42 Video player, See RealOne Player Video recorder 41 Memory card 42 Saving video clips 42 Settings 42 Viewing Connection details 115 GIF animations 43 Voice commands 89 Adding 90 Changing 91 Deleting 91 Starting applications 91 Voice dialing, See Voice tags Voice mail 21 Changing the number 22 Forwarding calls to voice mail 24 Listening to messages 21 Voice messages, See Voice mail Voice recorder 89 Voice tags 29 Adding, changing, and deleting 30 Making calls 30 Volume control 19 W Wallet 83 Creating a wallet profile 84 Creating personal notes 84 Entering the wallet code 83 Reset code 86 Retrieving data into browser Settings 85 Storing personal card details 85 84 Viewing ticket details 85 Wallpaper, See Themes 80 WAP pages, See Browser Warranty 4, 135 Web, See Browser Writing 50 Predictive text input 51 Traditional text input 50 X XHTML pages, See Browser Z Zooming On saved images 43 When recording video 41 When taking a picture 39 Nokia 6620 User Guide
Copyright 2004 Nokia 158 Copyright 2004 Nokia Para obtener un manual del usuario en espaol favor de llamar o enviar un fax al telfono 1-888-NOKIA-2U, fax 813-249-9619. 9310640
Copyright Nokia 2003
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2004-03-31 | 1850.2 ~ 1909.8 | PCE - PCS Licensed Transmitter held to ear | Original Equipment |
2 | 2402 ~ 2480 | DSS - Part 15 Spread Spectrum Transmitter |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 | Effective |
2004-03-31
|
||||
1 2 | Applicant's complete, legal business name |
Microsoft Corporation
|
||||
1 2 | FCC Registration Number (FRN) |
0008293318
|
||||
1 2 | Physical Address |
1 Microsoft Way
|
||||
1 2 |
Redmond, Washington 98052
|
|||||
1 2 |
United States
|
|||||
app s | TCB Information | |||||
1 2 | TCB Application Email Address |
h******@americantcb.com
|
||||
1 2 | TCB Scope |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
||||
1 2 |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
|||||
app s | FCC ID | |||||
1 2 | Grantee Code |
QUR
|
||||
1 2 | Equipment Product Code |
NHL-12
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 | Name |
H******** S******
|
||||
1 2 | Title |
Director, EMC, SI and RF Compliance
|
||||
1 2 | Telephone Number |
425-7********
|
||||
1 2 | Fax Number |
425-7********
|
||||
1 2 |
h******@microsoft.com
|
|||||
app s | Technical Contact | |||||
1 2 | Firm Name |
Nokia Corporation
|
||||
1 2 | Name |
E**** H****
|
||||
1 2 | Physical Address |
Mattilanniemi 6
|
||||
1 2 |
Jyvskyl, 40100
|
|||||
1 2 |
Finland
|
|||||
1 2 | Telephone Number |
011 3********
|
||||
1 2 | Fax Number |
011 3********
|
||||
1 2 |
e******@nokia.com
|
|||||
app s | Non Technical Contact | |||||
n/a | ||||||
app s | Confidentiality (long or short term) | |||||
1 2 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | No | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 | Equipment Class | PCE - PCS Licensed Transmitter held to ear | ||||
1 2 | DSS - Part 15 Spread Spectrum Transmitter | |||||
1 2 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | GSM 850/1800/1900 Cellular Telephone w/Bluetooth | ||||
1 2 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 2 | Modular Equipment Type | Does not apply | ||||
1 2 | Purpose / Application is for | Original Equipment | ||||
1 2 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | Yes | ||||
1 2 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 | Grant Comments | Power Output is ERP for Part 22 and EIRP for Part 24. Body-worn operations are restricted to belt-clips, holsters or similar accessories that have no metallic component in the assembly and which provide at least 1.5 cm separation between the device and the users body. End users must be informed of the body worn requirements for satisfying RF Exposure compliance. The highest reported SAR values are: Part 22 Head: 1.06W/kg; Body-worn 0.6W/kg; PCS Band Head: 0.51W/kg; Body-worn 1.22W/kg. This device contains 1800 MHz GSM functions that are not operational in U.S. Territories. This filing is only applicable for 850MHz Cellular and 1900MHz PCS operations. | ||||
1 2 | Power output is conducted. The Bluetooth antenna for this device is collocated with the Cellphone antenna. End users and installers must be provided with antenna installation instructions and transmitter operating conditions for satisfying RF exposure compliance. | |||||
1 2 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 2 | Firm Name |
TCC Tampere
|
||||
1 2 | Name |
J****** J******
|
||||
1 2 | Telephone Number |
35871********
|
||||
1 2 | Fax Number |
358-7********
|
||||
1 2 |
f******@microsoft.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 24E | BC | 1850.2 | 1909.8 | 0.811 | 0.1 ppm | 300KGXW | |||||||||||||||||||||||||||||||||
1 | 2 | 24E | BC | 1850.2 | 1909.8 | 0.505 | 0.1 ppm | 300KG7W | |||||||||||||||||||||||||||||||||
1 | 3 | 22H | BC | 824.2 | 848.8 | 1.194 | 0.1 ppm | 300KGXW | |||||||||||||||||||||||||||||||||
1 | 4 | 22H | BC | 824.2 | 848.8 | 0.537 | 0.1 ppm | 300KG7W | |||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 15C | CE | 2402.00000000 | 2480.00000000 | 0.0010000 |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC