all | frequencies |
|
|
|
|
|
|
|
exhibits | applications |
---|---|---|---|---|---|---|---|---|---|---|
manuals | photos | labels |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 3 |
|
User Manual-EX6400 | Users Manual | 1.39 MiB | January 20 2019 / July 20 2019 | |||
1 2 3 |
|
User Manual-EX7300 | Users Manual | 1.44 MiB | January 20 2019 / July 20 2019 | |||
1 2 3 |
|
User Manual-statement | Users Manual | 12.23 KiB | January 20 2019 / July 20 2019 | |||
1 2 3 |
|
Internal photos | Internal Photos | 1.60 MiB | January 20 2019 / July 20 2019 | |||
1 2 3 |
|
External Photos | External Photos | 908.74 KiB | January 20 2019 / July 20 2019 | |||
1 2 3 |
|
Label | ID Label/Location Info | 300.72 KiB | January 20 2019 | |||
1 2 3 |
|
Label location | ID Label/Location Info | 30.90 KiB | January 20 2019 | |||
1 2 3 |
|
Class II Permissive Change Request Letter | Cover Letter(s) | 16.17 KiB | / December 02 2019 | |||
1 2 3 |
|
Co-Location Test Report | Test Report | 318.82 KiB | / December 02 2019 | |||
1 2 3 |
|
Confidentiality Request Letter | Cover Letter(s) | 63.82 KiB | / December 02 2019 | |||
1 2 3 |
|
DFS Test Report | Test Report | 2.02 MiB | / December 02 2019 | |||
1 2 3 |
|
Declaration for DFS Master Devices | Cover Letter(s) | 420.59 KiB | / December 02 2019 | |||
1 2 3 |
|
Declaration for DTS UNII | Cover Letter(s) | 83.65 KiB | / December 02 2019 | |||
1 2 3 |
|
MPE Calculation | RF Exposure Info | 69.57 KiB | / December 02 2019 | |||
1 2 3 |
|
NII Test Report | Test Report | 699.50 KiB | / December 02 2019 | |||
1 2 3 |
|
Power of Attorney | Cover Letter(s) | 139.52 KiB | / December 02 2019 | |||
1 2 3 |
|
Project and Product Certification Representative Authorization Letter | Cover Letter(s) | 302.61 KiB | / December 02 2019 | |||
1 2 3 | Software Security Document | Operational Description | January 30 2019 | confidential | ||||
1 2 3 |
|
Test Setup Photo | Test Setup Photos | 261.07 KiB | / November 08 2019 | |||
1 2 3 | Block Diagram-EX6400 | Block Diagram | January 20 2019 | confidential | ||||
1 2 3 | Block Diagram-EX7300 | Block Diagram | January 20 2019 | confidential | ||||
1 2 3 |
|
LTC/STC Letter | Cover Letter(s) | 307.02 KiB | January 20 2019 | |||
1 2 3 |
|
MPE Report | RF Exposure Info | 60.30 KiB | January 20 2019 | |||
1 2 3 | Operational Description | Operational Description | January 20 2019 | confidential | ||||
1 2 3 | Operational description -Antenna spec | Operational Description | January 20 2019 | confidential | ||||
1 2 3 |
|
RF Test Report | Test Report | 2.76 MiB | January 20 2019 | |||
1 2 3 |
|
RF Test Report-Co-located | Test Report | 286.86 KiB | January 20 2019 | |||
1 2 3 |
|
RF Test set-up photo | Test Setup Photos | 316.01 KiB | January 20 2019 / July 20 2019 | |||
1 2 3 | Schematics-EX6400 | Schematics | January 20 2019 | confidential | ||||
1 2 3 | Schematics-EX7300 | Schematics | January 20 2019 | confidential | ||||
1 2 3 |
|
WIFI Channel description letter | Cover Letter(s) | 417.33 KiB | January 20 2019 | |||
1 2 3 | SW Declaration Letter | Operational Description | January 20 2019 | confidential |
1 2 3 | User Manual-EX6400 | Users Manual | 1.39 MiB | January 20 2019 / July 20 2019 |
Quick StartAC1900 WiFi Mesh Extender Essentials Edition Model EX6400v2 Getting started Your extender boosts your routers WiFi signal and enhances the signal quality over long distances. WiFi router Sometimes your router doesnt provide the WiFi coverage that you need Extender Boosts the WiFi range and sends a stronger signal in hard-to-reach areas 2 Meet your extender Before you install your extender, learn about its LEDs, buttons, and port. Router Arrow LED Router Link LED Factory Reset button Power On/Off button WPS button Access Point/
Extender switch Client Arrow LED Client Link LED Power LED WPS LED Ethernet port
(on bottom panel) 3 LED Description Router Link LED Client Link LED Power LED WPS LED WiFi connection from the router to the extender:
Solid green. Best connection. Solid amber. Good connection. Solid red. Poor connection. Off. No connection. WiFi connection from your computer or mobile device to the extender:
Solid green. Best connection. Solid amber. Good connection. Solid red. Poor connection. Off. No connection. Solid amber. The extender is booting. Solid green. The extender is powered on. Off. The extender is powered off. Solid green. WiFi security is enabled (WPA or WPA2). Blinking green. A WPS connection is being established. Off. WiFi security isnt enabled. No arrow LEDs are lit. The extender is in a good location. Client Arrow LED blinks. Move the WiFi-enabled computer or mobile device closer to the extender. Router Arrow LED blinks. Move the extender closer to the router. 4 You can use your extender in extender mode or in access point mode. In extender mode, your extender repeats the signals from your WiFi router. After initial setup, the best location for the extender is about halfway between your router and the area with a poor WiFi signal. The extender must be within the range of your WiFi router network. In access point mode, your extender creates a new WiFi hotspot by using a wired Ethernet connection. 5 Install the extender in extender mode 1. Set the Access Point/Extender switch to Extender 2. For initial setup, place your extender in the same room as your
. WiFi router. 3. Plug the extender into an electrical outlet. Wait for the Power LED to 2 minutes. If the Power LED doesnt light, press the Power On/Off button on the extender. to light green. This might take up Continue with installation, using one of these methods:
To connect your extender using WPS, see the following section. Note: WPS doesnt support WEP network security. If you use WEP security, you must use the NETGEAR installation assistant. To connect your extender using the NETGEAR installation assistant, see Connect the extender to your WiFi network using the NETGEAR installation assistant on page 9. 6 Connect the extender to your WiFi network using WPS Wi-Fi Protected Setup (WPS) lets you join a secure WiFi network without selecting the network name and entering the password. 1. Press the WPS button on the extender until the WPS LED blinks green. 2. Within two minutes, press the WPS button on your router. The WPS LED on the extender lights solid green, the Router Link LED lights, and the extender connects to your WiFi network. If the Router Link LED doesnt light, try again. If it still doesnt light, see Connect the extender to your WiFi network using the NETGEAR installation assistant on page 9. Note: If your router supports the 5 GHz band and your extender didnt connect to that band, repeat the WPS process. 3. Unplug the extender and move it to a new location that is about halfway between your router and the area with a poor router WiFi signal. The extender must be within the range of your WiFi router network. 7 4. Plug the extender into an electrical outlet and wait for the Power LED to light green. 5. Use the Router Link LED to find a spot where the 6. extender-to-router connection is optimal. If the Router Link LED doesnt light amber or green, plug the extender into an outlet closer to the router and try again. Keep moving the extender to outlets closer to the router until the Router Link LED lights amber or green. 7. Connect your WiFi-enabled computer or mobile device to the WiFi network. Your extender uses the same WiFi name as your router, based on the WiFi band that it connects to first. Dual-band router WiFi names Extender connects to this network first Extender WiFi name for 2.4 GHz and 5 GHz MyWiFiExample MyWiFiExample-5G MyWiFiExample MyWiFiExample-5G MyWiFiExample MyWiFiExample MyWiFiExample-5G MyWiFiExample-5G 8 Connect the extender to your WiFi network using the NETGEAR installation assistant The installation assistant guides you through the steps to connect your extender to your WiFi network. 1. Connect your WiFi-enabled computer or mobile device to the extender using a WiFi or wired Ethernet or connection:
WiFi. On your WiFi-enabled computer or mobile device, join the the extender WiFi network NETGEAR_EXT. Note: NETGEAR_EXT is the extenders default WiFi network. Ethernet. Use an Ethernet cable to connect the Ethernet port on the extender to an Ethernet port on your WiFi-
enabled computer. When your WiFi-enabled computer or mobile device connects, the Client Link LED lights. 2. Launch a web browser and visit www.mywifiext.net. The NETGEAR installation assistant displays. 3. Follow the prompts to connect your extender to your WiFi network. 9 The Router Link LED the router WiFi network. lights when the extender connects to 4. Unplug the extender and move it to a new location about halfway between your router and the area with a poor WiFi signal. The extender must be within the range of your WiFi router network. 5. Plug the extender into an electrical outlet and wait for the Power LED to light green. 6. Use the Router Link LED to find a spot where the 7. extender-to-router connection is optimal. If the Router Link LED doesnt light amber or green, plug the extender into an outlet closer to the router and try again. Keep moving the extender to outlets closer to the router until the Router Link LED lights amber or green. 10 Install the extender as an access point You can use your extender as a WiFi access point, which creates a new WiFi hotspot by using a wired Ethernet connection. 1. Set the Access Point/Extender switch to Access Point 2. Plug the extender into an electrical outlet. The Power LED lights green. If the Power LED doesnt light, press the Power button. 11 3. Connect a computer or mobile device to the extender using a WiFi or Ethernet connection:
WiFi. On your WiFi-enabled computer or mobile device, join the extender WiFi network NETGEAR_EXT. Note: NETGEAR_EXT is the extenders default WiFi network. When your WiFi-enabled computer or mobile device is connected to the extender, the Client LED lights. Ethernet. Use an Ethernet cable to connect the Ethernet port on the extender to an Ethernet port on your computer. Note: You must do this before you connect your extender to your modem router or router. 4. Launch a web browser and visit www.mywifiext.net. The NETGEAR installation assistant displays. 5. Use an Ethernet cable to connect an Ethernet port on your router to the extenders Ethernet port. 12 Note: Dont connect your extender directly to your DSL or cable modem. The extender doesnt function as a router. If your network includes a DHCP server, you can connect the extender to a switch or hub that is connected to the DHCP server. 6. Return to the NETGEAR installation assistant and follow the prompts to finish setting up your extender as an access point Log in to the extender After installation, you can log in to the extender to view or change the extenders settings. 1. Launch a web browser from a computer or mobile device that is connected to your extender network. 2. Log in to your extender:
If you didnt enable the One WiFi Name feature, enter http://mywifiext.local/ in the address field of the browser. If you enabled the One WiFi Name feature, enter one of the following URLs:
- Windows-based computer. http://mywifiext/ or http://mywifiext.local/
13
- Mac computers, iOS devices, and Linux devices. http://mywifiext.local/
- Android devices. http://<extenders IP address>/ (for example, http://192.168.1.3/) To find your extenders IP address, do the following:
a. Log in to your router. b. Find the page in your router web interface that lists the devices connected to your router. c. Find your extender in the list and note your extenders IP address. d. Enter your extenders IP address in the address field of your web browser. A login page displays. 3. Enter your admin email address and password and click the LOG IN button. The Status page displays. 14 FAQs You can find more information about your product in the user manual, which is available at www.netgear.com/support. The NETGEAR installation assistant keeps asking for my network password (passphrase) or security key, and I am sure that I entered the correct password. What can I do?
The extender is probably placed at the borderline of the range covered by the router or access point. Move the extender closer to your router. If youre using WEP security, make sure that youre entering the network password in the correct field. Can I set up the extender in extender mode if I connect it to the router or access point with an Ethernet cable?
No. The extender is designed to connect wirelessly to the router or access point if it is in extender mode. If the extender is in access point mode, you can connect it to the router or access point with an Ethernet connection. For more information about access point mode, see Install the extender as an access point on page 11. 15 I forgot my login email and password. What can I do?
On the login page, click the Username & Password Help link to answer the security questions you set up during the initial setup. If you forgot the answers to your security questions, you can set up your login credentials again:
1. Restore the extender to its factory default settings. (See the following page.) 2. Launch a web browser from a computer or mobile device connected to your extender network. 3. Log in to your extender:
If you didnt enable the One WiFi Name feature, enter http://mywifiext.local/ in the address field of the browser. If you enabled the One WiFi Name feature, enter one of the following URLs:
- Windows-based computer. http://mywifiext/ or http://mywifiext.local/
- Mac computers, iOS devices, and Linux devices. http://mywifiext.local/
- Android devices. http://<extenders IP address>/ (for example, http://192.168.1.3/) 16 A login page displays. 4. Click the NEW EXTENDER SETUP button. 5. Complete the fields on the page. How do I restore the extender to its factory default settings?
1. Use a sharp object such as a pen or straightened paper clip to press and hold the Factory Reset button on the extender for at least five seconds until the Power LED blinks amber. 2. Release the Factory Reset button and wait for the extender to reboot. The extender resets and returns to the factory default settings. I enabled a WiFi MAC filter, wireless access control, or access control list (ACL) on my router. What should I do when installing the extender?
When a device connects through the extender to your router, the MAC address of the device shown on the router is translated to another MAC address. If your routers MAC filter, wireless access control, or ACL is enabled, the device connects to the extender but cant get an IP address from the extender and cant access the Internet. 17 To receive an IP address from the extender and access the Internet, you must provide the translated MAC address to the router. 1. Log in to your router and disable the MAC filter, wireless access control, or ACL. For more information about how to disable your routers MAC filter, wireless access control, or ACL, see your routers documentation. 2. Power on the extender and connect all your devices to the extender network. 3. Make sure that the Router Link LED remains lit. 4. Log in to your extender:
If you didnt enable the One WiFi Name feature, enter www.mywifiext.net in the address field of the browser. If you enabled the One WiFi Name feature, enter one of the following URLs:
Windows-based computer. http://mywifiext/ or http://mywifiext.local/
Mac computers, iOS devices, and Linux devices. http://mywifiext.local/
Android devices. http://<extenders IP address>/ (for example, http://192.168.1.3/) 18 A login page displays. 5. Select Settings > Connected Devices. The Connected Devices page displays the MAC addresses and virtual MAC addresses for the extender, wired devices, and WiFi devices that are connected to the extender. 6. On the router, add the extenders virtual MAC addresses and all the virtual MAC addresses of the devices connected to the extender to your routers MAC filter table. 7. Enable the routers MAC filter, wireless access control, or ACL. I am connected to NETGEAR_EXT and launched a browser. I cant see the NETGEAR installation assistant. What can I do?
Try these troubleshooting steps:
Make sure that your WiFi-enabled computer is set up to use DHCP (most are). Make sure that the Client Link LED is green and that youre using a valid IP address. Relaunch the web browser and enter www.mywifiext.net in the address field. Enter your email and password and click the LOG IN button. 19 Support Thank you for purchasing this NETGEAR product. You can visit https://www.netgear.com/support/ to register your product, get help, access the latest downloads and user manuals, and join our community. We recommend that you use only official NETGEAR support resources. Si ce produit est vendu au Canada, vous pouvez accder ce document en franais canadien https://www.netgear.com/support/download/.
(If this product is sold in Canada, you can access this document in Canadian French at https://www.netgear.com/support/download/.) For regulatory compliance information including the EU Declaration of Conformity, visit https://www.netgear.com/about/regulatory/. See the regulatory compliance document before connecting the power supply. NETGEAR INTL LTD Building 3, University Technology Centre Curraheen Road, Cork, Ireland NETGEAR, Inc., NETGEAR and the NETGEAR Logo are trademarks of NETGEAR, Inc. Any non-
NETGEAR trademarks are used for reference purposes only. NETGEAR, Inc. 350 East Plumeria Drive San Jose, CA 95134, USA December 2018
1 2 3 | User Manual-EX7300 | Users Manual | 1.44 MiB | January 20 2019 / July 20 2019 |
Quick StartAC2200 Nighthawk X4 WiFi Mesh Extender Model EX7300v2 Getting started Your extender boosts your routers WiFi signal and enhances the signal quality over long distances. WiFi router Sometimes your router doesnt provide the WiFi coverage that you need Extender Boosts the WiFi range and sends a stronger signal in hard-to-reach areas 2 Meet your extender Before you install your extender, learn about its LEDs, buttons, and port. Router Arrow LED Router Link LED Factory Reset button Power On/Off button WPS button Access Point/
Extender switch Client Arrow LED Client Link LED Power LED WPS LED Ethernet port
(on bottom panel) 3 LED Description Router Link LED Client Link LED Power LED WPS LED WiFi connection from the router to the extender:
Solid green. Best connection. Solid amber. Good connection. Solid red. Poor connection. Off. No connection. WiFi connection from your computer or mobile device to the extender:
Solid green. Best connection. Solid amber. Good connection. Solid red. Poor connection. Off. No connection. Solid amber. The extender is booting. Solid green. The extender is powered on. Off. The extender is powered off. Solid green. WiFi security is enabled (WPA or WPA2). Blinking green. A WPS connection is being established. Off. WiFi security isnt enabled. No arrow LEDs are lit. The extender is in a good location. Client Arrow LED blinks. Move the WiFi-enabled computer or mobile device closer to the extender. Router Arrow LED blinks. Move the extender closer to the router. 4 You can use your extender in extender mode or in access point mode. In extender mode, your extender repeats the signals from your WiFi router. After initial setup, the best location for the extender is about halfway between your router and the area with a poor WiFi signal. The extender must be within the range of your WiFi router network. In access point mode, your extender creates a new WiFi hotspot by using a wired Ethernet connection. 5 Install the extender in extender mode 1. Set the Access Point/Extender switch to Extender 2. For initial setup, place your extender in the same room as your
. WiFi router. 3. Plug the extender into an electrical outlet. Wait for the Power LED to 2 minutes. If the Power LED doesnt light, press the Power On/Off button on the extender. to light green. This might take up Continue with installation, using one of these methods:
To connect your extender using WPS, see the following section. Note: WPS doesnt support WEP network security. If you use WEP security, you must use the NETGEAR installation assistant. To connect your extender using the NETGEAR installation assistant, see Connect the extender to your WiFi network using the NETGEAR installation assistant on page 9. 6 Connect the extender to your WiFi network using WPS Wi-Fi Protected Setup (WPS) lets you join a secure WiFi network without selecting the network name and entering the password. 1. Press the WPS button on the extender until the WPS LED blinks green. 2. Within two minutes, press the WPS button on your router. The WPS LED on the extender lights solid green, the Router Link LED lights, and the extender connects to your WiFi network. If the Router Link LED doesnt light, try again. If it still doesnt light, see Connect the extender to your WiFi network using the NETGEAR installation assistant on page 9. Note: If your router supports the 5 GHz band and your extender didnt connect to that band, repeat the WPS process. 3. Unplug the extender and move it to a new location that is about halfway between your router and the area with a poor router WiFi signal. The extender must be within the range of your WiFi router network. 7 4. Plug the extender into an electrical outlet and wait for the Power LED to light green. 5. Use the Router Link LED to find a spot where the 6. extender-to-router connection is optimal. If the Router Link LED doesnt light amber or green, plug the extender into an outlet closer to the router and try again. Keep moving the extender to outlets closer to the router until the Router Link LED lights amber or green. 7. Connect your WiFi-enabled computer or mobile device to the WiFi network. Your extender uses the same WiFi name as your router, based on the WiFi band that it connects to first. Dual-band router WiFi names Extender connects to this network first Extender WiFi name for 2.4 GHz and 5 GHz MyWiFiExample MyWiFiExample-5G MyWiFiExample MyWiFiExample-5G MyWiFiExample MyWiFiExample MyWiFiExample-5G MyWiFiExample-5G 8 Connect the extender to your WiFi network using the NETGEAR installation assistant The installation assistant guides you through the steps to connect your extender to your WiFi network. 1. Connect your WiFi-enabled computer or mobile device to the extender using a WiFi or wired Ethernet or connection:
WiFi. On your WiFi-enabled computer or mobile device, join the the extender WiFi network NETGEAR_EXT. Note: NETGEAR_EXT is the extenders default WiFi network. Ethernet. Use an Ethernet cable to connect the Ethernet port on the extender to an Ethernet port on your WiFi-
enabled computer. When your WiFi-enabled computer or mobile device connects, the Client Link LED lights. 2. Launch a web browser and visit www.mywifiext.net. The NETGEAR installation assistant displays. 3. Follow the prompts to connect your extender to your WiFi network. 9 The Router Link LED the router WiFi network. lights when the extender connects to 4. Unplug the extender and move it to a new location about halfway between your router and the area with a poor WiFi signal. The extender must be within the range of your WiFi router network. 5. Plug the extender into an electrical outlet and wait for the Power LED to light green. 6. Use the Router Link LED to find a spot where the 7. extender-to-router connection is optimal. If the Router Link LED doesnt light amber or green, plug the extender into an outlet closer to the router and try again. Keep moving the extender to outlets closer to the router until the Router Link LED lights amber or green. 10 Install the extender as an access point You can use your extender as a WiFi access point, which creates a new WiFi hotspot by using a wired Ethernet connection. 1. Set the Access Point/Extender switch to Access Point 2. Plug the extender into an electrical outlet. The Power LED lights green. If the Power LED doesnt light, press the Power button. 11 3. Connect a computer or mobile device to the extender using a WiFi or Ethernet connection:
WiFi. On your WiFi-enabled computer or mobile device, join the extender WiFi network NETGEAR_EXT. Note: NETGEAR_EXT is the extenders default WiFi network. When your WiFi-enabled computer or mobile device is connected to the extender, the Client LED lights. Ethernet. Use an Ethernet cable to connect the Ethernet port on the extender to an Ethernet port on your computer. Note: You must do this before you connect your extender to your modem router or router. 4. Launch a web browser and visit www.mywifiext.net. The NETGEAR installation assistant displays. 5. Use an Ethernet cable to connect an Ethernet port on your router to the extenders Ethernet port. 12 Note: Dont connect your extender directly to your DSL or cable modem. The extender doesnt function as a router. If your network includes a DHCP server, you can connect the extender to a switch or hub that is connected to the DHCP server. 6. Return to the NETGEAR installation assistant and follow the prompts to finish setting up your extender as an access point Log in to the extender After installation, you can log in to the extender to view or change the extenders settings. 1. Launch a web browser from a computer or mobile device that is connected to your extender network. 2. Log in to your extender:
If you didnt enable the One WiFi Name feature, enter http://mywifiext.local/ in the address field of the browser. If you enabled the One WiFi Name feature, enter one of the following URLs:
- Windows-based computer. http://mywifiext/ or http://mywifiext.local/
13
- Mac computers, iOS devices, and Linux devices. http://mywifiext.local/
- Android devices. http://<extenders IP address>/ (for example, http://192.168.1.3/) To find your extenders IP address, do the following:
a. Log in to your router. b. Find the page in your router web interface that lists the devices connected to your router. c. Find your extender in the list and note your extenders IP address. d. Enter your extenders IP address in the address field of your web browser. A login page displays. 3. Enter your admin email address and password and click the LOG IN button. The Status page displays. 14 FAQs You can find more information about your product in the user manual, which is available at www.netgear.com/support. The NETGEAR installation assistant keeps asking for my network password (passphrase) or security key, and I am sure that I entered the correct password. What can I do?
The extender is probably placed at the borderline of the range covered by the router or access point. Move the extender closer to your router. If youre using WEP security, make sure that youre entering the network password in the correct field. Can I set up the extender in extender mode if I connect it to the router or access point with an Ethernet cable?
No. The extender is designed to connect wirelessly to the router or access point if it is in extender mode. If the extender is in access point mode, you can connect it to the router or access point with an Ethernet connection. For more information about access point mode, see Install the extender as an access point on page 11. 15 I forgot my login email and password. What can I do?
On the login page, click the Username & Password Help link to answer the security questions you set up during the initial setup. If you forgot the answers to your security questions, you can set up your login credentials again:
1. Restore the extender to its factory default settings. (See the following page.) 2. Launch a web browser from a computer or mobile device connected to your extender network. 3. Log in to your extender:
If you didnt enable the One WiFi Name feature, enter http://mywifiext.local/ in the address field of the browser. If you enabled the One WiFi Name feature, enter one of the following URLs:
- Windows-based computer. http://mywifiext/ or http://mywifiext.local/
- Mac computers, iOS devices, and Linux devices. http://mywifiext.local/
- Android devices. http://<extenders IP address>/ (for example, http://192.168.1.3/) 16 A login page displays. 4. Click the NEW EXTENDER SETUP button. 5. Complete the fields on the page. How do I restore the extender to its factory default settings?
1. Use a sharp object such as a pen or straightened paper clip to press and hold the Factory Reset button on the extender for at least five seconds until the Power LED blinks amber. 2. Release the Factory Reset button and wait for the extender to reboot. The extender resets and returns to the factory default settings. I enabled a WiFi MAC filter, wireless access control, or access control list (ACL) on my router. What should I do when installing the extender?
When a device connects through the extender to your router, the MAC address of the device shown on the router is translated to another MAC address. If your routers MAC filter, wireless access control, or ACL is enabled, the device connects to the extender but cant get an IP address from the extender and cant access the Internet. 17 To receive an IP address from the extender and access the Internet, you must provide the translated MAC address to the router. 1. Log in to your router and disable the MAC filter, wireless access control, or ACL. For more information about how to disable your routers MAC filter, wireless access control, or ACL, see your routers documentation. 2. Power on the extender and connect all your devices to the extender network. 3. Make sure that the Router Link LED remains lit. 4. Log in to your extender:
If you didnt enable the One WiFi Name feature, enter www.mywifiext.net in the address field of the browser. If you enabled the One WiFi Name feature, enter one of the following URLs:
Windows-based computer. http://mywifiext/ or http://mywifiext.local/
Mac computers, iOS devices, and Linux devices. http://mywifiext.local/
Android devices. http://<extenders IP address>/ (for example, http://192.168.1.3/) 18 A login page displays. 5. Select Settings > Connected Devices. The Connected Devices page displays the MAC addresses and virtual MAC addresses for the extender, wired devices, and WiFi devices that are connected to the extender. 6. On the router, add the extenders virtual MAC addresses and all the virtual MAC addresses of the devices connected to the extender to your routers MAC filter table. 7. Enable the routers MAC filter, wireless access control, or ACL. I am connected to NETGEAR_EXT and launched a browser. I cant see the NETGEAR installation assistant. What can I do?
Try these troubleshooting steps:
Make sure that your WiFi-enabled computer is set up to use DHCP (most are). Make sure that the Client Link LED is green and that youre using a valid IP address. Relaunch the web browser and enter www.mywifiext.net in the address field. Enter your email and password and click the LOG IN button. 19 Support Thank you for purchasing this NETGEAR product. You can visit https://www.netgear.com/support/ to register your product, get help, access the latest downloads and user manuals, and join our community. We recommend that you use only official NETGEAR support resources. Si ce produit est vendu au Canada, vous pouvez accder ce document en franais canadien https://www.netgear.com/support/download/.
(If this product is sold in Canada, you can access this document in Canadian French at https://www.netgear.com/support/download/.) For regulatory compliance information including the EU Declaration of Conformity, visit https://www.netgear.com/about/regulatory/. See the regulatory compliance document before connecting the power supply. NETGEAR INTL LTD Building 3, University Technology Centre Curraheen Road, Cork, Ireland NETGEAR, Inc., NETGEAR and the NETGEAR Logo are trademarks of NETGEAR, Inc. Any non-
NETGEAR trademarks are used for reference purposes only. NETGEAR, Inc. 350 East Plumeria Drive San Jose, CA 95134, USA December 2018
1 2 3 | User Manual-statement | Users Manual | 12.23 KiB | January 20 2019 / July 20 2019 |
Federal Communication Commission Interference Statement This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one of the following measures:
-
-
- Connect the equipment into an outlet on a circuit different from that to which the receiver is Reorient or relocate the receiving antenna. Increase the separation between the equipment and receiver. connected. Consult the dealer or an experienced radio/TV technician for help.
-
FCC Caution: Any changes or modifications not expressly approved by the party responsible for compliance could void the user's authority to operate this equipment. This transmitter must not be co-located or operating in conjunction with any other antenna or transmitter. Operations in the 5.15-5.25GHz band are restricted to indoor usage only. This device meets all the other requirements specified in Part 15E, Section 15.407 of the FCC Rules. Radiation Exposure Statement This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment. This equipment should be installed and operated with minimum distance 21cm between the radiator & your body.
1 2 3 | Internal photos | Internal Photos | 1.60 MiB | January 20 2019 / July 20 2019 |
CONSTRUCTION PHOTOS OF EUT Model: EX7300v2 Report No.: 181023C12 Page No. 1 / 19 Report No.: 181023C12 Page No. 2 / 19 Report No.: 181023C12 Page No. 3 / 19 Report No.: 181023C12 Page No. 4 / 19 Report No.: 181023C12 Page No. 5 / 19 Report No.: 181023C12 Page No. 6 / 19 Report No.: 181023C12 Page No. 7 / 19 Report No.: 181023C12 Page No. 8 / 19 Report No.: 181023C12 Page No. 9 / 19 Model: EX6400v2 Report No.: 181023C12 Page No. 10 / 19 Report No.: 181023C12 Page No. 11 / 19 Report No.: 181023C12 Page No. 12 / 19 Report No.: 181023C12 Page No. 13 / 19 Report No.: 181023C12 Page No. 14 / 19 Report No.: 181023C12 Page No. 15 / 19 Report No.: 181023C12 Page No. 16 / 19 Report No.: 181023C12 Page No. 17 / 19 Report No.: 181023C12 Page No. 18 / 19 Report No.: 181023C12 Page No. 19 / 19
1 2 3 | External Photos | External Photos | 908.74 KiB | January 20 2019 / July 20 2019 |
CONSTRUCTION PHOTOS OF EUT Model: EX7300v2 Report No.: 181023C12-1 Page No. 1 / 7 Report No.: 181023C12-1 Page No. 2 / 7 Report No.: 181023C12-1 Page No. 3 / 7 Model: EX6400v2 Report No.: 181023C12-1 Page No. 4 / 7 Report No.: 181023C12-1 Page No. 5 / 7 Report No.: 181023C12-1 Page No. 6 / 7 Report No.: 181023C12-1 Page No. 7 / 7
1 2 3 | Label | ID Label/Location Info | 300.72 KiB | January 20 2019 |
REV 01 DESCRIPTION OF REVISION TITLE FROM RANGE TO MESH ENG APPD DATE M HUMPHREY 28SEP18 NOTE:
1. REFER TO NETGEAR SPEC. DOC-00093 FOR COLOR TOLERANCES. Made In China 2. INK COLOR IS SHOWN TO THE RIGHT. 3. DIE LINES ARE MAGENTA COLOR AND DO NOT PRINT. Black White Pantone Cool Gray 7C -
NETGEAR 490-10039-01 AUTHOR:
M HUMPHREY TITLE:
AW,PLBL,EX7300NA,V2 SHEET:
1 of 1 THIS DOCUMENT AND THE DATA DISCLOSED HEREIN OR WHEREWITH IS NOT TO BE REPRODUCED, USED OR DISCLOSED IN WHOLE OR IN PART TO ANYONE WITHOUT THE PERMISSION OF NETGEAR, INC. P/N:
AW-14072-02 REV:
01
1 2 3 | Label location | ID Label/Location Info | 30.90 KiB | January 20 2019 |
Rear View FCC ID: PY318300422 IC: 4054A-18300422
1 2 3 | Class II Permissive Change Request Letter | Cover Letter(s) | 16.17 KiB | / December 02 2019 |
FCC ID: PY318300422 Description of Permissive Change The application is prepared for FCC class II permissive change by adding 5.26GHz to 5.32GHz and 5.50GHz to 5.72GHz bands through software enabling to its original parent application. Amanda Wu / Senior Specialist Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Tel: 886-3-318 3232 ext. 1929 Fax: 886-3-327 0892 Email: amanda.wu@tw.bureauveritas.com
1 2 3 | Co-Location Test Report | Test Report | 318.82 KiB | / December 02 2019 |
FCC Test Report
(Co-Located) Report No.: RF181023C12A-1 FCC ID: PY318300422 Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Received Date: Oct. 23, 2018 Test Date: Dec. 13, 2018 Issued Date: Jan. 07, 2019 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan
(R.O.C.) Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth our findings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies. Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 1 / 24 Report Format Version: 6.1.1 Table of Contents 4 3 Release Control Record .................................................................................................................................. 3 Certificate of Conformity ...................................................................................................................... 4 1 Summary of Test Results ..................................................................................................................... 5 2 2.1 Measurement Uncertainty ................................................................................................................... 5 2.2 Modification Record ............................................................................................................................ 5 General Information .............................................................................................................................. 6 3.1 General Description of EUT ................................................................................................................ 6 3.2 Description of Test Modes ................................................................................................................... 9 3.2.1 Test Mode Applicability and Tested Channel Detail ............................................................................ 11 3.3 Description of Support Units ............................................................................................................. 12 3.3.1 Configuration of System under Test .................................................................................................. 12 3.4 General Description of Applied Standards ........................................................................................ 12 Test Types and Results ...................................................................................................................... 13 4.1 Radiated Emission and Bandedge Measurement ............................................................................. 13 4.1.1 Limits of Radiated Emission and Bandedge Measurement .............................................................. 13 4.1.2 Test Instruments ................................................................................................................................ 14 4.1.3 Test Procedures ................................................................................................................................. 15 4.1.4 Deviation from Test Standard ............................................................................................................ 15 4.1.5 Test Setup .......................................................................................................................................... 16 4.1.6 EUT Operating Conditions ................................................................................................................. 17 4.1.7 Test Results ....................................................................................................................................... 18 4.2 Conducted Out of Band Emission Measurement .............................................................................. 21 4.2.1 Limits of Conducted Out of Band Emission Measurement ................................................................ 21 4.2.2 Test Setup .......................................................................................................................................... 21 4.2.3 Test Instruments ................................................................................................................................ 21 4.2.4 Test Procedure .................................................................................................................................. 21 4.2.5 Deviation from Test Standard ............................................................................................................ 21 4.2.6 EUT Operating Condition .................................................................................................................. 21 4.2.7 Test Results ....................................................................................................................................... 22 5 Pictures of Test Arrangements .......................................................................................................... 23 Appendix Information on the Testing Laboratories ................................................................................ 24 Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 2 / 24 Report Format Version: 6.1.1 Issue No. RF181023C12A-1 Original release Description Release Control Record Date Issued Jan. 07, 2019 Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 3 / 24 Report Format Version: 6.1.1 1 Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender (refer to item 3.1 for more details) Brand: NETGEAR Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Dec. 13, 2018 Standards: 47 CFR FCC Part 15, Subpart C (Section 15.247) 47 CFR FCC Part 15, Subpart E (Section 15.407) ANSI C63.10-2013 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Jan. 07, 2019 Approved by :
, Date:
Jan. 07, 2019 Bruce Chen / Project Engineer Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 4 / 24 Report Format Version: 6.1.1 2 Summary of Test Results Applied Standard:
47 CFR FCC Part 15, Subpart C (Section 15.247) 47 CFR FCC Part 15, Subpart E (Section 15.407) FCC Clause 15.205 / 15.209 /
15.247(d) 15.407(b)
(1/2/3/4(i/ii)/6) Test Item Radiated Emissions Result Pass Remarks Meet the requirement of limit. Minimum passing margin is -4.3dB at 41.57MHz. 2.1 Measurement Uncertainty Where relevant, the following measurement uncertainty levels have been estimated for tests performed on the EUT as specified in CISPR 16-4-2:
Measurement Radiated Emissions up to 1 GHz Radiated Emissions above 1 GHz Frequency 30MHz ~ 200MHz 200MHz ~1000MHz 1GHz ~ 18GHz 18GHz ~ 40GHz 2.2 Modification Record There were no modifications required for compliance. Expanded Uncertainty
(k=2) () 3.63 dB 3.64 dB 2.29 dB 2.29 dB Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 5 / 24 Report Format Version: 6.1.1 3 General Information 3.1 General Description of EUT Product Brand Test Model Series Model Model Difference Status of EUT Power Supply Rating Modulation Type Transfer Rate Operating Frequency Number of Channel Output Power Nighthawk X4 AC2200 WiFi Mesh Extender (refer to note for more details) NETGEAR EX7300v2 EX6400v2 Refer to Note Engineering sample 100-240Vac CCK, DQPSK, DBPSK for DSSS 256QAM, 64QAM, 16QAM, QPSK, BPSK for OFDM 802.11b:11/5.5/2/1Mbps 802.11a/g: 54/48/36/24/18/12/9/6Mbps 802.11a: 54/48/36/24/18/12/9/6Mbps 802.11n: up to 600Mbps 802.11ac: 1733.3Mbps 2.4GHz: 2412 ~ 2462MHz 5.0GHz: 5260 ~ 5320MHz, 5500 ~ 5720MHz 2412 ~ 2462MHz:
802.11b, 802.11g, 802.11n (HT20): 11 802.11n (HT40): 7 5260 ~ 5320MHz:
802.11a, 802.11n (HT20), 802.11ac (VHT20): 4 802.11n (HT40), 802.11ac (VHT40): 2 802.11ac (VHT80): 1 5500 ~ 5720MHz:
802.11a, 802.11n (HT20), 802.11ac (VHT20): 12 802.11n (HT40), 802.11ac (VHT40): 6 802.11ac (VHT80): 3 Model: EX7300v2:
CDD Mode:
2412 ~ 2462MHz: 415.816mW Model: EX6400v2:
CDD Mode:
2412 ~ 2462MHz: 307.423mW Model: EX7300v2/ EX6400v2 5260 ~ 5320MHz: 231.217mW 5500 ~ 5720MHz: 215.895mW Beamforming Mode:
5260 ~ 5320MHz: 231.217mW 5500 ~ 5720MHz: 215.895mW Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 6 / 24 Report Format Version: 6.1.1 Refer to note Refer to note NA NA Antenna Type Antenna Connector Accessory Device Cable Supplied Note:
1. This report is prepared for FCC class II permissive change. The differences compared with the original report (BV CPS report no.: RF181023C12-2) are adding 5.26GHz to 5.32GHz and 5.50GHz to 5.72GHz by software. 2. All models are listed as below. Product Name Brand Model NETGEAR Nighthawk X4 AC2200 WiFi Mesh Extender EX7300v2 AC1900 WiFi Mesh Extender EX6400v2 Difference The listed models are electrically and mechanically identical. The intention of these models is only for RF output transmit antenna (EX7300v2 2.4G: 4T4R;
EX6400v2 2.4G: 3T3R) and different NETGEAR logo
(EX7300v2 has silver coating. EX6400v2 has no silver coating) purpose.
* For above two model are presented in power output test item. For other test items, model EX7300v2 is the worst case for final tests after pretesting. 3. The EUT incorporates a MIMO function. Physically, the EUT provides 4 completed transmitters and 4 receivers. Band Modulation Mode TX Function 2.4GHz 5GHz 2.4GHz 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) 802.11a 802.11n (HT20) 802.11n (HT40) 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) 4TX 4TX 4TX 4TX 4TX 4TX 4TX 4TX 4TX 4TX 3TX 3TX 3TX 3TX Beamforming Not Support Not Support Not Support Not Support Not Support Support Support Support Support Support Not Support Not Support Not Support Not Support Model EX7300v2 EX6400v2
* The modulation and bandwidth are similar for 802.11n mode for 20MHz/40MHz and 802.11ac mode for 20MHz/40MHz, therefore investigated worst case to representative mode in test report. (Final test mode refer section 3.2.1) Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 7 / 24 Report Format Version: 6.1.1 4. The EUT uses following antennas. For 2.4GHz Band Model: EX6400v2 Ant. Type Connecter Type Model: EX7300v2 Ant. Type Connecter Type For 5GHz Band Model: EX6400v2 & EX7300v2 Ant. Type Connecter Type Frequency 5150~5250MHz 5250~5350MHz 5470~5725MHz 5725~5850MHz PIFA NA Directional Antenna Gain (dBi) 6.07 PIFA NA Directional Antenna Gain (dBi) 7.60 PIFA NA Directional Gain (dBi) 5.49 5.48 5.11 5.14 Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 8 / 24 Report Format Version: 6.1.1 3.2 Description of Test Modes For 2.4GHz 11 channels are provided for 802.11b, 802.11g and 802.11n (HT20):
Channel Frequency 2412MHz 2417MHz 2422MHz 2427MHz 2432MHz 2437MHz 7 channels are provided for 802.11n (HT40):
1 2 3 4 5 6 Channel 3 4 5 6 Frequency 2422MHz 2427MHz 2432MHz 2437MHz For 5260 ~ 5320MHz:
4 channels are provided for 802.11a, 802.11n (HT20):
Channel 52 56 Frequency 5260 MHz 5280 MHz 2 channels are provided for 802.11n (HT40):
Channel 54 Frequency 5270 MHz 1 channel is provided for 802.11ac (VHT80):
Channel 58 Frequency 5290MHz Channel 7 8 9 10 11 Channel 7 8 9 Channel 60 64 Channel 62 Frequency 2442MHz 2447MHz 2452MHz 2457MHz 2462MHz Frequency 2442MHz 2447MHz 2452MHz Frequency 5300 MHz 5320 MHz Frequency 5310 MHz Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 9 / 24 Report Format Version: 6.1.1 For 5500 ~ 5720MHz:
12 channels are provided for 802.11a, 802.11n (HT20), 802.11ac (VHT20):
Channel 100 104 108 112 116 120 Frequency 5500 MHz 5520 MHz 5540 MHz 5560 MHz 5580 MHz 5600 MHz Channel 124 128 132 136 140 144 6 channels are provided for 802.11n (HT40), 802.11ac (VHT40):
Channel 102 110 118 Frequency 5510 MHz 5550 MHz 5590 MHz 3 channels are provided for 802.11ac (VHT80):
Frequency 5530 MHz 5690 MHz 106 138 Channel Channel 126 134 142 Channel 122 Frequency 5620 MHz 5640 MHz 5660 MHz 5680 MHz 5700 MHz 5720 MHz Frequency 5630 MHz 5670 MHz 5710 MHz Frequency 5610 MHz Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 10 / 24 Report Format Version: 6.1.1 3.2.1 Test Mode Applicability and Tested Channel Detail EUT Configure Mode
-
Where Applicable to RE1G RE<1G OB
-
RE1G: Radiated Emission above 1GHz & Bandedge Measurement OB: Conducted Out-Band Emission Measurement Description RE<1G: Radiated Emission below 1GHz Note: The EUT had been pre-tested on the positioned of each 3 axis. The worst case was found when positioned on Z-plane. Radiated Emission Test (Above 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. Mode Freq. Range (MHz) Available Channel Tested Channel
-
802.11g +
802.11a 2412 ~ 2462 5260 ~ 5320 5500 ~ 5720 1 to 11 52 to 64 100 to 144 6 + 52 Radiated Emission Test (Below 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. Mode Freq. Range (MHz) Available Channel Tested Channel
-
802.11g +
802.11a 2412 ~ 2462 5260 ~ 5320 5500 ~ 5720 1 to 11 52 to 64 100 to 144 6 + 52 Conducted Out-Band Emission Measurement Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. Mode Freq. Range (MHz) Available Channel Tested Channel
-
802.11g +
802.11a 2412 ~ 2462 5260 ~ 5320 5500 ~ 5720 1 to 11 52 to 64 100 to 144 6 + 52 EUT Configure Mode EUT Configure Mode EUT Configure Mode Modulation Technology OFDM OFDM OFDM Modulation Technology OFDM OFDM OFDM Modulation Technology OFDM OFDM OFDM Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 11 / 24 Report Format Version: 6.1.1 Test Condition:
Applicable to Environmental Conditions RE1G RE<1G OB 25deg. C, 70%RH 25deg. C, 70%RH 25deg. C, 75%RH Input Power 120Vac, 60Hz 120Vac, 60Hz 120Vac, 60Hz Tested by Luis Lee Luis Lee Noah Chang 3.3 Description of Support Units The EUT has been tested as an independent unit together with other necessary accessories or support units. The following support units or accessories were used to form a representative test configuration during the tests. ID A. Serial No. 1HC2XM1 FCC DoC Approved -
Product Notebook Brand DELL Model No. Remarks FCC ID E5410 Note:
1. All power cords of the above support units are non-shielded (1.8m). 2. Item A acted as a communication partner to transfer data. ID Descriptions Qty. Length (m) Shielding
(Yes/No) Cores (Qty.) Remarks 1. RJ45, Cat5e 1 6 N 0
-
(1) EUT 3.3.1 Configuration of System under Test 3.4 General Description of Applied Standards The EUT is a RF Product. According to the specification of the EUT declared by the manufacturer, it must comply with the requirements of the following standards:
FCC Part 15, Subpart C (15.247) FCC Part 15, Subpart E (15.407) ANSI C63.10-2013 All test items have been performed and recorded as per the above standards. Notebook (A) Remote site Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 12 / 24 Report Format Version: 6.1.1 Test Types and Results 4 4.1 Radiated Emission and Bandedge Measurement 4.1.1 Limits of Radiated Emission and Bandedge Measurement Radiated emissions which fall in the restricted bands must comply with the radiated emission limits specified as below table. Other emissions shall be at least 30dB below the highest level of the desired power:
Frequencies (MHz) Field Strength (microvolts/meter) Measurement Distance (meters) 0.009 ~ 0.490 0.490 ~ 1.705 1.705 ~ 30.0 30 ~ 88 88 ~ 216 216 ~ 960 Above 960 2400/F(kHz) 24000/F(kHz) 30 100 150 200 500 300 30 30 3 3 3 3 Note:
1. The lower limit shall apply at the transition frequencies. 2. Emission level (dBuV/m) = 20 log Emission level (uV/m). 3. For frequencies above 1000MHz, the field strength limits are based on average detector, however, the peak field strength of any emission shall not exceed the maximum permitted average limits, specified above by more than 20dB under any condition of modulation. Limits of unwanted emission out of the restricted bands Applicable To 789033 D02 General UNII Test Procedure New Rules v02r01 Limit Field Strength at 3m PK: 74 (dBV/m) AV: 54 (dBV/m) Frequency Band Applicable To EIRP Limit Equivalent Field Strength at 3m 5150~5250 MHz 5250~5350 MHz 5470~5725 MHz 15.407(b)(1) 15.407(b)(2) 15.407(b)(3) PK: -27 (dBm/MHz) PK: 68.2(dBV/m) 5725~5850 MHz 15.407(b)(4)(i) PK: -27 (dBm/MHz) *1 PK: 10 (dBm/MHz) *2 PK: 15.6 (dBm/MHz) *3 PK: 27 (dBm/MHz) *4 PK: 68.2(dBV/m) *1 PK: 105.2 (dBV/m) *2 PK: 110.8(dBV/m) *3 PK: 122.2 (dBV/m) *4 15.407(b)(4)(ii) Emission limits in section 15.247(d)
*1 beyond 75 MHz or more above of the band edge.
*3 below the band edge increasing linearly to a level of 15.6 dBm/MHz at 5 MHz above.
*2 below the band edge increasing linearly to 10 dBm/MHz at 25 MHz above.
*4 from 5 MHz above or below the band edge increasing linearly to a level of 27 dBm/MHz at the band edge. Note: The following formula is used to convert the equipment isotropic radiated power (eirp) to field strength:
V/m, where P is the eirp (Watts). 1000000 3 E =
30 P Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 13 / 24 Report Format Version: 6.1.1 45745 ESIB7 8447D FSP40 100040 Cal. Due Cal. Date 9168-155 HLA 6121 Model No. VULB9168 BBHA 9170 9120D-1170 BBHA 9120D BBHA9170241 Serial No. 100187 May 29, 2018 May 28, 2019 Jun. 14, 2018 Jun. 13, 2019 Mar. 25, 2018 Mar. 24, 2019 Nov. 25, 2018 Nov. 24, 2019 Nov. 21, 2018 Nov. 20, 2019 Sep. 25, 2018 Sep. 24, 2019 4.1.2 Test Instruments Description & Manufacturer Test Receiver ROHDE & SCHWARZ Spectrum Analyzer ROHDE & SCHWARZ BILOG Antenna SCHWARZBECK HORN Antenna SCHWARZBECK HORN Antenna SCHWARZBECK Loop Antenna TESEQ Preamplifier Agilent
(Below 1GHz) Preamplifier KEYSIGHT
(Above 1GHz) RF signal cable HUBER+SUHNER RF signal cable HUBER+SUHNER Software BV ADT Antenna Tower inn-co GmbH Antenna Tower Controller BV ADT Turn Table BV ADT Turn Table Controller BV ADT Boresight Antenna Fixture Pre-amplifier (18GHz-40GHz) EMC Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are traceable SUCOFLEX 104 Cable-CH4-03 (250724) Aug. 08, 2018 Aug. 07, 2019 ADT_Radiated_ MY 13380+295012/04 Aug. 08, 2018 Aug. 07, 2019 SC93021703 FBA-SIP01 Aug. 08, 2018 Aug. 07, 2019 Nov. 14, 2018 Nov. 13, 2019 V7.6.15.9.5 MA 4000 SC100 FBA-01 SUCOFLEX 104 EMC184045B MY53270295 Jul. 02, 2018 TT93021703 2944A10631 AT93021703 Jul. 01, 2019 NA NA NA NA 83017A 010303 980175 TT100 AT100 NA NA NA NA NA NA NA NA NA to NML/ROC and NIST/USA. 2. The test was performed in HwaYa Chamber 4. 3. The FCC Designation Number is TW0003. The number will be varied with the Lab location and scope as attached. 4. The IC Site Registration No. is 7450F-4. Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 14 / 24 Report Format Version: 6.1.1 4.1.3 Test Procedures For Radiated emission below 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters above the ground at a 3 meter chamber room. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. Parallel, perpendicular, and ground-parallel orientations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to Quasi-Peak Detect Function and Specified Bandwidth with Maximum Hold Mode. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 9kHz at frequency below 30MHz. For Radiated emission above 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters (for 30MHz ~ 1GHz) / 1.5 meters (for above 1GHz) above the ground at 3 meter chamber room for test. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. The height of antenna is varied from one meter to four meters above the ground to determine the maximum value of the field strength. Both horizontal and vertical polarizations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and then the antenna was tuned to heights from 1 meter to 4 meters and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to quasi-peak detect function and specified bandwidth with maximum f. hold mode when the test frequency is below 1 GHz. The test-receiver system was set to peak and average detect function and specified bandwidth with maximum hold mode when the test frequency is above 1 GHz. If the peak reading value also meets average limit, measurement with the average detector is unnecessary. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 120kHz for Quasi-peak detection (QP) at frequency below 1GHz. 2. The resolution bandwidth of test receiver/spectrum analyzer is 1 MHz and the video bandwidth is 3 MHz for Peak detection (PK) at frequency above 1GHz. 3. The resolution bandwidth of test receiver/spectrum analyzer is 1MHz and the video bandwidth is 1/T
(Duty cycle < 98%) or 10Hz (Duty cycle 98%) for Average detection (AV) at frequency above 1GHz. 4. All modes of operation were investigated and the worst-case emissions are reported. 4.1.4 Deviation from Test Standard No deviation. Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 15 / 24 Report Format Version: 6.1.1 4.1.5 Test Setup For Radiated emission below 30MHz 1 m EUT&
Support Units 80cm 3m Turn Table Ground Plane Test Receiver For Radiated emission 30MHz to 1GHz EUT&
Support Units 80cm 3m 10m Turn Table Ant. Tower 1-4m Variable Ground Plane Test Receiver Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 16 / 24 Report Format Version: 6.1.1 For Radiated emission above 1GHz EUT&
Support Units 3m Ant. Tower 1-4m Variable Turn Table Absorber 150cm Ground Plane Test Receiver For the actual test configuration, please refer to the attached file (Test Setup Photo). 4.1.6 EUT Operating Conditions a. Placed the EUT on the testing table. b. Prepared a notebook to act as a communication partner and placed it outside of testing area. c. The communication partner connected with EUT via a RJ45 cable and ran a test program (provided by manufacturer) to enable EUT under transmission condition continuously at specific channel frequency. d. The communication partner sent data to EUT by command "PING". Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 17 / 24 Report Format Version: 6.1.1 4.1.7 Test Results Above 1GHz Data:
802.11g + 802.11a CHANNEL CH 6 + CH 52 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE NO. FREQ. (MHz) 1 2 3 4 5 6 7 8 9
*2437.00
*2437.00 4874.00 4874.00 5150.00 5150.00
*5260.00
*5260.00 11520.00 LEVEL
(dBuV/m) 110.4 PK 100.4 AV 52.4 PK 38.9 AV 59.7 PK 46.4 AV 114.7 PK 104.2 AV 62.8 PK LIMIT
(dBuV/m) 74.0 54.0 74.0 54.0 74.0
-21.6
-15.1
-14.3
-7.6
-11.2 1.39 H 1.39 H 2.01 H 2.01 H 1.20 H 1.20 H 1.20 H 1.20 H 3.02 H 219 219 303 303 237 237 237 237 244
(dBuV) 77.0 67.0 40.0 26.5 47.9 34.6 74.2 63.7 39.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION LEVEL
(dBuV/m) 116.9 PK 106.8 AV 52.9 PK 39.9 AV 60.7 PK 47.4 AV 119.4 PK 108.7 AV 62.8 PK NO. FREQ. (MHz) 1 2 3 4 5 6 7 8 9
*2437.00
*2437.00 4874.00 4874.00 5150.00 5150.00
*5260.00
*5260.00
#10520.00 Remarks:
LIMIT
(dBuV/m) MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE
(dBuV) 74.0 54.0 74.0 54.0 68.2
-21.1
-14.1
-13.3
-6.6
-5.4 1.99 V 1.99 V 3.09 V 3.09 V 2.00 V 2.00 V 2.00 V 2.00 V 3.02 V 284 284 211 211 167 167 167 167 211 83.5 73.4 40.5 27.5 48.9 35.6 78.9 68.2 40.5 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 11.8 11.8 40.5 40.5 23.3 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 11.8 11.8 40.5 40.5 22.3 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 18 / 24 Report Format Version: 6.1.1 Below 1GHz data 802.11g + 802.11a CHANNEL CH 6 + CH 52 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE NO. FREQ. (MHz) 1 2 3 4 5 6 55.18 123.23 187.39 257.38 337.10 663.74 Remarks:
LEVEL
(dBuV/m) 27.3 QP 29.1 QP 21.7 QP 23.4 QP 25.2 QP 26.1 QP LIMIT
(dBuV/m) 40.0 43.5 43.5 46.0 46.0 46.0
-12.7
-14.4
-21.8
-22.6
-20.8
-19.9 1.00 H 1.50 H 1.00 H 1.00 H 1.00 H 1.50 H 79 95 251 168 251 129 CORRECTION FACTOR
(dB/m)
-9.2
-10.9
-10.9
-9.2
-7.4
-1.3
(dBuV) 36.5 40.0 32.6 32.6 32.6 27.4 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit of frequency range 30MHz ~ 1000MHz 4. Margin value = Emission Level Limit value 5. The emission levels were very low against the limit of frequency range 9kHz ~ 30MHz: the amplitude of spurious emissions attenuated more than 20 dB below the permissible value to be report Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 19 / 24 Report Format Version: 6.1.1 CHANNEL CH 6 + CH 52 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION LEVEL
(dBuV/m) 35.7 QP 26.6 QP 25.9 QP 25.1 QP 27.5 QP 26.6 QP LIMIT
(dBuV/m) MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE
(dBuV) 40.0 43.5 43.5 46.0 46.0 46.0
-4.3
-16.9
-17.6
-20.9
-18.5
-19.4 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 301 7 7 331 81 7 44.8 39.3 35.2 34.1 34.9 28.6 CORRECTION FACTOR
(dB/m)
-9.1
-12.7
-9.3
-9.0
-7.4
-2.0 NO. FREQ. (MHz) 1 2 3 4 5 6 41.57 103.78 138.78 265.16 337.10 615.13 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit of frequency range 30MHz ~ 1000MHz 4. Margin value = Emission Level Limit value 5. The emission levels were very low against the limit of frequency range 9kHz ~ 30MHz: the amplitude of spurious emissions attenuated more than 20 dB below the permissible value to be report Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 20 / 24 Report Format Version: 6.1.1 EUT Attenuator SPECTRUM ANALYZER 4.2 Conducted Out of Band Emission Measurement 4.2.1 Limits of Conducted Out of Band Emission Measurement Below -30dB of the highest emission level of operating band (in 100kHz Resolution Bandwidth). 4.2.2 Test Setup 4.2.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.2.4 Test Procedure MEASUREMENT PROCEDURE REF a. Set the RBW = 100 kHz. b. Set the VBW 300 kHz. c. Detector = peak. d. Sweep time = auto couple. e. Trace mode = max hold. f. Allow trace to fully stabilize. g. Use the peak marker function to determine the maximum power level in any 100 kHz band segment within the fundamental EBW. MEASUREMENT PROCEDURE OOBE a. Set RBW = 100 kHz. b. Set VBW 300 kHz. c. Detector = peak. d. Sweep = auto couple. e. Trace Mode = max hold. f. Allow trace to fully stabilize. g. Use the peak marker function to determine the maximum amplitude level. 4.2.5 Deviation from Test Standard No deviation. 4.2.6 EUT Operating Condition The software provided by client to enable the EUT under transmission condition continuously at lowest, middle and highest channel frequencies individually. Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 21 / 24 Report Format Version: 6.1.1 4.2.7 Test Results The spectrum plots are attached on the following pages. D1 line indicates the highest level, and D2 line indicates the 30dB offset below D1. It shows compliance with the requirement. 802.11g CH 6 + 802.11a CH 52 Chain 0 Chain 1 Chain 2 Chain 3 Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 22 / 24 Report Format Version: 6.1.1 5 Pictures of Test Arrangements Please refer to the attached file (Test Setup Photo). Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 23 / 24 Report Format Version: 6.1.1 Appendix Information on the Testing Laboratories We, Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, were founded in 1988 to provide our best service in EMC, Radio, Telecom and Safety consultation. Our laboratories are FCC recognized accredited test firms and accredited and approved according to ISO/IEC 17025. If you have any comments, please feel free to contact us at the following:
Linko EMC/RF Lab Tel: 886-2-26052180 Fax: 886-2-26051924 Hwa Ya EMC/RF/Safety Lab Tel: 886-3-3183232 Fax: 886-3-3270892 Email: service.adt@tw.bureauveritas.com Web Site: www.bureauveritas-adt.com Hsin Chu EMC/RF/Telecom Lab Tel: 886-3-6668565 Fax: 886-3-6668323 The address and road map of all our labs can be found in our web site also.
--- END ---
Report No.: RF181023C12A-1 Reference No.: 181023C11 Page No. 24 / 24 Report Format Version: 6.1.1
1 2 3 | Confidentiality Request Letter | Cover Letter(s) | 63.82 KiB | / December 02 2019 |
Confidentiality Request Letter 775 Montague Expressway Milpitas, CA 95035 Tel: 408-526-1188 Fax: 408-526-1088 Email: TCB@siemic.com Reason for Amendment (current / obsolete) Initial Release (obsolete) Adding CFR 2.459 (obsolete) Updated company template & Added text box Added IC confidentiality letter form (obsolete) Corrections to STC form. Added reference to KDB
(obsolete)
(current) Revision History To 1.0 2.0 3.0 From 1.0 1.0 2.0 Approved Date Nov-14-2006 August 11 - 2008 Jan-31-2012 3.0 4.0 4.0 5.0 March-26-2015 Nov 19 2015 SCS-F19: Confidentiality Request Letter Page 1 of 3 Rev 5.0 NetgearIncorporated Tel:4088903657/Fax:4089078097 350EastPlumeriaDrive,SanJose,CA95134,USA Date: 1/30/2019 To:
Federal Communications Commission Authorization and Evaluation Division 7435 Oakland Mills Road Columbia, MD Subject: Permanent Confidentiality Request for FCC ID: PY318300422 Pursuant to sections 0.457 and 0.459 of CFR 47, we respectfully request permanent confidential treatment of the following Exhibits accompanying this application as:
- e.g. Software Operational Description The above materials contain trade secrets and proprietary information not customarily released to the public. The public disclosure of these materials may be harmful to the applicant and provide unjustified benefits to its competitors. The applicant understands that disclosure of this application and all accompanying documentation will not be made before the date of the Grant for this application. Sincerely, SCS-F19: Confidentiality Request Letter Page 2 of 3 Rev 5.0 NetgearIncorporated Tel:4088903657/Fax:4089078097 350EastPlumeriaDrive,SanJose,CA95134,USA Date: 1/30/2019 To: Federal Communications Commission Office of Engineering and Technology Equipment Authorization Division 7345 Oakland Mills Road Columbia, Maryland 21046 Subject: Short Term Confidentiality Request for FCC ID: PY318300422 To Whom It May Concern:
Pursuant to sections 0.457 and 0.459 of CFR 47, and to avoid premature release of sensitive information prior to marketing or release of the product to the public, the applicant requests the following documents contained in this certification application be temporarily withheld from public disclosure for an initial period of 45 days;
or for a specified date of not to exceed 180 days from the Grant Date. See KDB 726920.. or 180
/
/
- e.g. Test Setup photos The above materials contain trade secrets and proprietary information not customarily released to the public. The public disclosure of these materials may be harmful to the applicant and provide unjustified benefits to its competitors. Sincerely, SCS-F19: Confidentiality Request Letter Page 3 of 3 Rev 5.0
1 2 3 | DFS Test Report | Test Report | 2.02 MiB | / December 02 2019 |
DFS Test Report Report No.: RF181023C12A-2 FCC ID: PY318300422 Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 2.2 for more details) Received Date: Oct. 23, 2018 Test Date: Jan. 10 ~ Jan. 17, 2019 Issued Date: Jan. 18, 2019 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan
(R.O.C.) Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth our findings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 1 / 250 Report Format Version: 6.1.2 Table of Contents 4. 3. 5. Release Control Record .................................................................................................................................. 3 1. Certificate of Conformity ...................................................................................................................... 4 EUT Information .................................................................................................................................... 5 2. 2.1 Operating Frequency Bands and Mode of EUT .................................................................................. 5 2.2 EUT Software and Firmware Version .................................................................................................. 5 2.3 Description of Available Antennas to the EUT .................................................................................... 5 EUT Maximum Conducted Power ....................................................................................................... 6 2.4 EUT Maximum E.I.R.P. Power ............................................................................................................ 8 2.5 Transmit Power Control (TPC) ............................................................................................................ 9 2.6 2.7 Statement of Maunfacturer .................................................................................................................. 9 U-NII DFS Rule Requirements ........................................................................................................... 10 3.1 Working Modes and Required Test Items ......................................................................................... 10 3.2 Test Limits and Radar Signal Parameters .......................................................................................... 11 Test & Support Equipment List ......................................................................................................... 14 4.1 Test Instruments ................................................................................................................................ 14 4.2 Description of Support Units ............................................................................................................. 14 Test Procedure .................................................................................................................................... 15 5.1 DFS Measurement System ............................................................................................................... 15 5.2 Calibration of DFS Detection Threshold Level .................................................................................. 16 5.3 Deviation from Test Standard ............................................................................................................ 16 5.4 Radiated Test Setup Configuration ................................................................................................... 17 5.4.1 Master Mode ...................................................................................................................................... 17 5.4.2 Extender_Slave mode ....................................................................................................................... 17 Test Results ......................................................................................................................................... 18 6.1 Summary of Test Results .................................................................................................................. 18 6.1.1 Master mode ...................................................................................................................................... 18 6.1.2 Extender_Slave mode ....................................................................................................................... 18 6.2 Test Results ....................................................................................................................................... 19 6.2.1 Test Mode: Device Operating In Master Mode & Extender_Slave mode .......................................... 19 6.2.2 U-NII Detection Bandwidth ................................................................................................................ 24 6.2.3 Channel Availability Check Time ....................................................................................................... 30 6.2.4 Channel Closing Transmission and Channel Move Time.................................................................. 32 6.2.5 Non-Occupancy Period ..................................................................................................................... 65 6.2.6 Uniform Spreading ............................................................................................................................. 69 6.2.7 Transmit power control (TPC) ........................................................................................................... 69 6.2.8 Non-Associated Test .......................................................................................................................... 69 6.2.9 Non- Co-Channel Test ....................................................................................................................... 69 Information of the Testing Laboratories ........................................................................................... 70 7. Appendix A.1 - Radar Test Signal ................................................................................................................ 71 Appendix A.2 - The Frequency Hopping Radar pattern ........................................................................... 161 6. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 2 / 250 Report Format Version: 6.1.2 Release Control Record Issue No. RF181023C12A-2 Original release Description Date Issued Jan. 18, 2019 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 3 / 250 Report Format Version: 6.1.2 1. Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender (refer to item 2.2 for more details) Brand: NETGEAR Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 2.2 for more details) Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Jan. 10 ~ Jan. 17, 2019 Standards: FCC Part 15, Subpart E (Section 15.407) KDB 905462 D02 UNII DFS Compliance Procedures New Rules v02 KDB 905462 D03 UNII Clients Without Radar Detection New Rules v01r02 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Jan. 18, 2019 Approved by :
, Date:
Jan. 18, 2019 Bruce Chen / Project Engineer Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 4 / 250 Report Format Version: 6.1.2 2. EUT Information 2.1 Operating Frequency Bands and Mode of EUT Table 1: Operating Frequency Bands and Mode of EUT Operational Mode Master Extender_Slave mode Operating Frequency Range 5250~5350MHz 5470~5725MHz 2.2 EUT Software and Firmware Version No. 1 Table 2: The EUT Software/Firmware Version Product Test Model No. Software/Firmware Version Nighthawk X4 AC2200 WiFi Mesh Extender
(refer to note for more details) EX7300v2
(refer to note for more details) V1.0.0.75-DFS Note: All models are listed as below. Brand Product Name Model NETGEAR Nighthawk X4 AC2200 WiFi Mesh Extender EX7300v2 AC1900 WiFi Mesh Extender EX6400v2 Difference The listed models are electrically and mechanically identical. The intention of these models is only for RF output transmit antenna (EX7300v2 2.4G: 4T4R;
EX6400v2 2.4G: 3T3R) and different NETGEAR logo
(EX7300v2 has silver coating. EX6400v2 has no silver coating) purpose.
* For above two model are presented in power output test item. For other test items, model EX7300v2 is the worst case for final tests after pretesting. 2.3 Description of Available Antennas to the EUT Ant. Type Connecter Type Frequency Table 3: Directional Gain PIFA NA Directional Gain (dBi) 5150~5250MHz 5250~5350MHz 5470~5725MHz 5725~5850MHz 5.49 5.48 5.11 5.14 Note: The detail information please refer to operating description-Antenna Spec Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 5 / 250 Report Format Version: 6.1.2 2.4 EUT Maximum Conducted Power Table 4: The Measured Conducted Output Power CDD Mode 802.11a Frequency Band
(MHz) 5250~5350 5470~5725 802.11n HT20 Frequency Band
(MHz) 5250~5350 5470~5725 802.11n HT40 Frequency Band
(MHz) 5250~5350 5470~5725 802.11ac VHT80 Frequency Band
(MHz) 5250~5350 5470~5725 Output Power (dBm) Output Power (mW) Max. Power 23.36 23.34 216.915 215.582 Output Power (dBm) Output Power (mW) Max. Power 23.38 23.34 217.576 215.895 Output Power (dBm) Output Power (mW) Max. Power 23.64 23.23 231.217 210.353 Output Power (dBm) Output Power (mW) Max. Power 21.64 22.78 146.038 189.861 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 6 / 250 Report Format Version: 6.1.2 Beamforming Mode 802.11n HT20 Frequency Band
(MHz) 5250~5350 5470~5725 802.11n HT40 Frequency Band
(MHz) 5250~5350 5470~5725 802.11ac VHT80 Frequency Band
(MHz) 5250~5350 5470~5725 Output Power (dBm) Output Power (mW) Max. Power 23.38 23.34 217.576 215.895 Output Power (dBm) Output Power (mW) Max. Power 23.64 23.23 231.217 210.353 Output Power (dBm) Output Power (mW) Max. Power 21.64 22.78 146.038 189.861 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 7 / 250 Report Format Version: 6.1.2 2.5 EUT Maximum E.I.R.P. Power Table 5: The EIRP Output Power List CDD Mode 802.11a Frequency Band
(MHz) 5250~5350 5470~5725 802.11n HT20 Frequency Band
(MHz) 5250~5350 5470~5725 802.11n HT40 Frequency Band
(MHz) 5250~5350 5470~5725 802.11ac VHT80 Frequency Band
(MHz) 5250~5350 5470~5725 Output Power (dBm) Output Power (mW) Max. Power 27.85 27.67 609.537 584.790 Output Power (dBm) Output Power (mW) Max. Power 27.87 27.67 612.350 584.790 Output Power (dBm) Output Power (mW) Max. Power 28.13 27.56 650.130 570.164 Output Power (dBm) Output Power (mW) Max. Power 26.13 27.11 410.204 514.044 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 8 / 250 Report Format Version: 6.1.2 Beamforming Mode 802.11n HT20 Frequency Band
(MHz) 5250~5350 5470~5725 802.11n HT40 Frequency Band
(MHz) 5250~5350 5470~5725 802.11ac VHT80 Frequency Band
(MHz) 5250~5350 5470~5725 Output Power (dBm) Output Power (mW) Max. Power 28.86 28.45 769.130 699.842 Output Power (dBm) Output Power (mW) Max. Power 29.12 28.34 816.582 682.339 Output Power (dBm) Output Power (mW) Max. Power 27.12 27.89 515.229 615.177 2.6 Transmit Power Control (TPC) U-NII devices operating in the 5.25-5.35 GHz band and the 5.47-5.725 GHz band shall employ a TPC mechanism. The U-NII device is required to have the capability to operate at least 6 dB below the mean EIRP value of 30 dBm. A TPC mechanism is not required for systems with an e.i.r.p. of less than 500 mW. Maximum EIRP of this device is 816.582mW which greater than 500mW, therefore its require TPC function. The UUT can adjust a transmitters output power based on the signal level present at the receiver.TPC is auto controlled by software 2.7 Statement of Maunfacturer Manufacturer statement confirming that information regarding the parameters of the detected Radar Waveforms is not available to the end user. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 9 / 250 Report Format Version: 6.1.2 3. U-NII DFS Rule Requirements 3.1 Working Modes and Required Test Items The manufacturer shall state whether the UUT is capable of operating as a Master and/or a Client. If the UUT is capable of operating in more than one operating mode then each operating mode shall be tested separately. See tables 6 and 7 for the applicability of DFS requirements for each of the operational modes. Table 6: Applicability of DFS Requirements Prior To Use a Channel Requirement Non-Occupancy Period DFS Detection Threshold Channel Availability Check Time U-NII Detection Bandwidth Master Operational Mode Client without radar detection note Not required Not required Not required Client with radar detection Not required Note: Per KDB 905462 D03 UNII Clients Without Radar Detection New Rules v01r02 section (b)(5/6), If the client moves with the master, the device is considered compliant if nothing appears in the client non-occupancy period test. For devices that shut down (rather than moving channels), no beacons should appear. An analyzer plot that contains a single 30-minute sweep on the original channel. Table 7: Applicability of DFS Requirements during Normal Operation. Requirement DFS Detection Threshold Channel Closing Transmission Time Channel Move Time U-NII Detection Bandwidth Operational Mode Master or Client with radar detection Client without radar detection Not required Not required Additional requirements for devices with multiple bandwidth modes U-NII Detection Bandwidth and Statistical Performance Check Channel Move Time and Channel Closing Transmission Time Master or Client with radar detection All BW modes must be tested Test using widest BW mode available Client without radar detection Not required Test using the widest BW mode available for the link All other tests Any single BW mode Not required Note: Frequencies selected for statistical performance check (Section 7.8.4) should include several frequencies within the radar detection bandwidth and frequencies near the edge of the radar detection bandwidth. For 802.11 devices it is suggested to select frequencies in each of the bonded 20 MHz channels and the channel center frequency. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 10 / 250 Report Format Version: 6.1.2 3.2 Test Limits and Radar Signal Parameters Detection Threshold Values Table 8: DFS Detection Thresholds for Master Devices And Client Devices With Radar Detection Maximum Transmit Power EIRP 200 milliwatt EIRP < 200 milliwatt and power spectral density < 10 dBm/MHz EIRP < 200 milliwatt that do not meet the Value
(See Notes 1, 2, and 3)
-64 dBm
-62 dBm power spectral density requirement
-64 dBm Note 1: This is the level at the input of the receiver assuming a 0 dBi receive antenna. Note 2: Throughout these test procedures an additional 1 dB has been added to the amplitude of the test transmission waveforms to account for variations in measurement equipment. This will ensure that the test signal is at or above the detection threshold level to trigger a DFS response. Note3: EIRP is based on the highest antenna gain. For MIMO devices refer to KDB Publication 662911 D01. Table 9: DFS Response Requirement Values Parameter Non-occupancy period Channel Availability Check Time Channel Move Time Channel Closing Transmission Time U-NII Detection Bandwidth Value Minimum 30 minutes 60 seconds 10 seconds See Note 1. 200 milliseconds + an aggregate of 60 milliseconds over remaining 10 second period. See Notes 1 and 2. Minimum 100% of the U-NII 99% transmission power bandwidth. See Note 3 Note 1: Channel Move Time and the Channel Closing Transmission Time should be performed with Radar Type 0. The measurement timing begins at the end of the Radar Type 0 burst. Note 2: The Channel Closing Transmission Time is comprised of 200 milliseconds starting at the beginning of the Channel Move Time plus any additional intermittent control signals required to facilitate a Channel move
(an aggregate of 60 milliseconds) during the remainder of the 10 second period. The aggregate duration of control signals will not count quiet periods in between transmissions. Note 3: During the U-NII Detection Bandwidth detection test, radar type 0 should be used. For each frequency step the minimum percentage of detection is 90 percent. Measurements are performed with no data traffic. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 11 / 250 Report Format Version: 6.1.2 Parameters of DFS Test Signals Step intervals of 0.1 microsecond for Pulse Width, 1 microsecond for PRI, 1 MHz for chirp width and 1 for the number of pulses will be utilized for the random determination of specific test waveforms. Table 10: Short Pulse Radar Test Waveforms PRI
(sec) 1428 Number of Pulses 18 Minimum Percentage of Successful Detection See Note 1 60%
Minimum Number of Trials See Note 1 30 Radar Type Pulse Width
(sec) 0 1 1 1 2 3 4 1-5 6-10 11-20 Test A: 15 unique PRI values randomly selected from the list of 23 PRI values in Table 5a
------------------------
Test B: 15 unique PRI values randomly selected within the range of 518-3066 sec, with a minimum increment of 1 sec, excluding PRI values selected in Test A 150-230 200-500 200-500 23-29 16-18 12-16 60%
60%
60%
80%
30 30 30 120 Aggregate (Radar Types 1-4) Note 1: Short Pulse Radar Type 0 should be used for the detection bandwidth test, channel move time, and channel closing time tests. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 12 / 250 Report Format Version: 6.1.2 Table 11: Long Pulse Radar Test Waveform Radar Type Pulse Width
(sec) 5 50-100 Chirp Width
(MHz) 5-20 PRI
(sec) 1000-2000 Number Of Pulses Per Burst 1-3 Number Of Bursts Minimum Percentage Of Successful Detection Minimum Number Of Trials 8-20 80%
30 Three subsets of trials will be performed with a minimum of ten trials per subset. The subset of trials differ in where the Long Pulse Type 5 Signal is tuned in frequency. a) the Channel center frequency b) tuned frequencies such that 90% of the Long Pulse Type 5 frequency modulation is within the low edge of the UUT Occupied Bandwidth c) tuned frequencies such that 90% of the Long Pulse Type 5 frequency modulation is within the high edge of the UUT Occupied Bandwidth It include 10 trails for every subset, the formula as below, For subset case 1: the center frequency of the signal generator will remain fixed at the center of the UUT Channel. For subset case 2: to retain 90% frequency overlap between the radar signal and the UUT Occupied Bandwidth, the center frequency of the signal generator will vary for each of the ten trials in subset case 2. The center frequency of the signal generator for each trial is calculated by:
For subset case 3: to retain 90% frequency overlap between the radar signal and the UUT Occupied Bandwidth, the center frequency of the signal generator will vary for each of the ten trials in subset case 3. The center frequency of the signal generator for each trial is calculated by:
+(0.4 [ ])
(0.4 [ ]) Table 12: Frequency Hopping Radar Test Waveform Radar Type Pulse Width
(sec) PRI
(sec) Pulses PER HOP Hopping Rate
(kHz) 6 1 333 9 0.333 Hopping Sequence Length
(msec) 300 Minimum Percentage Of Successful Detection Minimum Number Of Trials 70%
30 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 13 / 250 Report Format Version: 6.1.2 4. Test & Support Equipment List 4.1 Test Instruments Table 13: Test Instruments List Description &
Manufacturer Model No. Spectrum analyzer Signal generator Horn antenna RF coaxial cable CA3501-3501-G.90(3m) &
CA3501-3501-F.90(2m) BBHA 9120 D ESR MXG 4.2 Description of Support Units Brand R&S Agilent Schwarzbeck Date Of Calibration Mar. 01, 2018 Dec. 24 2018 Nov. 25 2018 INFINET Aug. 23 2018 Due Date Of Calibration Feb. 28, 2019 Dec. 23 2019 Nov. 24 2019 Aug. 22 2019 Table 14: Support Unit Information. No. 1 2 Product Brand WiFi USB Adapter NETGEAR NETGEAR Note: This device was functioned as a Master Router Model No. A6210 R7800 FCC ID PY313400249 PY315100319 Slave device during the DFS test. This device No.2 was functioned as a Master Slave device during the DFS test. No. 1 2 Table 15: Software/Firmware Information. Product WiFi USB Adapter Router Model No. A6210 R7800 Software/Firmware Version 5.1.22.0 V1.0.2.58 Note: This device No.1 was functioned as a Master This device No.2 was functioned as a Master Slave device during the DFS test. Slave device during the DFS test. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 14 / 250 Report Format Version: 6.1.2 Control PC Radar Signal Generating system 5. Test Procedure 5.1 DFS Measurement System A complete DFS Measurement System consists of two subsystems: (1) the Radar Signal Generating Subsystem and (2) the Traffic Monitoring Subsystem. The control PC is necessary for generating the Radar waveforms in Table 10, 11 and 12. The traffic monitoring subsystem is specified to the type of unit under test
(UUT). Radiated Setup Configuration of DFS Measurement System System testing will be performed with channel-loading using means appropriate to the data types that are used by the unlicensed device. The following requirements apply:
Traffic Monitoring system Master /
Client with DFS function Spectrum Analyzer Support Unit Attenuator Wireless Horn Ant Horn Ant D = 3m a) The data file must be of a type that is typical for the device (i.e., MPEG-2, MPEG-4, WAV, MP3, MP4, AVI, etc.) and must generally be transmitting in a streaming mode. b) Software to ping the client is permitted to simulate data transfer but must have random ping intervals. c) Timing plots are required with calculations demonstrating a minimum channel loading of approximately 17% or greater. d) Unicast or Multicast protocols are preferable but other protocols may be used. The appropriate protocol used must be described in the test procedures. V Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 15 / 250 Report Format Version: 6.1.2 Control PC 5.2 Calibration of DFS Detection Threshold Level The measured channel is 5500MHz and 5510MHz and 5530MHz. The radar signal was the same as transmitted channels, and injected into the antenna of AP (master) or Client Device with Radar Detection, measured the channel closing transmission time and channel move time. Radiated setup configuration of Calibration of DFS Detection Threshold Level The radar signal generate system is gererating waveform pattern of radar types. The amplitude of the radar signal generator system is adjusted to yield a level of64 dBm as measured on the spectrum analyzer. The interference detection threshold level is lower than 64dBm hence it provides margin to the limit. 5.3 Deviation from Test Standard No deviation. Radar Signal Generate system Spectrum Analyzer Attenuator D = 3m Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 16 / 250 Report Format Version: 6.1.2 Notebook Control PC Spectrum Analyzer Radar Signal Generating system 5.4 Radiated Test Setup Configuration 5.4.1 Master Mode The EUT is a U-NII Device operating in Master mode. The radar test signals are injected into the Master Device. 5.4.2 Extender_Slave mode Master /
Client with DFS function Support Unit Attenuator Wireless Notebook Horn Ant D = 3m The UUT is a U-NII Device operating in Client mode without radar detection. The radar test signals are injected into the Master Device. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 17 / 250 Report Format Version: 6.1.2 6. Test Results 6.1 Summary of Test Results 6.1.1 Master mode Clause 15.407 15.407 15.407 15.407 15.407 15.407 15.407 Test Parameter DFS Detection Threshold U-NII Detection Bandwidth Channel Availability Check Time Channel Move Time Channel Closing Transmission Time Non- Occupancy Period Uniform Spreading 6.1.2 Extender_Slave mode Clause Test Parameter 15.407 DFS Detection Threshold 15.407 Channel Availability Check Time 15.407 Channel Move Time 15.407 Channel Closing Transmission Time 15.407 Non- Occupancy Period 15.407 Uniform Spreading 15.407 U-NII Detection Bandwidth 15.407 Non-associated test 15.407 Non-Co-Channel test Remarks Applicable Applicable Applicable Applicable Applicable Applicable Applicable Remarks Not Applicable Not Applicable Applicable Applicable Applicable Not Applicable Not Applicable Applicable Applicable Pass/Fail Pass Pass Pass Pass Pass Pass Pass Pass/Fail NA NA Pass Pass Pass NA NA Pass Pass Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 18 / 250 Report Format Version: 6.1.2 6.2 Test Results 6.2.1 Test Mode: Device Operating In Master Mode & Extender_Slave mode The radar test waveforms are injected into the Master. DFS Detection Threshold For detection threshold level of -64dBm, the tested level is lower than required level for 1dB, hence it provides margin to the limit. Radar Signal Noise Floor Radar Signal 0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 19 / 250 Report Format Version: 6.1.2 Radar Signal Noise Floor Radar Signal Noise Floor Radar Signal 1 (Test A) Radar Signal 1 (Test B) Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 20 / 250 Report Format Version: 6.1.2 Radar Signal Noise Floor Radar Signal Noise Floor Radar Signal 2 Radar Signal 3 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 21 / 250 Report Format Version: 6.1.2 Radar Signal Noise Floor Radar Signal Noise Floor Radar Signal 4 Radar Signal 5 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 22 / 250 Report Format Version: 6.1.2 Single Burst of Radar Signal 5 Radar Signal Noise Floor Radar Signal Noise Floor Radar Signal 6 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 23 / 250 Report Format Version: 6.1.2 6.2.2 U-NII Detection Bandwidth IEEE 802.11ac VHT20 IEEE 802.11ac VHT40 U-NII 99% Channel bandwidth U-NII 99% Channel bandwidth Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 24 / 250 Report Format Version: 6.1.2 IEEE 802.11ac VHT80 U-NII 99% Channel bandwidth Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 25 / 250 Report Format Version: 6.1.2 Detection Bandwidth Test - IEEE 802.11ac VHT20 Radar Type 0 EUT Frequency: 5500MHz EUT 99% Power bandwidth: 17.76MHz Detection bandwidth limit (100% of EUT 99% Power bandwidth): 17.76MHz Detection bandwidth (5510(FH) 5490(FL)) : 20MHz Test Result : PASS Radar Frequency
(MHz) 5489 5490 (FL) 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 (FH) 5511 Trial Number / Detection 4 9 No 8 No 7 No 6 No 3 5 No No No 1 2 10 No No No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No No No No No No No No No No Detection Rate (%) 0.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 0.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 26 / 250 Report Format Version: 6.1.2 Detection Bandwidth Test - IEEE 802.11ac VHT40 Radar Type 0 EUT Frequency: 5510MHz EUT 99% Power bandwidth: 36.73MHz Detection bandwidth limit (100% of EUT 99% Power bandwidth): 36.73MHz Detection bandwidth (5530(FH) 5490(FL)) : 40MHz Test Result : PASS Radar Frequency
(MHz) 5489 5490 (FL) 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 5511 5512 5513 5514 5515 5516 5517 5518 5519 5520 5521 5522 5523 5524 5525 5526 5527 5528 5529 5530 (FH) 5531 Trial Number / Detection 4 9 No 8 No 7 No 6 No 3 5 No No No 1 2 10 No No No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No No No No No No No No No No Detection Rate (%) 0.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 0.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 27 / 250 Report Format Version: 6.1.2 Detection Bandwidth Test - IEEE 802.11ac VHT80 Radar Type 0 EUT Frequency: 5530MHz EUT 99% Power bandwidth: 75.71MHz Detection bandwidth limit (100% of EUT 99% Power bandwidth): 75.71MHz Detection bandwidth (5570(FH) 5490(FL)) : 80MHz Test Result : PASS Radar Frequency
(MHz) 5489 5490 (FL) 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 5511 5512 5513 5514 5515 5516 5517 5518 5519 5520 5521 5522 5523 5524 5525 5526 5527 5528 5529 5530 5531 5532 Trial Number / Detection 4 9 No 8 No 7 No 6 No 3 5 No No No 1 2 10 No No No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Detection Rate (%) 0.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 28 / 250 Report Format Version: 6.1.2 5533 5534 5535 5536 5537 5538 5539 5540 5541 5542 5543 5544 5545 5546 5547 5548 5549 5550 5551 5552 5553 5554 5555 5556 5557 5558 5559 5560 5561 5562 5563 5564 5565 5566 5567 5568 5569 5570 (FH) 5571 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No No No No No No No No No No 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 0.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 29 / 250 Report Format Version: 6.1.2 6.2.3 Channel Availability Check Time If the EUT successfully detected the radar burst, it should be observed as the EUT has no transmissions occurred until the EUT starts transmitting on another channel. Timing of Radar Signal Within 1 to 6 second Within 54 to 60 second Observation EUT Detected Detected Spectrum Analyzer No transmissions No transmissions Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 30 / 250 Report Format Version: 6.1.2 Initial Channel Availability Check Time Beacon Signal Note: T1 denotes the end of power-up time period is 93.6th second. T4 denotes the end of Channel Availability Check time is 153.6th second. Channel Availability Check time is equal to ( T4 T1) 60 seconds. Radar Burst at the Beginning of the Channel Availability Check Time Radar Signal Note: T1 denotes the end of power up time period is 93.6th second. T2 denotes 99.6th second and the radar burst was commenced within a 6 second window starting from the end of power-up sequence. T4 denotes the 153.6th second. Radar Burst at the End of the Channel Availability Check Time Radar Signal Note: T1 denotes the end of power up time period is 93.6th second.T3 denotes 147.6th second and the radar burst was commenced within 54th second to 60th second window starting from the end of power-up sequence. T4 denotes the 153.6th second. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 31 / 250 Report Format Version: 6.1.2 6.2.4 Channel Closing Transmission and Channel Move Time Wireless Traffic Loading 802.11ac VHT20 Traffic Signal 802.11ac VHT40 Traffic Signal 802.11ac VHT80 Traffic Signal Noise Floor Noise Floor Noise Floor Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 32 / 250 Report Format Version: 6.1.2 IEEE 802.11ac VHT20 Table 1: Short Pulse Radar Test Waveforms. Radar Type Pulse Width
(sec) PRI
(sec) Test A: 15 unique PRI values randomly selected from the list of 23 PRI values in Table 5a Number of Pulses Number of Trials
(Times) Percentage of Successful Detection (%) Roundup
. 1 360 19 106 PRIsec 1 1 2 3 4 1-5 6-10 11-20 Test B: 15 unique PRI values randomly selected within the range of 518-3066sec, with a minimum increment of 1 sec, excluding PRI values selected in Test A 150-230 200-500 200-500 Aggregate (Radar Types 1-4) 30 96.7 23-29 16-18 12-16 30 30 30 120 90 83.3 83.3 88.325 Table 2: Long Pulse Radar Test Waveform Radar Type 5 Pulse Width
(sec) 50-100 Chirp Width
(MHz) 5-20 PRI
(sec) Number of Pulses per Burst Number of Bursts Number of Trials(Times) 1000-2000 1-3 8-20 30 Percentage of Successful Detection (%) 93.3 Table 3: Frequency Hopping Radar Test Waveform Radar Type Pulse Width
(sec) PRI
(sec) Pulses per Hop Hopping Rate
(kHz) Hopping Sequence Length
(msec) Number of Trials(Times) Percentage of Successful Detection (%) 6 1 333 9 0.333 300 30 100 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 33 / 250 Report Format Version: 6.1.2 IEEE 802.11ac VHT40 Table 1: Short Pulse Radar Test Waveforms. Radar Type Pulse Width
(sec) PRI
(sec) Test A: 15 unique PRI values randomly selected from the list of 23 PRI values in Table 5a Number of Pulses Number of Trials
(Times) Percentage of Successful Detection (%) Roundup
. 1 360 19 106 PRIsec 1 1 2 3 4 1-5 6-10 11-20 Test B: 15 unique PRI values randomly selected within the range of 518-3066sec, with a minimum increment of 1 sec, excluding PRI values selected in Test A 150-230 200-500 200-500 Aggregate (Radar Types 1-4) 30 96.7 23-29 16-18 12-16 30 30 30 120 83.3 86.7 96.7 90.85 Table 2: Long Pulse Radar Test Waveform Radar Type 5 Pulse Width
(sec) 50-100 Chirp Width
(MHz) 5-20 PRI
(sec) Number of Pulses per Burst Number of Bursts Number of Trials(Times) 1000-2000 1-3 8-20 30 Percentage of Successful Detection (%) 100 Table 3: Frequency Hopping Radar Test Waveform Radar Type Pulse Width
(sec) PRI
(sec) Pulses per Hop Hopping Rate
(kHz) Hopping Sequence Length
(msec) Number of Trials(Times) Percentage of Successful Detection (%) 6 1 333 9 0.333 300 30 100 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 34 / 250 Report Format Version: 6.1.2 IEEE 802.11ac VHT80 Table 1: Short Pulse Radar Test Waveforms. Radar Type Pulse Width
(sec) PRI
(sec) Number of Pulses Test A: 15 unique PRI values randomly selected from the list of 23 PRI values in Table 5a Roundup 1 360
. 19 106 PRIsec Number of Trials
(Times) Percentage of Successful Detection (%) 30 100 1 1 2 3 4 1-5 6-10 11-20 Test B: 15 unique PRI values randomly selected within the range of 518-3066sec, with a minimum increment of 1 sec, excluding PRI values selected in Test A 150-230 200-500 200-500 Aggregate (Radar Types 1-4) 23-29 16-18 12-16 30 30 30 120 83.3 90 93.3 91.65 Table 2: Long Pulse Radar Test Waveform Radar Type 5 Pulse Width
(sec) 50-100 Chirp Width
(MHz) 5-20 PRI
(sec) Number of Pulses per Burst Number of Bursts Number of Trials(Times) 1000-2000 1-3 8-20 30 Percentage of Successful Detection (%) 100 Table 3: Frequency Hopping Radar Test Waveform Radar Type Pulse Width
(sec) PRI
(sec) Pulses per Hop Hopping Rate
(kHz) Hopping Sequence Length
(msec) Number of Trials(Times) Percentage of Successful Detection (%) 6 1 333 9 0.333 300 30 100 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 35 / 250 Report Format Version: 6.1.2 For Master mode Radar signal 0 802.11ac VHT80 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time. T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: Room-in of the first 500ms after radar signal applied. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 36 / 250 Report Format Version: 6.1.2 Radar signal 1 802.11ac VHT80 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time. T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: Room-in of the first 500ms after radar signal applied. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 37 / 250 Report Format Version: 6.1.2 Radar signal 2 802.11ac VHT80 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time. T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: Room-in of the first 500ms after radar signal applied. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 38 / 250 Report Format Version: 6.1.2 Radar signal 3 802.11ac VHT80 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time. T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: Room-in of the first 500ms after radar signal applied. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 39 / 250 Report Format Version: 6.1.2 Radar signal 4 802.11ac VHT80 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time. T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Note: Room-in of the first 500ms after radar signal applied. Noise Floor Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 40 / 250 Report Format Version: 6.1.2 For Extender_Slave mode Radar Signal 0 802.11AC VHT20 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time.T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: An expanded plot for the device vacates the channel in the required 500ms. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 41 / 250 Report Format Version: 6.1.2 Radar Signal 0 802.11AC VHT40 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time.T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: An expanded plot for the device vacates the channel in the required 500ms. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 42 / 250 Report Format Version: 6.1.2 Radar Signal 0 802.11ac VHT80 Traffic Signal Radar Signal Noise Floor Note: T1 denotes the start of Channel Move Time upon the end of the last Radar burst. T2 denotes the data transmission time of 200ms from T1. T3 denotes the end of Channel Move Time.T4 denotes the 10 second from T1 to observe the aggregate duration of transmissions. Radar Signal Noise Floor Note: An expanded plot for the device vacates the channel in the required 500ms. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 43 / 250 Report Format Version: 6.1.2 802.11ac VHT20 Type 1 Radar Statistical Performances Trial Pulse Repetition Test
#
Frequency Frequency Pulse Repetition Frequency
(Pulse per seconds)
(MHz) 5491 5507 5506 5494 5502 5498 5500 5503 5505 5508 5495 5496 5497 5509 5504 5492 5493 5499 5501 5507 5491 5497 5499 5493 5496 5505 5509 5508 5500 5501 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Number (1 to 23) 15 16 4 11 22 7 2 8 1 19 21 23 9 5 6 1253 1223 1730 1393 1066 1567 1859 1520 1931 1139 1089 326.2 1475 1672 1618 1111 1024 625.8 730.5 1181 400.6 529.4 347.6 641.4 508.9 345.4 580.7 786.8 808.4 517.1 Pulses per Burst Pulse Repetition Interval
(microseconds) Detection 67 65 92 74 57 83 99 81 102 61 58 18 78 89 86 59 55 34 39 63 22 28 19 34 27 19 31 42 43 28 798 818 578 718 938 638 538 658 518 878 918 3066 678 598 618 900 977 1598 1369 847 2496 1889 2877 1559 1965 2895 1722 1271 1237 1934 Detection Rate: 96.7 %
Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 44 / 250 Report Format Version: 6.1.2 Type 2 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5503 5494 5491 5497 5492 5496 5509 5498 5495 5507 5501 5505 5493 5500 5504 5506 5502 5499 5508 5491 5495 5505 5492 5509 5508 5504 5500 5493 5494 5501 26 23 24 29 28 26 26 25 26 23 27 29 26 25 29 26 29 25 26 25 27 25 29 26 25 23 27 29 25 28 3.2 1.1 2.1 4.8 3.9 2.9 3.2 2.5 3.1 1.2 3.9 4.6 3.2 2.2 4.5 3 5 2.4 2.9 2.3 3.7 2.2 4.9 2.9 2.5 1.1 3.8 4.7 2.4 4.2 179 207 230 200 214 222 204 192 164 156 210 201 162 197 163 203 168 217 191 166 150 176 195 202 178 206 155 157 224 159 Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Detection Rate: 90 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 45 / 250 Report Format Version: 6.1.2 Type 3 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5491 5498 5505 5506 5494 5502 5503 5500 5499 5501 5504 5495 5496 5492 5508 5493 5507 5497 5509 5499 5508 5498 5507 5503 5494 5501 5495 5493 5500 5505 17 16 16 18 18 17 17 17 17 16 18 18 17 16 18 17 18 17 17 16 18 16 18 17 17 16 18 18 17 18 8.2 6.1 7.1 9.8 8.9 7.9 8.2 7.5 8.1 6.2 8.9 9.6 8.2 7.2 9.5 8 10 7.4 7.9 7.3 8.7 7.2 9.9 7.9 7.5 6.1 8.8 9.7 7.4 9.2 355 487 344 288 230 432 207 443 439 223 208 463 441 323 297 412 324 271 349 409 373 254 274 278 317 260 211 272 264 284 Yes Yes Yes Yes No Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes No Yes No Yes Yes Yes No Yes Yes Yes Yes Detection Rate: 83.3 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 46 / 250 Report Format Version: 6.1.2 Type 4 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5504 5503 5498 5507 5492 5509 5494 5493 5496 5505 5501 5499 5508 5491 5502 5506 5497 5500 5495 5502 5492 5493 5505 5498 5503 5499 5507 5497 5491 5496 14 12 13 16 15 14 14 13 14 12 15 16 14 13 16 14 16 13 14 13 15 13 16 14 13 12 15 16 13 15 16 11.3 13.5 19.4 17.5 15.3 15.9 14.3 15.8 11.5 17.4 19 16 13.8 18.9 15.5 19.9 14.1 15.2 13.8 17.1 13.8 19.8 15.3 14.5 11.3 17.3 19.2 14.2 18.2 355 487 344 288 230 432 207 443 439 223 208 463 441 323 297 412 324 271 349 409 373 254 274 278 317 260 211 272 264 284 Yes Yes No Yes No Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Detection Rate: 83.3 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 47 / 250 Report Format Version: 6.1.2 Type 5 Radar Statistical Performances Trial #
Minimum Chirp Width(MHz) Chirp Center Frequency(MHz) Test Signal Name Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 15 8 11 20 17 14 15 12 14 8 17 19 15 12 19 14 20 12 14 12 16 12 20 14 13 8 17 19 12 18 5500 5500 5500 5500 5500 5500 5500 5500 5500 5500 5497.42 5498.62 5496.22 5495.02 5498.22 5495.82 5499.02 5495.02 5495.82 5495.02 5502.98 5505.38 5500.98 5504.18 5504.58 5506.98 5502.58 5501.38 5504.98 5502.18 LP_Signal_01 LP_Signal_02 LP_Signal_03 LP_Signal_04 LP_Signal_05 LP_Signal_06 LP_Signal_07 LP_Signal_08 LP_Signal_09 LP_Signal_10 LP_Signal_11 LP_Signal_12 LP_Signal_13 LP_Signal_14 LP_Signal_15 LP_Signal_16 LP_Signal_17 LP_Signal_18 LP_Signal_19 LP_Signal_20 LP_Signal_21 LP_Signal_22 LP_Signal_23 LP_Signal_24 LP_Signal_25 LP_Signal_26 LP_Signal_27 LP_Signal_28 LP_Signal_29 LP_Signal_30 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes The Long Pulse Radar pattern shown in Appendix A.1 Detection Rate: 93.3 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 48 / 250 Report Format Version: 6.1.2 Type 6 Radar Statistical Performances Trial #
Pulses per Burst Pulse Width(us) 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 PRI(us) 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 Detection Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 49 / 250 Report Format Version: 6.1.2 Type 6 Radar Statistical Performances Trial #
Hopping Frequency Sequence Name Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 HOP_FREQ_SEQ_01 HOP_FREQ_SEQ_02 HOP_FREQ_SEQ_03 HOP_FREQ_SEQ_04 HOP_FREQ_SEQ_05 HOP_FREQ_SEQ_06 HOP_FREQ_SEQ_07 HOP_FREQ_SEQ_08 HOP_FREQ_SEQ_09 HOP_FREQ_SEQ_10 HOP_FREQ_SEQ_11 HOP_FREQ_SEQ_12 HOP_FREQ_SEQ_13 HOP_FREQ_SEQ_14 HOP_FREQ_SEQ_15 HOP_FREQ_SEQ_16 HOP_FREQ_SEQ_17 HOP_FREQ_SEQ_18 HOP_FREQ_SEQ_19 HOP_FREQ_SEQ_20 HOP_FREQ_SEQ_21 HOP_FREQ_SEQ_22 HOP_FREQ_SEQ_23 HOP_FREQ_SEQ_24 HOP_FREQ_SEQ_25 HOP_FREQ_SEQ_26 HOP_FREQ_SEQ_27 HOP_FREQ_SEQ_28 HOP_FREQ_SEQ_29 HOP_FREQ_SEQ_30 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes The Frequency Hopping Radar pattern shown in Appendix A.2 Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 50 / 250 Report Format Version: 6.1.2 802.11ac VHT40 Type 1 Radar Statistical Performances Trial Pulse Repetition Test
#
Frequency Frequency Pulse Repetition Frequency
(Pulse per seconds)
(MHz) 5523 5496 5518 5527 5495 5522 5509 5501 5502 5505 5520 5506 5499 5493 5514 5503 5517 5508 5512 5510 5513 5500 5498 5507 5526 5528 5497 5504 5519 5516 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Number (1 to 23) 15 16 4 11 22 7 2 8 1 19 21 23 9 5 6 1253 1223 1730 1393 1066 1567 1859 1520 1931 1139 1089 326.2 1475 1672 1618 1111 1024 625.8 730.5 1181 400.6 529.4 347.6 641.4 508.9 345.4 580.7 786.8 808.4 517.1 Pulses per Burst Pulse Repetition Interval
(microseconds) Detection 67 65 92 74 57 83 99 81 102 61 58 18 78 89 86 59 55 34 39 63 22 28 19 34 27 19 31 42 43 28 798 818 578 718 938 638 538 658 518 878 918 3066 678 598 618 900 977 1598 1369 847 2496 1889 2877 1559 1965 2895 1722 1271 1237 1934 Detection Rate: 96.7%
Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 51 / 250 Report Format Version: 6.1.2 Type 2 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5507 5520 5525 5492 5521 5508 5494 5495 5499 5503 5504 5496 5505 5509 5522 5512 5511 5491 5501 5526 5510 5498 5518 5524 5515 5516 5517 5527 5519 5502 29 24 25 28 27 29 29 23 23 29 29 29 25 28 24 29 23 25 26 26 25 25 24 23 23 29 29 25 28 26 4.9 1.7 2.1 4 3.6 5 4.9 1.1 1.2 4.5 5 5 2.4 4.1 2 4.6 1 2.4 3.2 3.1 2.7 2.6 2 1.1 1 4.9 4.8 2.3 4.3 3.3 210 178 173 222 219 212 176 199 162 220 229 214 153 197 211 190 213 218 215 157 168 227 171 158 167 150 191 159 226 208 Yes Yes No Yes Yes No Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Detection Rate: 83.3 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 52 / 250 Report Format Version: 6.1.2 Type 3 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5515 5507 5493 5523 5529 5528 5521 5498 5516 5496 5506 5500 5518 5524 5511 5527 5508 5510 5497 5495 5503 5512 5513 5526 5492 5520 5517 5519 5514 5525 18 16 16 18 17 18 18 16 16 18 18 18 17 18 16 18 16 17 17 17 17 17 16 16 16 18 18 17 18 17 9.9 6.7 7.1 9 8.6 10 9.9 6.1 6.2 9.5 10 10 7.4 9.1 7 9.6 6 7.4 8.2 8.1 7.7 7.6 7 6.1 6 9.9 9.8 7.3 9.3 8.3 235 357 333 242 397 302 203 428 335 240 224 410 359 269 250 247 222 424 393 382 486 480 360 297 265 263 324 386 311 378 Yes Yes No Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Detection Rate: 86.7 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 53 / 250 Report Format Version: 6.1.2 Type 4 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5502 5493 5499 5503 5509 5528 5508 5518 5510 5500 5517 5523 5494 5504 5529 5516 5524 5514 5526 5496 5497 5515 5495 5513 5512 5498 5507 5501 5519 5506 16 12 13 15 15 16 16 12 12 16 16 16 13 15 13 16 12 13 14 14 14 13 13 12 12 16 16 13 16 14 19.7 12.7 13.6 17.7 16.8 20 19.7 11.3 11.5 18.8 20 20 14.2 18 13.3 19 11.1 14.2 15.9 15.8 14.8 14.6 13.2 11.3 11 19.6 19.6 14 18.3 16.1 235 357 333 242 397 302 203 428 335 240 224 410 359 269 250 247 222 424 393 382 486 480 360 297 265 263 324 386 311 378 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Detection Rate: 96.67 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 54 / 250 Report Format Version: 6.1.2 Type 5 Radar Statistical Performances Trial #
Minimum Chirp Width(MHz) Chirp Center Frequency(MHz) Test Signal Name Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 15 8 11 20 17 14 15 12 14 8 17 19 15 12 19 14 20 12 14 12 16 12 20 14 13 8 17 19 12 18 5510.0 5510.0 5510.0 5510.0 5510.0 5510.0 5510.0 5510.0 5510.0 5510.0 5497.9 5499.1 5496.7 5495.5 5498.7 5496.3 5499.5 5495.5 5496.3 5495.5 5522.5 5524.9 5520.5 5523.7 5524.1 5526.5 5522.1 5520.9 5524.5 5521.7 LP_Signal_01 LP_Signal_02 LP_Signal_03 LP_Signal_04 LP_Signal_05 LP_Signal_06 LP_Signal_07 LP_Signal_08 LP_Signal_09 LP_Signal_10 LP_Signal_11 LP_Signal_12 LP_Signal_13 LP_Signal_14 LP_Signal_15 LP_Signal_16 LP_Signal_17 LP_Signal_18 LP_Signal_19 LP_Signal_20 LP_Signal_21 LP_Signal_22 LP_Signal_23 LP_Signal_24 LP_Signal_25 LP_Signal_26 LP_Signal_27 LP_Signal_28 LP_Signal_29 LP_Signal_30 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes The Long Pulse Radar pattern shown in Appendix A.1 Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 55 / 250 Report Format Version: 6.1.2 Type 6 Radar Statistical Performances Trial #
Pulses per Burst Pulse Width(us) 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 PRI(us) 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 Detection Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 56 / 250 Report Format Version: 6.1.2 Type 6 Radar Statistical Performances Trial #
Hopping Frequency Sequence Name Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 HOP_FREQ_SEQ_01 HOP_FREQ_SEQ_02 HOP_FREQ_SEQ_03 HOP_FREQ_SEQ_04 HOP_FREQ_SEQ_05 HOP_FREQ_SEQ_06 HOP_FREQ_SEQ_07 HOP_FREQ_SEQ_08 HOP_FREQ_SEQ_09 HOP_FREQ_SEQ_10 HOP_FREQ_SEQ_11 HOP_FREQ_SEQ_12 HOP_FREQ_SEQ_13 HOP_FREQ_SEQ_14 HOP_FREQ_SEQ_15 HOP_FREQ_SEQ_16 HOP_FREQ_SEQ_17 HOP_FREQ_SEQ_18 HOP_FREQ_SEQ_19 HOP_FREQ_SEQ_20 HOP_FREQ_SEQ_21 HOP_FREQ_SEQ_22 HOP_FREQ_SEQ_23 HOP_FREQ_SEQ_24 HOP_FREQ_SEQ_25 HOP_FREQ_SEQ_26 HOP_FREQ_SEQ_27 HOP_FREQ_SEQ_28 HOP_FREQ_SEQ_29 HOP_FREQ_SEQ_30 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes The Frequency Hopping Radar pattern shown in Appendix A.2 Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 57 / 250 Report Format Version: 6.1.2 802.11ac VHT80 Type 1 Radar Statistical Performances Trial Pulse Repetition Test
#
Frequency Frequency Pulse Repetition Frequency
(Pulse per seconds)
(MHz) 5564 5539 5529 5553 5496 5497 5562 5542 5500 5503 5554 5543 5507 5523 5517 5519 5550 5509 5534 5524 5510 5513 5498 5528 5546 5527 5533 5560 5548 5518 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Number (1 to 23) 15 16 4 11 22 7 2 8 1 19 21 23 9 5 6 1253 1223 1730 1393 1066 1567 1859 1520 1931 1139 1089 326.2 1475 1672 1618 1111 1024 625.8 730.5 1181 400.6 529.4 347.6 641.4 508.9 345.4 580.7 786.8 808.4 517.1 Pulses per Burst Pulse Repetition Interval
(microseconds) Detection 67 65 92 74 57 83 99 81 102 61 58 18 78 89 86 59 55 34 39 63 22 28 19 34 27 19 31 42 43 28 798 818 578 718 938 638 538 658 518 878 918 3066 678 598 618 900 977 1598 1369 847 2496 1889 2877 1559 1965 2895 1722 1271 1237 1934 Detection Rate: 100 %
Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 58 / 250 Report Format Version: 6.1.2 Type 2 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5508 5530 5499 5563 5502 5557 5492 5528 5539 5505 5536 5551 5543 5514 5506 5507 5554 5509 5560 5521 5562 5497 5561 5515 5516 5552 5527 5513 5493 5553 23 26 27 24 27 26 29 23 29 27 25 29 26 28 24 27 26 25 23 25 29 27 23 29 28 26 24 23 25 29 1.3 3.2 3.9 1.9 3.6 3.3 4.9 1.3 4.9 3.3 2.7 5 3.3 4.4 1.9 3.6 2.8 2.5 1.3 2.4 4.8 3.5 1.3 4.8 4.3 3.2 1.7 1.2 2.4 5 228 172 212 213 150 158 210 223 152 190 203 227 196 198 161 226 181 167 178 187 153 201 166 155 221 191 192 164 154 207 No Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes No Yes No Yes Yes Yes Detection Rate: 83.3 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 59 / 250 Report Format Version: 6.1.2 Type 3 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5511 5540 5533 5495 5537 5507 5500 5566 5527 5529 5497 5528 5496 5552 5523 5504 5565 5502 5510 5539 5554 5548 5549 5512 5524 5534 5518 5519 5542 5521 16 17 18 16 17 17 18 16 18 17 17 18 17 18 16 17 17 17 16 17 18 17 16 18 18 17 16 16 17 18 6.3 8.2 8.9 6.9 8.6 8.3 9.9 6.3 9.9 8.3 7.7 10 8.3 9.4 6.9 8.6 7.8 7.5 6.3 7.4 9.8 8.5 6.3 9.8 9.3 8.2 6.7 6.2 7.4 10 403 313 214 262 273 470 453 378 483 317 385 275 497 420 366 414 444 427 338 436 265 451 274 417 330 472 333 377 394 296 Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes No Yes Yes Yes No Yes Yes Yes Yes Yes Detection Rate: 90 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 60 / 250 Report Format Version: 6.1.2 Type 4 Radar Statistical Performances Trial #
Test Frequency Pulses per Burst Pulse Width(us) PRI(us) Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30
(MHz) 5567 5512 5546 5526 5529 5514 5537 5515 5496 5517 5502 5497 5507 5528 5550 5555 5527 5552 5543 5511 5561 5553 5495 5558 5533 5510 5493 5562 5500 5506 12 14 15 13 15 14 16 12 16 14 14 16 14 16 13 15 14 13 12 13 16 15 12 16 16 14 12 12 13 16 11.7 15.9 17.4 13.2 16.8 16.1 19.8 11.7 19.8 16.2 14.8 19.9 16.1 18.6 13.2 16.9 15 14.4 11.7 14.2 19.6 16.5 11.7 19.4 18.3 15.9 12.5 11.5 14.2 19.8 403 313 214 262 273 470 453 378 483 317 385 275 497 420 366 414 444 427 338 436 265 451 274 417 330 472 333 377 394 296 Yes Yes Yes No Yes Yes Yes Yes Yes Yes No Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Detection Rate:93.3 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 61 / 250 Report Format Version: 6.1.2 Type 5 Radar Statistical Performances Trial #
Minimum Chirp Width(MHz) Chirp Center Frequency(MHz) Test Signal Name Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 15 7 7 5 16 8 10 20 6 11 16 19 13 10 18 12 20 10 12 10 15 9 20 12 11 5 16 19 10 17 5530.0 5530.0 5530.0 5530.0 5530.0 5530.0 5530.0 5530.0 5530.0 5530.0 5498.4 5499.6 5497.2 5496.0 5499.2 5496.8 5500.0 5496.0 5496.8 5496.0 5562.0 5564.4 5560.0 5563.2 5563.6 5566.0 5561.6 5560.4 5564.0 5561.2 LP_Signal_01 LP_Signal_02 LP_Signal_03 LP_Signal_04 LP_Signal_05 LP_Signal_06 LP_Signal_07 LP_Signal_08 LP_Signal_09 LP_Signal_10 LP_Signal_11 LP_Signal_12 LP_Signal_13 LP_Signal_14 LP_Signal_15 LP_Signal_16 LP_Signal_17 LP_Signal_18 LP_Signal_19 LP_Signal_20 LP_Signal_21 LP_Signal_22 LP_Signal_23 LP_Signal_24 LP_Signal_25 LP_Signal_26 LP_Signal_27 LP_Signal_28 LP_Signal_29 LP_Signal_30 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes The Long Pulse Radar pattern shown in Appendix A.1 Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 62 / 250 Report Format Version: 6.1.2 Type 6 Radar Statistical Performances Trial #
Pulses per Burst Pulse Width(us) 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 PRI(us) 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 333.3 Detection Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 63 / 250 Report Format Version: 6.1.2 Type 6 Radar Statistical Performances Trial #
Hopping Frequency Sequence Name Detection 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 HOP_FREQ_SEQ_01 HOP_FREQ_SEQ_02 HOP_FREQ_SEQ_03 HOP_FREQ_SEQ_04 HOP_FREQ_SEQ_05 HOP_FREQ_SEQ_06 HOP_FREQ_SEQ_07 HOP_FREQ_SEQ_08 HOP_FREQ_SEQ_09 HOP_FREQ_SEQ_10 HOP_FREQ_SEQ_11 HOP_FREQ_SEQ_12 HOP_FREQ_SEQ_13 HOP_FREQ_SEQ_14 HOP_FREQ_SEQ_15 HOP_FREQ_SEQ_16 HOP_FREQ_SEQ_17 HOP_FREQ_SEQ_18 HOP_FREQ_SEQ_19 HOP_FREQ_SEQ_20 HOP_FREQ_SEQ_21 HOP_FREQ_SEQ_22 HOP_FREQ_SEQ_23 HOP_FREQ_SEQ_24 HOP_FREQ_SEQ_25 HOP_FREQ_SEQ_26 HOP_FREQ_SEQ_27 HOP_FREQ_SEQ_28 HOP_FREQ_SEQ_29 HOP_FREQ_SEQ_30 Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes The Frequency Hopping Radar pattern shown in Appendix A.2 Detection Rate: 100 %
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 64 / 250 Report Format Version: 6.1.2 6.2.5 Non-Occupancy Period During the 30 minutes observation time, UUT did not make any transmissions on a channel after a radar signal was detected on that channel by either the Channel Availability Check or the In-Service Monitoring. 1) EUT (Master) links with Client on 5500MHz. Waveform of EUT links up with Client 2) Client plays specified files via master. Waveform of transmission Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 65 / 250 Report Format Version: 6.1.2 3) Radar signal is applied to the Master device and WiFi traffic signal stop immediately. Radar 0 Radar 1 Radar 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 66 / 250 Report Format Version: 6.1.2 Radar 3 Radar 4 Radar 5 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 67 / 250 Report Format Version: 6.1.2 Radar 6 4) 5500MHz has been monitored in 30 minutes period. In this period, no any transmission occurs. For Master mode Plot of 30minutes period 802.11ac VHT20 Traffic Signal Injected into Radar Note: Test setup are shown on Test setup photo.pdf For Extender_Slave mode Plot of 30minutes period 802.11ac VHT20 Traffic Signal Injected into Radar Note: Test setup are shown on Test setup photo.pdf Noise Floor Noise Floor Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 68 / 250 Report Format Version: 6.1.2 6.2.6 Uniform Spreading The intention of the uniform spreading is to provide, on aggregate, a uniform loading of the spectrum. The EUT randomly select next output channel without any bias or fixed pattern, so that all channels in DFS bands
(5250 to 5350MHz and 5470 to 5725 MHz) will be used equally. 6.2.7 Transmit power control (TPC) TPC E.I.R.P FCC 15.407(h)(1)
> 500mW The TPC mechanism is required for system with an E.I.R.P. of above 500mW
< 500mW The TPC mechanism is not required for system with an E.I.R.P. of less 500mW For Extender_Slave mode 6.2.8 Non-Associated Test Master was off. During the 30 minutes observation time, The UUT did not make any transmissions in the DFS band after UUT power up. Noise Floor 6.2.9 Non- Co-Channel Test The UUT was investigated after radar was detected and confirmed that no co-channel operation with radars. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 69 / 250 Report Format Version: 6.1.2 Information of the Testing Laboratories 7. We, Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, were founded in 1988 to provide our best service in EMC, Radio, Telecom and Safety consultation. Our laboratories are FCC recognized accredited test firms and accredited and approved according to ISO/IEC 17025. If you have any comments, please feel free to contact us at the following:
Linko EMC/RF Lab Tel: 886-2-26052180 Fax: 886-2-26051924 Hwa Ya EMC/RF/Safety Lab Tel: 886-3-3183232 Fax: 886-3-3270892 Email: service.adt@tw.bureauveritas.com Web Site: www.bureauveritas-adt.com Hsin Chu EMC/RF/Telecom Lab Tel: 886-3-6668565 Fax: 886-3-6668323 The address and road map of all our labs can be found in our web site also. Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 70 / 250 Report Format Version: 6.1.2 Appendix A.1 - Radar Test Signal 802.11ac (VHT20) Long Pulse Radar Test Signal Test Signal Name: LP_Signal_01 Number of Bursts in Trial: 15 Chrip Center Frequency 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 77.8 51.9 63.8 96.6 85.9 73.7 77.2 68.4 76.7 53.2 85.7 94.3 77.6 65.7 93.5 1665.0 1074.0 1584.0 1682.0 1795.0 1198.0 1837.0 1587.0 2000.0 1147.0 1433.0 1670.0 1294.0 1512.0 1444.0 1477.0
-
-
1786.0 1215.0 1549.0 1819.0 1114.0 1155.0
-
1695.0 1426.0 1671.0
-
1130.0
-
-
-
1843.0 1729.0
-
-
-
-
-
1394.0 1935.0
-
-
1468.0 Burst 2 1 1 3 3 2 2 2 2 1 3 3 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 71 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_02 Number of Bursts in Trial: 8 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 8 8 8 8 8 8 8 8 75.0 99.4 67.4 73.6 65.9 83.8 65.5 98.6 1880.0 1401.0 1531.0 1449.0 1432.0 1356.0 1543.0 1548.0 1527.0 1262.0 1403.0 1041.0
-
1292.0
-
1796.0
-
1257.0
-
-
-
1419.0
-
1728.0 Burst 2 3 2 2 1 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 72 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_03 Number of Bursts in Trial: 11 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 73.8 69.5 51.9 84.6 95.4 68.0 89.6 81.9 88.3 53.7 91.3 1806.0 1117.0 1651.0 1976.0 1060.0 1368.0 1338.0 1022.0 1810.0 1597.0 1961.0 1538.0 1649.0
-
1032.0 1903.0 1351.0 1514.0 1689.0 1330.0
-
1106.0
-
-
-
1271.0 1388.0
-
1573.0
-
1838.0
-
1001.0 Burst 2 2 1 3 3 2 3 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 73 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_04 Number of Bursts in Trial: 20 Chrip Center Frequency: 5500.0MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 2 1 2 1 3 1 1 2 2 2 3 3 2 3 2 3 1 3 3 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 68.1 58.7 75.3 56.4 99.7 57.7 59.5 80.0 82.0 82.8 88.0 93.2 70.4 95.3 81.9 98.5 65.0 85.4 91.6 67.3 1339.0 1251.0 1136.0 1753.0 1196.0 1013.0 1072.0 1482.0 1993.0 1883.0 1061.0 1207.0 1526.0 1171.0 1690.0 1975.0 1767.0 1011.0 1878.0 1091.0 1355.0
-
1640.0
-
1708.0
-
-
1369.0 1197.0 1005.0 1928.0 1907.0 1360.0 1955.0 1545.0 1169.0
-
1637.0 1445.0 1218.0
-
-
-
-
1159.0
-
-
-
-
-
1101.0 1223.0
-
1775.0
-
1062.0
-
1425.0 1325.0
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 74 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_05 Number of Bursts in Trial: 17 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 67.9 62.3 53.3 90.0 77.1 83.9 89.1 81.8 50.3 87.1 71.3 97.5 90.6 86.3 97.6 84.7 99.7 1320.0 1957.0 1592.0 1900.0 1166.0 1278.0 1240.0 1833.0 1075.0 1116.0 1225.0 1884.0 1561.0 1596.0 1365.0 1021.0 1150.0 1133.0
-
-
1153.0 1646.0 1232.0 1384.0 1676.0
-
1996.0 1815.0 1465.0 1040.0 1183.0 1073.0 1718.0 1244.0
-
-
-
1346.0
-
1459.0 1939.0
-
-
1756.0
-
1132.0 1354.0 1792.0 1361.0 1854.0 1988.0 Burst 2 1 1 3 2 3 3 2 1 3 2 3 3 3 3 3 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 75 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_06 Number of Bursts in Trial: 14 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 92.9 67.7 65.8 56.3 53.7 83.5 65.8 85.9 76.3 81.5 89.4 63.4 69.6 74.5 1085.0 1744.0 1092.0 1851.0 1727.0 1679.0 1519.0 1134.0 1606.0 1891.0 1310.0 1568.0 1307.0 1264.0 1564.0 1747.0
-
-
-
1930.0
-
1034.0 1926.0 1714.0 1594.0
-
1925.0 1846.0 1407.0
-
-
-
-
1025.0
-
1808.0
-
-
1827.0
-
-
-
Burst 3 2 1 1 1 3 1 3 2 2 3 1 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 76 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_07 Number of Bursts in Trial: 15 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 96.6 96.7 86.5 73.3 55.8 55.4 85.3 79.4 65.7 68.6 77.7 79.6 94.9 61.4 90.6 1182.0 1829.0 1923.0 1908.0 1688.0 1145.0 1336.0 1344.0 1476.0 1008.0 1972.0 1882.0 1830.0 1451.0 1233.0 1609.0 1799.0 1396.0 1318.0
-
-
1504.0 1893.0
-
1028.0 1835.0 1331.0 1070.0
-
1562.0 1581.0 1154.0 1865.0
-
-
-
1820.0
-
-
-
-
-
1349.0
-
1887.0 Burst 3 3 3 2 1 1 3 2 1 2 2 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 77 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_08 Number of Bursts in Trial: 12 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 14 14 14 14 14 14 14 14 14 14 14 14 52.6 84.1 97.7 97.3 98.8 72.2 67.6 75.7 60.9 64.2 78.8 87.5 1210.0 1314.0 1139.0 1341.0 1544.0 1771.0 1175.0 1026.0 1798.0 1138.0 1784.0 1511.0
-
1725.0 1868.0 1446.0 1386.0 1184.0 1027.0 1871.0
-
-
1604.0 1712.0
-
1529.0 1805.0 1755.0 1302.0
-
-
-
-
-
-
1683.0 Burst 1 3 3 3 3 2 2 2 1 1 2 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 78 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_09 Number of Bursts in Trial: 14 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 10 10 54.1 50.7 52.3 99.8 68.4 80.8 62.5 74.8 50.8 54.0 63.0 91.8 79.3 64.3 1415.0 1221.0 1974.0 1558.0 1014.0 1736.0 1778.0 1149.0 1049.0 1417.0 1730.0 1143.0 1274.0 1937.0
-
-
-
1696.0 1099.0 1505.0
-
1204.0
-
-
-
1270.0 1992.0
-
-
-
-
1949.0
-
-
-
-
-
-
-
1347.0
-
-
Burst 1 1 1 3 2 2 1 2 1 1 1 3 2 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 79 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_10 Number of Bursts in Trial: 8 Chrip Center Frequency: 5500.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 18 18 18 18 18 18 18 18 63.4 52.0 97.2 78.7 74.2 88.7 54.3 95.4 1043.0 1863.0 1973.0 1466.0 1280.0 1293.0 1991.0 1580.0
-
-
1605.0 1743.0 1219.0 1934.0
-
1555.0
-
-
1583.0
-
-
1273.0
-
1791.0 Burst 1 1 3 2 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 80 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_11 Number of Bursts in Trial: 17 Chrip Center Frequency: 5497.42 MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 73.7 97.4 91.7 66.2 70.8 52.3 78.9 70.9 75.6 59.1 77.0 67.9 81.2 78.7 63.3 68.9 59.3 1208.0 1942.0 1999.0 1393.0 1968.0 1740.0 1308.0 1050.0 1437.0 1697.0 1397.0 1803.0 1720.0 1247.0 1634.0 1849.0 1093.0 1497.0 1754.0 1702.0
-
1821.0
-
1984.0 1358.0 1430.0
-
1304.0 1083.0 1932.0 1121.0
-
1423.0
-
-
1613.0 1462.0
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Burst 2 3 3 1 2 1 2 2 2 1 2 2 2 2 1 2 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 81 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_12 Number of Bursts in Trial: 19 Chrip Center Frequency: 5498.62 MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 98.9 82.3 86.7 89.7 98.6 71.1 55.9 67.9 84.4 58.8 65.6 78.5 82.3 90.1 90.2 83.1 58.8 77.0 55.0 1381.0 1716.0 1211.0 1861.0 1507.0 1921.0 1947.0 1350.0 1203.0 1715.0 1017.0 1911.0 1845.0 1938.0 1989.0 1943.0 1742.0 1187.0 1012.0 1680.0 1855.0 1400.0 1068.0 1194.0 1789.0
-
1372.0 1107.0
-
-
1704.0 1686.0 1071.0 1089.0 1406.0
-
1657.0
-
1488.0
-
1919.0 1282.0 1461.0
-
-
-
1443.0
-
-
-
-
1266.0 1950.0
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 3 3 3 2 1 2 3 1 1 2 2 3 3 2 1 2 1 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 82 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_13 Number of Bursts in Trial: 15 Chrip Center Frequency: 5496.22MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 58.1 52.1 59.9 60.2 95.9 79.9 78.5 53.8 64.7 61.4 83.2 84.7 88.7 78.3 69.3 1929.0 1910.0 1971.0 1812.0 1399.0 1626.0 1238.0 1763.0 1800.0 1390.0 1692.0 1533.0 1703.0 1258.0 1731.0
-
-
-
-
1906.0 1859.0 1917.0
-
-
-
1858.0 1677.0 1528.0 1951.0 1717.0
-
-
-
-
1608.0
-
-
-
-
-
-
1638.0 1058.0
-
-
Burst 1 1 1 1 3 2 2 1 1 1 2 3 3 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 83 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_14 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.02MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 75.3 56.3 67.7 55.6 75.2 76.3 85.7 98.4 86.4 93.6 63.3 92.4 1994.0 1456.0 1617.0 1337.0 1421.0 1359.0 1547.0 1873.0 1779.0 1059.0 1328.0 1412.0 1612.0
-
1185.0
-
1267.0 1305.0 1362.0 1550.0 1439.0 1031.0
-
1673.0
-
-
-
-
-
-
1924.0 1249.0 1046.0 1452.0
-
1322.0 Burst 2 1 2 1 2 2 3 3 3 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 84 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_15 Number of Bursts in Trial: 19 Chrip Center Frequency: 5498.22MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 93.3 69.1 86.9 84.9 72.3 51.7 58.3 60.8 57.1 88.9 72.0 90.9 59.8 70.0 67.2 91.2 56.5 51.2 74.1 1983.0 1102.0 1044.0 1894.0 1094.0 1447.0 1429.0 1979.0 1641.0 1886.0 1909.0 1261.0 1552.0 1759.0 1625.0 1382.0 1483.0 1237.0 1471.0 1912.0 1794.0 1152.0 1948.0 1916.0
-
-
-
-
1964.0 1297.0 1566.0
-
1291.0 1881.0 1832.0
-
-
1245.0 1535.0
-
1148.0 1118.0
-
-
-
-
-
1489.0
-
1370.0
-
-
-
1661.0
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 3 3 2 1 1 1 1 3 2 3 1 2 2 3 1 1 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 85 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_16 Number of Bursts in Trial: 14 Chrip Center Frequency: 5495.82MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 76.9 50.2 62.9 64.7 83.8 65.4 53.2 51.7 78.7 72.4 53.8 73.6 66.7 82.5 1110.0 1316.0 1520.0 1902.0 1410.0 1944.0 1024.0 1603.0 1804.0 1030.0 1327.0 1524.0 1722.0 1404.0 1140.0
-
-
-
-
-
-
-
1097.0 1621.0
-
-
-
1168.0 1343.0
-
1553.0 1122.0 1019.0
-
-
-
-
-
-
-
-
-
Burst 2 1 1 1 3 1 1 1 2 2 1 2 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 86 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_17 Number of Bursts in Trial: 20 Chrip Center Frequency: 5499.02MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 3 3 2 2 1 2 2 2 1 3 3 2 3 1 1 3 3 3 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 87.6 85.2 84.8 77.9 76.5 60.9 83.0 80.4 67.5 62.1 86.4 84.3 76.9 95.8 55.2 59.0 94.5 91.9 85.2 69.5 1565.0 1735.0 1534.0 1749.0 1518.0 1540.0 1080.0 1824.0 1764.0 1495.0 1773.0 1593.0 1226.0 1192.0 1644.0 1402.0 1296.0 1970.0 1732.0 1038.0 1055.0 1541.0 1889.0 1460.0 1485.0
-
1010.0 1752.0 1181.0
-
1966.0 1188.0 1537.0 1298.0
-
-
1700.0 1978.0 1551.0 1224.0 1840.0 1408.0 1463.0
-
-
-
-
-
-
-
1263.0 1788.0
-
1844.0
-
-
1283.0 1165.0 1189.0
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 87 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_18 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.02MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 86.4 92.2 80.4 54.3 53.1 69.4 69.1 100.0 79.6 88.4 53.3 65.3 1259.0 1598.0 1816.0 1335.0 1303.0 1503.0 1279.0 1375.0 1239.0 1374.0 1016.0 1709.0 1918.0 1719.0 1899.0
-
-
1546.0 1639.0 1438.0 1705.0 1579.0
-
-
1455.0 1895.0
-
-
-
-
-
1595.0
-
1623.0
-
-
Burst 3 3 2 1 1 2 2 3 2 3 1 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 88 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_19 Number of Bursts in Trial: 14 Chrip Center Frequency: 5495.82MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 55.3 58.3 72.3 84.8 82.5 63.3 80.0 90.3 91.1 96.6 82.7 50.7 78.4 99.5 1920.0 1797.0 1610.0 1131.0 1875.0 1095.0 1119.0 1660.0 1539.0 1525.0 1710.0 1234.0 1047.0 1299.0
-
-
1039.0 1761.0 1431.0
-
1913.0 1853.0 1783.0 1036.0 1990.0
-
1109.0 1965.0
-
-
-
1721.0
-
-
-
1123.0 1172.0 1385.0
-
-
-
1869.0 Burst 1 1 2 3 2 1 2 3 3 3 2 1 2 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 89 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_20 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.02MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 88.6 57.4 96.6 69.7 77.9 62.0 88.4 97.3 96.2 95.4 54.8 80.4 1501.0 1723.0 1086.0 1751.0 1642.0 1866.0 1997.0 1790.0 1391.0 1020.0 1084.0 1850.0 1067.0
-
1658.0 1945.0 1317.0
-
1077.0 1896.0 1787.0 1892.0
-
1436.0 1927.0
-
1324.0
-
-
-
1366.0 1367.0 1672.0 1414.0
-
-
Burst 3 1 3 2 2 1 3 3 3 3 1 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 90 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_21 Number of Bursts in Trial: 16 Chrip Center Frequency: 5502.98MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 74.7 57.1 91.9 83.1 50.7 79.2 58.7 71.0 79.0 68.5 73.5 70.5 76.6 81.2 61.8 94.9 1619.0 1560.0 1392.0 1809.0 1003.0 1574.0 1186.0 1521.0 1777.0 1284.0 1904.0 1864.0 1045.0 1160.0 1277.0 1450.0 1611.0
-
1475.0 1772.0
-
1600.0
-
1567.0 1960.0 1428.0 1352.0 1115.0 1300.0 1675.0
-
1206.0
-
-
1276.0
-
-
-
-
-
-
-
-
-
-
-
-
1860.0 Burst 2 1 3 2 1 2 1 2 2 2 2 2 2 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 91 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_22 Number of Bursts in Trial: 12 Chrip Center Frequency: 5505.38MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 9 9 9 9 9 9 9 9 9 9 9 9 78.5 89.8 59.4 79.6 76.0 53.6 80.9 61.6 53.4 59.9 60.4 91.4 1653.0 1174.0 1982.0 1633.0 1112.0 1144.0 1220.0 1724.0 1901.0 1379.0 1453.0 1768.0 1698.0 1962.0
-
1890.0 1811.0
-
1053.0
-
-
-
-
-
1167.0
-
-
-
-
-
-
-
-
-
1726.0 1227.0 Burst 2 3 1 2 2 1 2 1 1 1 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 92 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_23 Number of Bursts in Trial: 20 Chrip Center Frequency: 5500.98MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 2 1 1 2 2 1 3 2 3 1 3 1 3 1 2 2 3 2 3 3 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 77.0 58.1 62.1 76.9 80.0 52.0 88.6 72.9 98.5 57.9 95.9 53.5 92.0 57.3 70.5 70.0 84.0 76.1 93.2 96.8 1191.0 1248.0 1836.0 1334.0 1914.0 1701.0 1693.0 1922.0 1839.0 1193.0 1659.0 1162.0 1745.0 1834.0 1684.0 1042.0 1765.0 1557.0 1985.0 1760.0 1363.0
-
-
1236.0 1852.0
-
1995.0 1387.0 1746.0
-
1870.0
-
1654.0
-
1586.0 1664.0 1630.0 1057.0 1018.0 1614.0
-
-
-
-
-
-
1905.0
-
1389.0
-
1066.0
-
1458.0
-
-
-
1176.0
-
1340.0 1817.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 93 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_24 Number of Bursts in Trial: 14 Chrip Center Frequency: 5504.18 MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 50.1 93.5 68.8 56.3 86.0 75.2 54.4 71.1 76.2 80.2 79.7 90.9 68.7 67.4 1841.0 1590.0 1707.0 1056.0 1953.0 1572.0 1517.0 1329.0 1940.0 1098.0 1588.0 1615.0 1377.0 1872.0
-
1081.0 1577.0
-
1108.0 1536.0
-
1243.0 1770.0 1209.0 1214.0 1862.0 1441.0 1313.0
-
1413.0
-
-
1987.0
-
-
-
-
-
-
1601.0
-
-
Burst 1 3 2 1 3 2 1 2 2 2 2 3 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 94 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_25 Number of Bursts in Trial: 13 Chrip Center Frequency: 5504.58MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 11 11 11 11 11 11 11 11 11 11 11 11 11 94.0 70.8 56.3 96.7 90.6 74.5 92.6 89.0 96.5 70.5 94.0 55.8 87.7 1643.0 1177.0 1006.0 1230.0 1217.0 1569.0 1065.0 1493.0 1607.0 1141.0 1009.0 1290.0 1435.0 1748.0 1201.0
-
1163.0 1582.0 1281.0 1669.0 1135.0 1822.0 1178.0 1629.0
-
1963.0 1941.0
-
-
1332.0 1498.0
-
1222.0 1380.0 1602.0
-
1956.0
-
1164.0 Burst 3 2 1 3 3 2 3 3 3 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 95 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_26 Number of Bursts in Trial: 8 Chrip Center Frequency: 5506.98MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 5 5 5 5 5 5 5 5 68.6 83.1 60.9 77.7 77.4 66.8 63.7 91.2 1306.0 1420.0 1687.0 1776.0 1793.0 1576.0 1333.0 1409.0 1161.0 1315.0
-
1158.0 1510.0 1323.0
-
1681.0
-
-
-
-
-
-
-
1275.0 Burst 2 2 1 2 2 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 96 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_27 Number of Bursts in Trial: 17 Chrip Center Frequency: 5502.58MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 83.6 89.4 55.8 90.9 54.7 97.7 67.5 96.7 68.3 78.3 55.0 84.9 74.6 63.3 99.8 63.6 87.3 1632.0 1173.0 1532.0 1981.0 1825.0 1734.0 1571.0 1589.0 1750.0 1591.0 1427.0 1129.0 1959.0 1885.0 1035.0 1647.0 1931.0 1195.0 1627.0
-
1554.0
-
1202.0 1434.0 1469.0 1954.0 1082.0
-
1936.0 1856.0
-
1515.0
-
1051.0 1000.0 1656.0
-
1998.0
-
1250.0
-
1268.0
-
-
-
1199.0
-
-
1120.0
-
1831.0 Burst 3 3 1 3 1 3 2 3 2 2 1 3 2 1 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 97 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_28 Number of Bursts in Trial: 19 Chrip Center Frequency: 5501.38MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 85.6 68.6 54.2 61.2 97.1 98.3 62.4 80.2 87.5 85.8 88.1 65.3 52.5 52.3 74.1 54.9 76.2 60.4 81.5 1946.0 1029.0 1111.0 1104.0 1157.0 1142.0 1655.0 1126.0 1216.0 1847.0 1023.0 1848.0 1470.0 1312.0 1915.0 1479.0 1376.0 1758.0 1491.0 1078.0 1780.0
-
-
1969.0 1699.0
-
1769.0 1448.0 1348.0 1124.0
-
-
-
1200.0
-
1502.0
-
1103.0 1015.0
-
-
-
1100.0 1622.0
-
-
1179.0 1472.0 1631.0
-
-
-
-
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 1 1 3 3 1 2 3 3 3 1 1 1 2 1 2 1 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 98 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_29 Number of Bursts in Trial: 12 Chrip Center Frequency: 5504.98MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 50.5 55.7 85.8 76.9 75.1 92.3 78.1 92.2 89.0 70.9 63.1 55.3 1857.0 1246.0 1774.0 1125.0 1254.0 1180.0 1301.0 1898.0 1260.0 1578.0 1782.0 1522.0
-
-
1002.0 1474.0 1052.0 1486.0 1757.0 1252.0 1706.0 1620.0
-
-
-
-
1967.0
-
-
1492.0
-
1713.0 1411.0
-
-
-
Burst 1 1 3 2 2 3 2 3 3 2 1 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 99 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_30 Number of Bursts in Trial: 18 Chrip Center Frequency: 5502.18MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 83.4 97.3 90.4 91.8 98.2 59.5 80.0 86.5 91.1 93.5 60.7 67.2 61.8 79.4 81.4 65.7 76.0 81.0 1454.0 1319.0 1079.0 1563.0 1876.0 1952.0 1253.0 1054.0 1105.0 1867.0 1033.0 1288.0 1585.0 1933.0 1096.0 1496.0 1733.0 1326.0 1205.0 1826.0 1986.0 1151.0 1977.0
-
1137.0 1128.0 1599.0 1373.0
-
1405.0
-
1667.0 1464.0
-
1255.0 1668.0 1801.0 1635.0 1674.0 1802.0 1766.0
-
-
1828.0 1442.0 1087.0
-
-
-
-
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 3 3 3 3 1 2 3 3 3 1 2 1 2 2 1 2 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 100 / 250 Report Format Version: 6.1.2 802.11ac (VHT40) Long Pulse Radar Test Signal Test Signal Name: LP_Signal_01 Number of Bursts in Trial: 15 Chrip Center Frequency 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 77.8 51.9 63.8 96.6 85.9 73.7 77.2 68.4 76.7 53.2 85.7 94.3 77.6 65.7 93.5 1665.0 1074.0 1584.0 1682.0 1795.0 1198.0 1837.0 1587.0 2000.0 1147.0 1433.0 1670.0 1294.0 1512.0 1444.0 1477.0
-
-
1786.0 1215.0 1549.0 1819.0 1114.0 1155.0
-
1695.0 1426.0 1671.0
-
1130.0
-
-
-
1843.0 1729.0
-
-
-
-
-
1394.0 1935.0
-
-
1468.0 Burst 2 1 1 3 3 2 2 2 2 1 3 3 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 101 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_02 Number of Bursts in Trial: 8 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 75.0 99.4 67.4 73.6 65.9 83.8 65.5 98.6 1880.0 1401.0 1531.0 1449.0 1432.0 1356.0 1543.0 1548.0 1527.0 1262.0 1403.0 1041.0
-
1292.0
-
1796.0
-
1257.0
-
-
-
1419.0
-
1728.0 Burst 2 3 2 2 1 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 102 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_03 Number of Bursts in Trial: 11 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 73.8 69.5 51.9 84.6 95.4 68.0 89.6 81.9 88.3 53.7 91.3 1806.0 1117.0 1651.0 1976.0 1060.0 1368.0 1338.0 1022.0 1810.0 1597.0 1961.0 1538.0 1649.0
-
1032.0 1903.0 1351.0 1514.0 1689.0 1330.0
-
1106.0
-
-
-
1271.0 1388.0
-
1573.0
-
1838.0
-
1001.0 Burst 2 2 1 3 3 2 3 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 103 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_04 Number of Bursts in Trial: 20 Chrip Center Frequency: 5510.0MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 2 1 2 1 3 1 1 2 2 2 3 3 2 3 2 3 1 3 3 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 68.1 58.7 75.3 56.4 99.7 57.7 59.5 80.0 82.0 82.8 88.0 93.2 70.4 95.3 81.9 98.5 65.0 85.4 91.6 67.3 1339.0 1251.0 1136.0 1753.0 1196.0 1013.0 1072.0 1482.0 1993.0 1883.0 1061.0 1207.0 1526.0 1171.0 1690.0 1975.0 1767.0 1011.0 1878.0 1091.0 1355.0
-
1640.0
-
1708.0
-
-
1369.0 1197.0 1005.0 1928.0 1907.0 1360.0 1955.0 1545.0 1169.0
-
1637.0 1445.0 1218.0
-
-
-
-
1159.0
-
-
-
-
-
1101.0 1223.0
-
1775.0
-
1062.0
-
1425.0 1325.0
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 104 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_05 Number of Bursts in Trial: 17 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 67.9 62.3 53.3 90.0 77.1 83.9 89.1 81.8 50.3 87.1 71.3 97.5 90.6 86.3 97.6 84.7 99.7 1320.0 1957.0 1592.0 1900.0 1166.0 1278.0 1240.0 1833.0 1075.0 1116.0 1225.0 1884.0 1561.0 1596.0 1365.0 1021.0 1150.0 1133.0
-
-
1153.0 1646.0 1232.0 1384.0 1676.0
-
1996.0 1815.0 1465.0 1040.0 1183.0 1073.0 1718.0 1244.0
-
-
-
1346.0
-
1459.0 1939.0
-
-
1756.0
-
1132.0 1354.0 1792.0 1361.0 1854.0 1988.0 Burst 2 1 1 3 2 3 3 2 1 3 2 3 3 3 3 3 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 105 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_06 Number of Bursts in Trial: 14 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 18 18 18 18 18 18 18 18 18 18 18 18 18 18 92.9 67.7 65.8 56.3 53.7 83.5 65.8 85.9 76.3 81.5 89.4 63.4 69.6 74.5 1085.0 1744.0 1092.0 1851.0 1727.0 1679.0 1519.0 1134.0 1606.0 1891.0 1310.0 1568.0 1307.0 1264.0 1564.0 1747.0
-
-
-
1930.0
-
1034.0 1926.0 1714.0 1594.0
-
1925.0 1846.0 1407.0
-
-
-
-
1025.0
-
1808.0
-
-
1827.0
-
-
-
Burst 3 2 1 1 1 3 1 3 2 2 3 1 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 106 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_07 Number of Bursts in Trial: 15 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 96.6 96.7 86.5 73.3 55.8 55.4 85.3 79.4 65.7 68.6 77.7 79.6 94.9 61.4 90.6 1182.0 1829.0 1923.0 1908.0 1688.0 1145.0 1336.0 1344.0 1476.0 1008.0 1972.0 1882.0 1830.0 1451.0 1233.0 1609.0 1799.0 1396.0 1318.0
-
-
1504.0 1893.0
-
1028.0 1835.0 1331.0 1070.0
-
1562.0 1581.0 1154.0 1865.0
-
-
-
1820.0
-
-
-
-
-
1349.0
-
1887.0 Burst 3 3 3 2 1 1 3 2 1 2 2 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 107 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_08 Number of Bursts in Trial: 12 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 52.6 84.1 97.7 97.3 98.8 72.2 67.6 75.7 60.9 64.2 78.8 87.5 1210.0 1314.0 1139.0 1341.0 1544.0 1771.0 1175.0 1026.0 1798.0 1138.0 1784.0 1511.0
-
1725.0 1868.0 1446.0 1386.0 1184.0 1027.0 1871.0
-
-
1604.0 1712.0
-
1529.0 1805.0 1755.0 1302.0
-
-
-
-
-
-
1683.0 Burst 1 3 3 3 3 2 2 2 1 1 2 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 108 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_09 Number of Bursts in Trial: 14 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 7 7 7 7 7 7 7 7 7 7 7 7 7 7 54.1 50.7 52.3 99.8 68.4 80.8 62.5 74.8 50.8 54.0 63.0 91.8 79.3 64.3 1415.0 1221.0 1974.0 1558.0 1014.0 1736.0 1778.0 1149.0 1049.0 1417.0 1730.0 1143.0 1274.0 1937.0
-
-
-
1696.0 1099.0 1505.0
-
1204.0
-
-
-
1270.0 1992.0
-
-
-
-
1949.0
-
-
-
-
-
-
-
1347.0
-
-
Burst 1 1 1 3 2 2 1 2 1 1 1 3 2 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 109 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_10 Number of Bursts in Trial: 8 Chrip Center Frequency: 5510.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 63.4 52.0 97.2 78.7 74.2 88.7 54.3 95.4 1043.0 1863.0 1973.0 1466.0 1280.0 1293.0 1991.0 1580.0
-
-
1605.0 1743.0 1219.0 1934.0
-
1555.0
-
-
1583.0
-
-
1273.0
-
1791.0 Burst 1 1 3 2 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 110 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_11 Number of Bursts in Trial: 17 Chrip Center Frequency: 5497.9MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 73.7 97.4 91.7 66.2 70.8 52.3 78.9 70.9 75.6 59.1 77.0 67.9 81.2 78.7 63.3 68.9 59.3 1208.0 1942.0 1999.0 1393.0 1968.0 1740.0 1308.0 1050.0 1437.0 1697.0 1397.0 1803.0 1720.0 1247.0 1634.0 1849.0 1093.0 1497.0 1754.0 1702.0
-
1821.0
-
1984.0 1358.0 1430.0
-
1304.0 1083.0 1932.0 1121.0
-
1423.0
-
-
1613.0 1462.0
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Burst 2 3 3 1 2 1 2 2 2 1 2 2 2 2 1 2 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 111 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_12 Number of Bursts in Trial: 19 Chrip Center Frequency: 5499.1MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 98.9 82.3 86.7 89.7 98.6 71.1 55.9 67.9 84.4 58.8 65.6 78.5 82.3 90.1 90.2 83.1 58.8 77.0 55.0 1381.0 1716.0 1211.0 1861.0 1507.0 1921.0 1947.0 1350.0 1203.0 1715.0 1017.0 1911.0 1845.0 1938.0 1989.0 1943.0 1742.0 1187.0 1012.0 1680.0 1855.0 1400.0 1068.0 1194.0 1789.0
-
1372.0 1107.0
-
-
1704.0 1686.0 1071.0 1089.0 1406.0
-
1657.0
-
1488.0
-
1919.0 1282.0 1461.0
-
-
-
1443.0
-
-
-
-
1266.0 1950.0
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 3 3 3 2 1 2 3 1 1 2 2 3 3 2 1 2 1 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 112 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_13 Number of Bursts in Trial: 15 Chrip Center Frequency: 5496.7MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 58.1 52.1 59.9 60.2 95.9 79.9 78.5 53.8 64.7 61.4 83.2 84.7 88.7 78.3 69.3 1929.0 1910.0 1971.0 1812.0 1399.0 1626.0 1238.0 1763.0 1800.0 1390.0 1692.0 1533.0 1703.0 1258.0 1731.0
-
-
-
-
1906.0 1859.0 1917.0
-
-
-
1858.0 1677.0 1528.0 1951.0 1717.0
-
-
-
-
1608.0
-
-
-
-
-
-
1638.0 1058.0
-
-
Burst 1 1 1 1 3 2 2 1 1 1 2 3 3 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 113 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_14 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.5MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 75.3 56.3 67.7 55.6 75.2 76.3 85.7 98.4 86.4 93.6 63.3 92.4 1994.0 1456.0 1617.0 1337.0 1421.0 1359.0 1547.0 1873.0 1779.0 1059.0 1328.0 1412.0 1612.0
-
1185.0
-
1267.0 1305.0 1362.0 1550.0 1439.0 1031.0
-
1673.0
-
-
-
-
-
-
1924.0 1249.0 1046.0 1452.0
-
1322.0 Burst 2 1 2 1 2 2 3 3 3 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 114 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_15 Number of Bursts in Trial: 19 Chrip Center Frequency: 5498.7MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 93.3 69.1 86.9 84.9 72.3 51.7 58.3 60.8 57.1 88.9 72.0 90.9 59.8 70.0 67.2 91.2 56.5 51.2 74.1 1983.0 1102.0 1044.0 1894.0 1094.0 1447.0 1429.0 1979.0 1641.0 1886.0 1909.0 1261.0 1552.0 1759.0 1625.0 1382.0 1483.0 1237.0 1471.0 1912.0 1794.0 1152.0 1948.0 1916.0
-
-
-
-
1964.0 1297.0 1566.0
-
1291.0 1881.0 1832.0
-
-
1245.0 1535.0
-
1148.0 1118.0
-
-
-
-
-
1489.0
-
1370.0
-
-
-
1661.0
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 3 3 2 1 1 1 1 3 2 3 1 2 2 3 1 1 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 115 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_16 Number of Bursts in Trial: 14 Chrip Center Frequency: 5496.3MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 76.9 50.2 62.9 64.7 83.8 65.4 53.2 51.7 78.7 72.4 53.8 73.6 66.7 82.5 1110.0 1316.0 1520.0 1902.0 1410.0 1944.0 1024.0 1603.0 1804.0 1030.0 1327.0 1524.0 1722.0 1404.0 1140.0
-
-
-
-
-
-
-
1097.0 1621.0
-
-
-
1168.0 1343.0
-
1553.0 1122.0 1019.0
-
-
-
-
-
-
-
-
-
Burst 2 1 1 1 3 1 1 1 2 2 1 2 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 116 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_17 Number of Bursts in Trial: 20 Chrip Center Frequency: 5499.5MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 3 3 2 2 1 2 2 2 1 3 3 2 3 1 1 3 3 3 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 87.6 85.2 84.8 77.9 76.5 60.9 83.0 80.4 67.5 62.1 86.4 84.3 76.9 95.8 55.2 59.0 94.5 91.9 85.2 69.5 1565.0 1735.0 1534.0 1749.0 1518.0 1540.0 1080.0 1824.0 1764.0 1495.0 1773.0 1593.0 1226.0 1192.0 1644.0 1402.0 1296.0 1970.0 1732.0 1038.0 1055.0 1541.0 1889.0 1460.0 1485.0
-
1010.0 1752.0 1181.0
-
1966.0 1188.0 1537.0 1298.0
-
-
1700.0 1978.0 1551.0 1224.0 1840.0 1408.0 1463.0
-
-
-
-
-
-
-
1263.0 1788.0
-
1844.0
-
-
1283.0 1165.0 1189.0
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 117 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_18 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.5MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 86.4 92.2 80.4 54.3 53.1 69.4 69.1 100.0 79.6 88.4 53.3 65.3 1259.0 1598.0 1816.0 1335.0 1303.0 1503.0 1279.0 1375.0 1239.0 1374.0 1016.0 1709.0 1918.0 1719.0 1899.0
-
-
1546.0 1639.0 1438.0 1705.0 1579.0
-
-
1455.0 1895.0
-
-
-
-
-
1595.0
-
1623.0
-
-
Burst 3 3 2 1 1 2 2 3 2 3 1 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 118 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_19 Number of Bursts in Trial: 14 Chrip Center Frequency: 5496.3MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 55.3 58.3 72.3 84.8 82.5 63.3 80.0 90.3 91.1 96.6 82.7 50.7 78.4 99.5 1920.0 1797.0 1610.0 1131.0 1875.0 1095.0 1119.0 1660.0 1539.0 1525.0 1710.0 1234.0 1047.0 1299.0
-
-
1039.0 1761.0 1431.0
-
1913.0 1853.0 1783.0 1036.0 1990.0
-
1109.0 1965.0
-
-
-
1721.0
-
-
-
1123.0 1172.0 1385.0
-
-
-
1869.0 Burst 1 1 2 3 2 1 2 3 3 3 2 1 2 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 119 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_20 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.5MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 88.6 57.4 96.6 69.7 77.9 62.0 88.4 97.3 96.2 95.4 54.8 80.4 1501.0 1723.0 1086.0 1751.0 1642.0 1866.0 1997.0 1790.0 1391.0 1020.0 1084.0 1850.0 1067.0
-
1658.0 1945.0 1317.0
-
1077.0 1896.0 1787.0 1892.0
-
1436.0 1927.0
-
1324.0
-
-
-
1366.0 1367.0 1672.0 1414.0
-
-
Burst 3 1 3 2 2 1 3 3 3 3 1 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 120 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_21 Number of Bursts in Trial: 16 Chrip Center Frequency: 5522.5MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 74.7 57.1 91.9 83.1 50.7 79.2 58.7 71.0 79.0 68.5 73.5 70.5 76.6 81.2 61.8 94.9 1619.0 1560.0 1392.0 1809.0 1003.0 1574.0 1186.0 1521.0 1777.0 1284.0 1904.0 1864.0 1045.0 1160.0 1277.0 1450.0 1611.0
-
1475.0 1772.0
-
1600.0
-
1567.0 1960.0 1428.0 1352.0 1115.0 1300.0 1675.0
-
1206.0
-
-
1276.0
-
-
-
-
-
-
-
-
-
-
-
-
1860.0 Burst 2 1 3 2 1 2 1 2 2 2 2 2 2 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 121 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_22 Number of Bursts in Trial: 12 Chrip Center Frequency: 5524.9MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 9 9 9 9 9 9 9 9 9 9 9 9 78.5 89.8 59.4 79.6 76.0 53.6 80.9 61.6 53.4 59.9 60.4 91.4 1653.0 1174.0 1982.0 1633.0 1112.0 1144.0 1220.0 1724.0 1901.0 1379.0 1453.0 1768.0 1698.0 1962.0
-
1890.0 1811.0
-
1053.0
-
-
-
-
-
1167.0
-
-
-
-
-
-
-
-
-
1726.0 1227.0 Burst 2 3 1 2 2 1 2 1 1 1 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 122 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_23 Number of Bursts in Trial: 20 Chrip Center Frequency: 5520.5MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 2 1 1 2 2 1 3 2 3 1 3 1 3 1 2 2 3 2 3 3 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 77.0 58.1 62.1 76.9 80.0 52.0 88.6 72.9 98.5 57.9 95.9 53.5 92.0 57.3 70.5 70.0 84.0 76.1 93.2 96.8 1191.0 1248.0 1836.0 1334.0 1914.0 1701.0 1693.0 1922.0 1839.0 1193.0 1659.0 1162.0 1745.0 1834.0 1684.0 1042.0 1765.0 1557.0 1985.0 1760.0 1363.0
-
-
1236.0 1852.0
-
1995.0 1387.0 1746.0
-
1870.0
-
1654.0
-
1586.0 1664.0 1630.0 1057.0 1018.0 1614.0
-
-
-
-
-
-
1905.0
-
1389.0
-
1066.0
-
1458.0
-
-
-
1176.0
-
1340.0 1817.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 123 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_24 Number of Bursts in Trial: 14 Chrip Center Frequency: 5523.7MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 50.1 93.5 68.8 56.3 86.0 75.2 54.4 71.1 76.2 80.2 79.7 90.9 68.7 67.4 1841.0 1590.0 1707.0 1056.0 1953.0 1572.0 1517.0 1329.0 1940.0 1098.0 1588.0 1615.0 1377.0 1872.0
-
1081.0 1577.0
-
1108.0 1536.0
-
1243.0 1770.0 1209.0 1214.0 1862.0 1441.0 1313.0
-
1413.0
-
-
1987.0
-
-
-
-
-
-
1601.0
-
-
Burst 1 3 2 1 3 2 1 2 2 2 2 3 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 124 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_25 Number of Bursts in Trial: 13 Chrip Center Frequency: 5524.1MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 11 11 11 11 11 11 11 11 11 11 11 11 11 94.0 70.8 56.3 96.7 90.6 74.5 92.6 89.0 96.5 70.5 94.0 55.8 87.7 1643.0 1177.0 1006.0 1230.0 1217.0 1569.0 1065.0 1493.0 1607.0 1141.0 1009.0 1290.0 1435.0 1748.0 1201.0
-
1163.0 1582.0 1281.0 1669.0 1135.0 1822.0 1178.0 1629.0
-
1963.0 1941.0
-
-
1332.0 1498.0
-
1222.0 1380.0 1602.0
-
1956.0
-
1164.0 Burst 3 2 1 3 3 2 3 3 3 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 125 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_26 Number of Bursts in Trial: 8 Chrip Center Frequency: 5526.5MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 5 5 5 5 5 5 5 5 68.6 83.1 60.9 77.7 77.4 66.8 63.7 91.2 1306.0 1420.0 1687.0 1776.0 1793.0 1576.0 1333.0 1409.0 1161.0 1315.0
-
1158.0 1510.0 1323.0
-
1681.0
-
-
-
-
-
-
-
1275.0 Burst 2 2 1 2 2 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 126 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_27 Number of Bursts in Trial: 17 Chrip Center Frequency: 5522.1MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 83.6 89.4 55.8 90.9 54.7 97.7 67.5 96.7 68.3 78.3 55.0 84.9 74.6 63.3 99.8 63.6 87.3 1632.0 1173.0 1532.0 1981.0 1825.0 1734.0 1571.0 1589.0 1750.0 1591.0 1427.0 1129.0 1959.0 1885.0 1035.0 1647.0 1931.0 1195.0 1627.0
-
1554.0
-
1202.0 1434.0 1469.0 1954.0 1082.0
-
1936.0 1856.0
-
1515.0
-
1051.0 1000.0 1656.0
-
1998.0
-
1250.0
-
1268.0
-
-
-
1199.0
-
-
1120.0
-
1831.0 Burst 3 3 1 3 1 3 2 3 2 2 1 3 2 1 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 127 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_28 Number of Bursts in Trial: 19 Chrip Center Frequency: 5520.9MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 85.6 68.6 54.2 61.2 97.1 98.3 62.4 80.2 87.5 85.8 88.1 65.3 52.5 52.3 74.1 54.9 76.2 60.4 81.5 1946.0 1029.0 1111.0 1104.0 1157.0 1142.0 1655.0 1126.0 1216.0 1847.0 1023.0 1848.0 1470.0 1312.0 1915.0 1479.0 1376.0 1758.0 1491.0 1078.0 1780.0
-
-
1969.0 1699.0
-
1769.0 1448.0 1348.0 1124.0
-
-
-
1200.0
-
1502.0
-
1103.0 1015.0
-
-
-
1100.0 1622.0
-
-
1179.0 1472.0 1631.0
-
-
-
-
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 1 1 3 3 1 2 3 3 3 1 1 1 2 1 2 1 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 128 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_29 Number of Bursts in Trial: 12 Chrip Center Frequency: 5524.5MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 50.5 55.7 85.8 76.9 75.1 92.3 78.1 92.2 89.0 70.9 63.1 55.3 1857.0 1246.0 1774.0 1125.0 1254.0 1180.0 1301.0 1898.0 1260.0 1578.0 1782.0 1522.0
-
-
1002.0 1474.0 1052.0 1486.0 1757.0 1252.0 1706.0 1620.0
-
-
-
-
1967.0
-
-
1492.0
-
1713.0 1411.0
-
-
-
Burst 1 1 3 2 2 3 2 3 3 2 1 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 129 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_30 Number of Bursts in Trial: 18 Chrip Center Frequency: 5521.7MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 83.4 97.3 90.4 91.8 98.2 59.5 80.0 86.5 91.1 93.5 60.7 67.2 61.8 79.4 81.4 65.7 76.0 81.0 1454.0 1319.0 1079.0 1563.0 1876.0 1952.0 1253.0 1054.0 1105.0 1867.0 1033.0 1288.0 1585.0 1933.0 1096.0 1496.0 1733.0 1326.0 1205.0 1826.0 1986.0 1151.0 1977.0
-
1137.0 1128.0 1599.0 1373.0
-
1405.0
-
1667.0 1464.0
-
1255.0 1668.0 1801.0 1635.0 1674.0 1802.0 1766.0
-
-
1828.0 1442.0 1087.0
-
-
-
-
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 3 3 3 3 3 1 2 3 3 3 1 2 1 2 2 1 2 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 130 / 250 Report Format Version: 6.1.2 802.11ac (VHT80) Long Pulse Radar Test Signal Test Signal Name: LP_Signal_01 Number of Bursts in Trial: 15 Chrip Center Frequency 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 77.8 51.9 63.8 96.6 85.9 73.7 77.2 68.4 76.7 53.2 85.7 94.3 77.6 65.7 93.5 1665.0 1074.0 1584.0 1682.0 1795.0 1198.0 1837.0 1587.0 2000.0 1147.0 1433.0 1670.0 1294.0 1512.0 1444.0 1477.0
-
-
1786.0 1215.0 1549.0 1819.0 1114.0 1155.0
-
1695.0 1426.0 1671.0
-
1130.0
-
-
-
1843.0 1729.0
-
-
-
-
-
1394.0 1935.0
-
-
1468.0 Burst 2 1 1 3 3 2 2 2 2 1 3 3 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 131 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_02 Number of Bursts in Trial: 8 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 7 7 7 7 7 7 7 7 75.0 99.4 67.4 73.6 65.9 83.8 65.5 98.6 1880.0 1401.0 1531.0 1449.0 1432.0 1356.0 1543.0 1548.0 1527.0 1262.0 1403.0 1041.0
-
1292.0
-
1796.0
-
1257.0
-
-
-
1419.0
-
1728.0 Burst 2 3 2 2 1 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 132 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_03 Number of Bursts in Trial: 11 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 7 7 7 7 7 7 7 7 7 7 7 73.8 69.5 51.9 84.6 95.4 68.0 89.6 81.9 88.3 53.7 91.3 1806.0 1117.0 1651.0 1976.0 1060.0 1368.0 1338.0 1022.0 1810.0 1597.0 1961.0 1538.0 1649.0
-
1032.0 1903.0 1351.0 1514.0 1689.0 1330.0
-
1106.0
-
-
-
1271.0 1388.0
-
1573.0
-
1838.0
-
1001.0 Burst 2 2 1 3 3 2 3 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 133 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_04 Number of Bursts in Trial: 20 Chrip Center Frequency: 5530.0MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 2 1 2 1 3 1 1 2 2 2 3 3 2 3 2 3 1 3 3 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 68.1 58.7 75.3 56.4 99.7 57.7 59.5 80.0 82.0 82.8 88.0 93.2 70.4 95.3 81.9 98.5 65.0 85.4 91.6 67.3 1339.0 1251.0 1136.0 1753.0 1196.0 1013.0 1072.0 1482.0 1993.0 1883.0 1061.0 1207.0 1526.0 1171.0 1690.0 1975.0 1767.0 1011.0 1878.0 1091.0 1355.0
-
1640.0
-
1708.0
-
-
1369.0 1197.0 1005.0 1928.0 1907.0 1360.0 1955.0 1545.0 1169.0
-
1637.0 1445.0 1218.0
-
-
-
-
1159.0
-
-
-
-
-
1101.0 1223.0
-
1775.0
-
1062.0
-
1425.0 1325.0
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 134 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_05 Number of Bursts in Trial: 17 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 67.9 62.3 53.3 90.0 77.1 83.9 89.1 81.8 50.3 87.1 71.3 97.5 90.6 86.3 97.6 84.7 99.7 1320.0 1957.0 1592.0 1900.0 1166.0 1278.0 1240.0 1833.0 1075.0 1116.0 1225.0 1884.0 1561.0 1596.0 1365.0 1021.0 1150.0 1133.0
-
-
1153.0 1646.0 1232.0 1384.0 1676.0
-
1996.0 1815.0 1465.0 1040.0 1183.0 1073.0 1718.0 1244.0
-
-
-
1346.0
-
1459.0 1939.0
-
-
1756.0
-
1132.0 1354.0 1792.0 1361.0 1854.0 1988.0 Burst 2 1 1 3 2 3 3 2 1 3 2 3 3 3 3 3 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 135 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_06 Number of Bursts in Trial: 14 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 8 8 8 8 8 8 8 8 8 8 8 8 8 8 92.9 67.7 65.8 56.3 53.7 83.5 65.8 85.9 76.3 81.5 89.4 63.4 69.6 74.5 1085.0 1744.0 1092.0 1851.0 1727.0 1679.0 1519.0 1134.0 1606.0 1891.0 1310.0 1568.0 1307.0 1264.0 1564.0 1747.0
-
-
-
1930.0
-
1034.0 1926.0 1714.0 1594.0
-
1925.0 1846.0 1407.0
-
-
-
-
1025.0
-
1808.0
-
-
1827.0
-
-
-
Burst 3 2 1 1 1 3 1 3 2 2 3 1 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 136 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_07 Number of Bursts in Trial: 15 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 96.6 96.7 86.5 73.3 55.8 55.4 85.3 79.4 65.7 68.6 77.7 79.6 94.9 61.4 90.6 1182.0 1829.0 1923.0 1908.0 1688.0 1145.0 1336.0 1344.0 1476.0 1008.0 1972.0 1882.0 1830.0 1451.0 1233.0 1609.0 1799.0 1396.0 1318.0
-
-
1504.0 1893.0
-
1028.0 1835.0 1331.0 1070.0
-
1562.0 1581.0 1154.0 1865.0
-
-
-
1820.0
-
-
-
-
-
1349.0
-
1887.0 Burst 3 3 3 2 1 1 3 2 1 2 2 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 137 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_08 Number of Bursts in Trial: 12 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 52.6 84.1 97.7 97.3 98.8 72.2 67.6 75.7 60.9 64.2 78.8 87.5 1210.0 1314.0 1139.0 1341.0 1544.0 1771.0 1175.0 1026.0 1798.0 1138.0 1784.0 1511.0
-
1725.0 1868.0 1446.0 1386.0 1184.0 1027.0 1871.0
-
-
1604.0 1712.0
-
1529.0 1805.0 1755.0 1302.0
-
-
-
-
-
-
1683.0 Burst 1 3 3 3 3 2 2 2 1 1 2 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 138 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_09 Number of Bursts in Trial: 14 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 6 6 6 6 6 6 6 6 6 6 6 6 6 6 54.1 50.7 52.3 99.8 68.4 80.8 62.5 74.8 50.8 54.0 63.0 91.8 79.3 64.3 1415.0 1221.0 1974.0 1558.0 1014.0 1736.0 1778.0 1149.0 1049.0 1417.0 1730.0 1143.0 1274.0 1937.0
-
-
-
1696.0 1099.0 1505.0
-
1204.0
-
-
-
1270.0 1992.0
-
-
-
-
1949.0
-
-
-
-
-
-
-
1347.0
-
-
Burst 1 1 1 3 2 2 1 2 1 1 1 3 2 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 139 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_10 Number of Bursts in Trial: 8 Chrip Center Frequency: 5530.0MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 11 11 11 11 11 11 11 11 63.4 52.0 97.2 78.7 74.2 88.7 54.3 95.4 1043.0 1863.0 1973.0 1466.0 1280.0 1293.0 1991.0 1580.0
-
-
1605.0 1743.0 1219.0 1934.0
-
1555.0
-
-
1583.0
-
-
1273.0
-
1791.0 Burst 1 1 3 2 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 140 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_11 Number of Bursts in Trial: 17 Chrip Center Frequency: 5498.15MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 73.7 97.4 91.7 66.2 70.8 52.3 78.9 70.9 75.6 59.1 77.0 67.9 81.2 78.7 63.3 68.9 59.3 1208.0 1942.0 1999.0 1393.0 1968.0 1740.0 1308.0 1050.0 1437.0 1697.0 1397.0 1803.0 1720.0 1247.0 1634.0 1849.0 1093.0 1497.0 1754.0 1702.0
-
1821.0
-
1984.0 1358.0 1430.0
-
1304.0 1083.0 1932.0 1121.0
-
1423.0
-
-
1613.0 1462.0
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Burst 2 3 3 1 2 1 2 2 2 1 2 2 2 2 1 2 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 141 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_12 Number of Bursts in Trial: 19 Chrip Center Frequency: 5499.35MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 98.9 82.3 86.7 89.7 98.6 71.1 55.9 67.9 84.4 58.8 65.6 78.5 82.3 90.1 90.2 83.1 58.8 77.0 55.0 1381.0 1716.0 1211.0 1861.0 1507.0 1921.0 1947.0 1350.0 1203.0 1715.0 1017.0 1911.0 1845.0 1938.0 1989.0 1943.0 1742.0 1187.0 1012.0 1680.0 1855.0 1400.0 1068.0 1194.0 1789.0
-
1372.0 1107.0
-
-
1704.0 1686.0 1071.0 1089.0 1406.0
-
1657.0
-
1488.0
-
1919.0 1282.0 1461.0
-
-
-
1443.0
-
-
-
-
1266.0 1950.0
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 3 3 3 2 1 2 3 1 1 2 2 3 3 2 1 2 1 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 142 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_13 Number of Bursts in Trial: 15 Chrip Center Frequency: 5496.95MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 58.1 52.1 59.9 60.2 95.9 79.9 78.5 53.8 64.7 61.4 83.2 84.7 88.7 78.3 69.3 1929.0 1910.0 1971.0 1812.0 1399.0 1626.0 1238.0 1763.0 1800.0 1390.0 1692.0 1533.0 1703.0 1258.0 1731.0
-
-
-
-
1906.0 1859.0 1917.0
-
-
-
1858.0 1677.0 1528.0 1951.0 1717.0
-
-
-
-
1608.0
-
-
-
-
-
-
1638.0 1058.0
-
-
Burst 1 1 1 1 3 2 2 1 1 1 2 3 3 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 143 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_14 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.75MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 75.3 56.3 67.7 55.6 75.2 76.3 85.7 98.4 86.4 93.6 63.3 92.4 1994.0 1456.0 1617.0 1337.0 1421.0 1359.0 1547.0 1873.0 1779.0 1059.0 1328.0 1412.0 1612.0
-
1185.0
-
1267.0 1305.0 1362.0 1550.0 1439.0 1031.0
-
1673.0
-
-
-
-
-
-
1924.0 1249.0 1046.0 1452.0
-
1322.0 Burst 2 1 2 1 2 2 3 3 3 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 144 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_15 Number of Bursts in Trial: 19 Chrip Center Frequency: 5498.95MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 18 93.3 69.1 86.9 84.9 72.3 51.7 58.3 60.8 57.1 88.9 72.0 90.9 59.8 70.0 67.2 91.2 56.5 51.2 74.1 1983.0 1102.0 1044.0 1894.0 1094.0 1447.0 1429.0 1979.0 1641.0 1886.0 1909.0 1261.0 1552.0 1759.0 1625.0 1382.0 1483.0 1237.0 1471.0 1912.0 1794.0 1152.0 1948.0 1916.0
-
-
-
-
1964.0 1297.0 1566.0
-
1291.0 1881.0 1832.0
-
-
1245.0 1535.0
-
1148.0 1118.0
-
-
-
-
-
1489.0
-
1370.0
-
-
-
1661.0
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 3 3 2 1 1 1 1 3 2 3 1 2 2 3 1 1 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 145 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_16 Number of Bursts in Trial: 14 Chrip Center Frequency: 5496.55MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 76.9 50.2 62.9 64.7 83.8 65.4 53.2 51.7 78.7 72.4 53.8 73.6 66.7 82.5 1110.0 1316.0 1520.0 1902.0 1410.0 1944.0 1024.0 1603.0 1804.0 1030.0 1327.0 1524.0 1722.0 1404.0 1140.0
-
-
-
-
-
-
-
1097.0 1621.0
-
-
-
1168.0 1343.0
-
1553.0 1122.0 1019.0
-
-
-
-
-
-
-
-
-
Burst 2 1 1 1 3 1 1 1 2 2 1 2 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 146 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_17 Number of Bursts in Trial: 20 Chrip Center Frequency: 5499.75MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 3 3 2 2 1 2 2 2 1 3 3 2 3 1 1 3 3 3 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 87.6 85.2 84.8 77.9 76.5 60.9 83.0 80.4 67.5 62.1 86.4 84.3 76.9 95.8 55.2 59.0 94.5 91.9 85.2 69.5 1565.0 1735.0 1534.0 1749.0 1518.0 1540.0 1080.0 1824.0 1764.0 1495.0 1773.0 1593.0 1226.0 1192.0 1644.0 1402.0 1296.0 1970.0 1732.0 1038.0 1055.0 1541.0 1889.0 1460.0 1485.0
-
1010.0 1752.0 1181.0
-
1966.0 1188.0 1537.0 1298.0
-
-
1700.0 1978.0 1551.0 1224.0 1840.0 1408.0 1463.0
-
-
-
-
-
-
-
1263.0 1788.0
-
1844.0
-
-
1283.0 1165.0 1189.0
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 147 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_18 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.75MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 86.4 92.2 80.4 54.3 53.1 69.4 69.1 100.0 79.6 88.4 53.3 65.3 1259.0 1598.0 1816.0 1335.0 1303.0 1503.0 1279.0 1375.0 1239.0 1374.0 1016.0 1709.0 1918.0 1719.0 1899.0
-
-
1546.0 1639.0 1438.0 1705.0 1579.0
-
-
1455.0 1895.0
-
-
-
-
-
1595.0
-
1623.0
-
-
Burst 3 3 2 1 1 2 2 3 2 3 1 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 148 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_19 Number of Bursts in Trial: 14 Chrip Center Frequency: 5496.55MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 55.3 58.3 72.3 84.8 82.5 63.3 80.0 90.3 91.1 96.6 82.7 50.7 78.4 99.5 1920.0 1797.0 1610.0 1131.0 1875.0 1095.0 1119.0 1660.0 1539.0 1525.0 1710.0 1234.0 1047.0 1299.0
-
-
1039.0 1761.0 1431.0
-
1913.0 1853.0 1783.0 1036.0 1990.0
-
1109.0 1965.0
-
-
-
1721.0
-
-
-
1123.0 1172.0 1385.0
-
-
-
1869.0 Burst 1 1 2 3 2 1 2 3 3 3 2 1 2 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 149 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_20 Number of Bursts in Trial: 12 Chrip Center Frequency: 5495.75MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 88.6 57.4 96.6 69.7 77.9 62.0 88.4 97.3 96.2 95.4 54.8 80.4 1501.0 1723.0 1086.0 1751.0 1642.0 1866.0 1997.0 1790.0 1391.0 1020.0 1084.0 1850.0 1067.0
-
1658.0 1945.0 1317.0
-
1077.0 1896.0 1787.0 1892.0
-
1436.0 1927.0
-
1324.0
-
-
-
1366.0 1367.0 1672.0 1414.0
-
-
Burst 3 1 3 2 2 1 3 3 3 3 1 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 150 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_21 Number of Bursts in Trial: 16 Chrip Center Frequency: 5562.25MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 74.7 57.1 91.9 83.1 50.7 79.2 58.7 71.0 79.0 68.5 73.5 70.5 76.6 81.2 61.8 94.9 1619.0 1560.0 1392.0 1809.0 1003.0 1574.0 1186.0 1521.0 1777.0 1284.0 1904.0 1864.0 1045.0 1160.0 1277.0 1450.0 1611.0
-
1475.0 1772.0
-
1600.0
-
1567.0 1960.0 1428.0 1352.0 1115.0 1300.0 1675.0
-
1206.0
-
-
1276.0
-
-
-
-
-
-
-
-
-
-
-
-
1860.0 Burst 2 1 3 2 1 2 1 2 2 2 2 2 2 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 151 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_22 Number of Bursts in Trial: 12 Chrip Center Frequency: 5564.65MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 9 9 9 9 9 9 9 9 9 9 9 9 78.5 89.8 59.4 79.6 76.0 53.6 80.9 61.6 53.4 59.9 60.4 91.4 1653.0 1174.0 1982.0 1633.0 1112.0 1144.0 1220.0 1724.0 1901.0 1379.0 1453.0 1768.0 1698.0 1962.0
-
1890.0 1811.0
-
1053.0
-
-
-
-
-
1167.0
-
-
-
-
-
-
-
-
-
1726.0 1227.0 Burst 2 3 1 2 2 1 2 1 1 1 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 152 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_23 Number of Bursts in Trial: 20 Chrip Center Frequency: 5560.25MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 2 1 1 2 2 1 3 2 3 1 3 1 3 1 2 2 3 2 3 3 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 77.0 58.1 62.1 76.9 80.0 52.0 88.6 72.9 98.5 57.9 95.9 53.5 92.0 57.3 70.5 70.0 84.0 76.1 93.2 96.8 1191.0 1248.0 1836.0 1334.0 1914.0 1701.0 1693.0 1922.0 1839.0 1193.0 1659.0 1162.0 1745.0 1834.0 1684.0 1042.0 1765.0 1557.0 1985.0 1760.0 1363.0
-
-
1236.0 1852.0
-
1995.0 1387.0 1746.0
-
1870.0
-
1654.0
-
1586.0 1664.0 1630.0 1057.0 1018.0 1614.0
-
-
-
-
-
-
1905.0
-
1389.0
-
1066.0
-
1458.0
-
-
-
1176.0
-
1340.0 1817.0 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 153 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_24 Number of Bursts in Trial: 14 Chrip Center Frequency: 5563.45MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 12 12 12 12 12 12 12 12 12 12 12 12 12 12 50.1 93.5 68.8 56.3 86.0 75.2 54.4 71.1 76.2 80.2 79.7 90.9 68.7 67.4 1841.0 1590.0 1707.0 1056.0 1953.0 1572.0 1517.0 1329.0 1940.0 1098.0 1588.0 1615.0 1377.0 1872.0
-
1081.0 1577.0
-
1108.0 1536.0
-
1243.0 1770.0 1209.0 1214.0 1862.0 1441.0 1313.0
-
1413.0
-
-
1987.0
-
-
-
-
-
-
1601.0
-
-
Burst 1 3 2 1 3 2 1 2 2 2 2 3 2 2 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 154 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_25 Number of Bursts in Trial: 13 Chrip Center Frequency: 5563.85MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 11 11 11 11 11 11 11 11 11 11 11 11 11 94.0 70.8 56.3 96.7 90.6 74.5 92.6 89.0 96.5 70.5 94.0 55.8 87.7 1643.0 1177.0 1006.0 1230.0 1217.0 1569.0 1065.0 1493.0 1607.0 1141.0 1009.0 1290.0 1435.0 1748.0 1201.0
-
1163.0 1582.0 1281.0 1669.0 1135.0 1822.0 1178.0 1629.0
-
1963.0 1941.0
-
-
1332.0 1498.0
-
1222.0 1380.0 1602.0
-
1956.0
-
1164.0 Burst 3 2 1 3 3 2 3 3 3 2 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 155 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_26 Number of Bursts in Trial: 8 Chrip Center Frequency: 5566.25MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 5 5 5 5 5 5 5 5 68.6 83.1 60.9 77.7 77.4 66.8 63.7 91.2 1306.0 1420.0 1687.0 1776.0 1793.0 1576.0 1333.0 1409.0 1161.0 1315.0
-
1158.0 1510.0 1323.0
-
1681.0
-
-
-
-
-
-
-
1275.0 Burst 2 2 1 2 2 2 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 156 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_27 Number of Bursts in Trial: 17 Chrip Center Frequency: 5561.85MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 83.6 89.4 55.8 90.9 54.7 97.7 67.5 96.7 68.3 78.3 55.0 84.9 74.6 63.3 99.8 63.6 87.3 1632.0 1173.0 1532.0 1981.0 1825.0 1734.0 1571.0 1589.0 1750.0 1591.0 1427.0 1129.0 1959.0 1885.0 1035.0 1647.0 1931.0 1195.0 1627.0
-
1554.0
-
1202.0 1434.0 1469.0 1954.0 1082.0
-
1936.0 1856.0
-
1515.0
-
1051.0 1000.0 1656.0
-
1998.0
-
1250.0
-
1268.0
-
-
-
1199.0
-
-
1120.0
-
1831.0 Burst 3 3 1 3 1 3 2 3 2 2 1 3 2 1 3 1 3 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 157 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_28 Number of Bursts in Trial: 19 Chrip Center Frequency: 5560.65MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 19 85.6 68.6 54.2 61.2 97.1 98.3 62.4 80.2 87.5 85.8 88.1 65.3 52.5 52.3 74.1 54.9 76.2 60.4 81.5 1946.0 1029.0 1111.0 1104.0 1157.0 1142.0 1655.0 1126.0 1216.0 1847.0 1023.0 1848.0 1470.0 1312.0 1915.0 1479.0 1376.0 1758.0 1491.0 1078.0 1780.0
-
-
1969.0 1699.0
-
1769.0 1448.0 1348.0 1124.0
-
-
-
1200.0
-
1502.0
-
1103.0 1015.0
-
-
-
1100.0 1622.0
-
-
1179.0 1472.0 1631.0
-
-
-
-
-
-
-
-
Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 3 2 1 1 3 3 1 2 3 3 3 1 1 1 2 1 2 1 2 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 158 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_29 Number of Bursts in Trial: 12 Chrip Center Frequency: 5564.25MHz Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 10 10 10 10 10 10 10 10 10 10 10 10 50.5 55.7 85.8 76.9 75.1 92.3 78.1 92.2 89.0 70.9 63.1 55.3 1857.0 1246.0 1774.0 1125.0 1254.0 1180.0 1301.0 1898.0 1260.0 1578.0 1782.0 1522.0
-
-
1002.0 1474.0 1052.0 1486.0 1757.0 1252.0 1706.0 1620.0
-
-
-
-
1967.0
-
-
1492.0
-
1713.0 1411.0
-
-
-
Burst 1 1 3 2 2 3 2 3 3 2 1 1 Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 159 / 250 Report Format Version: 6.1.2 Long Pulse Radar Test Signal Test Signal Name: LP_Signal_30 Number of Bursts in Trial: 18 Chrip Center Frequency: 5561.45MHz Burst Burst Pulses per 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 3 3 3 3 3 1 2 3 3 3 1 2 1 2 2 1 2 2 Chirp
(MHz) Pulse Width(us) PRI-1 (us) PRI-2 (us) PRI-3 (us) 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 17 83.4 97.3 90.4 91.8 98.2 59.5 80.0 86.5 91.1 93.5 60.7 67.2 61.8 79.4 81.4 65.7 76.0 81.0 1454.0 1319.0 1079.0 1563.0 1876.0 1952.0 1253.0 1054.0 1105.0 1867.0 1033.0 1288.0 1585.0 1933.0 1096.0 1496.0 1733.0 1326.0 1205.0 1826.0 1986.0 1151.0 1977.0
-
1137.0 1128.0 1599.0 1373.0
-
1405.0
-
1667.0 1464.0
-
1255.0 1668.0 1801.0 1635.0 1674.0 1802.0 1766.0
-
-
1828.0 1442.0 1087.0
-
-
-
-
-
-
-
-
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 160 / 250 Report Format Version: 6.1.2 Appendix A.2 - The Frequency Hopping Radar pattern 802.11ac (VHT20) Hopping Frequency Sequence Name: HOP_FREQ_SEQ_01 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.505G 5.520G 5.685G 5.313G 5.695G 5.533G 5.604G 5.399G 5.667G 5.319G 5.624G 5.531G 5.688G 5.336G 5.635G 5.389G 5.665G 5.279G 5.717G 5.630G 5.608G 5.549G 5.643G 5.535G 5.507G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.674G 5.262G 5.332G 5.383G 5.461G 5.287G 5.591G 5.593G 5.434G 5.376G 5.302G 5.298G 5.372G 5.308G 5.650G 5.626G 5.481G 5.558G 5.382G 5.603G 5.329G 5.451G 5.285G 5.584G 5.712G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.257G 5.356G 5.720G 5.697G 5.719G 5.675G 5.564G 5.600G 5.299G 5.710G 5.406G 5.303G 5.699G 5.565G 5.357G 5.411G 5.354G 5.578G 5.297G 5.676G 5.388G 5.709G 5.377G 5.506G 5.680G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.690G 5.439G 5.579G 5.318G 5.606G 5.540G 5.612G 5.478G 5.387G 5.581G 5.272G 5.265G 5.550G 5.269G 5.462G 5.386G 5.267G 5.647G 5.601G 5.657G 5.602G 5.716G 5.443G 5.723G 5.724G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 161 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_02 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.350G 5.699G 5.299G 5.487G 5.269G 5.680G 5.303G 5.632G 5.308G 5.494G 5.553G 5.664G 5.452G 5.662G 5.595G 5.465G 5.671G 5.300G 5.330G 5.416G 5.252G 5.478G 5.279G 5.594G 5.533G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.673G 5.714G 5.455G 5.448G 5.614G 5.603G 5.504G 5.535G 5.566G 5.400G 5.343G 5.718G 5.588G 5.275G 5.479G 5.312G 5.284G 5.568G 5.399G 5.723G 5.703G 5.482G 5.316G 5.633G 5.446G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.251G 5.500G 5.359G 5.663G 5.439G 5.363G 5.576G 5.402G 5.689G 5.513G 5.532G 5.612G 5.307G 5.583G 5.410G 5.268G 5.406G 5.318G 5.694G 5.637G 5.654G 5.474G 5.592G 5.380G 5.526G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.286G 5.265G 5.611G 5.373G 5.385G 5.341G 5.584G 5.597G 5.301G 5.691G 5.520G 5.444G 5.422G 5.578G 5.693G 5.629G 5.624G 5.711G 5.631G 5.339G 5.538G 5.407G 5.627G 5.598G 5.555G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 162 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_03 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.501G 5.549G 5.264G 5.640G 5.703G 5.364G 5.546G 5.465G 5.621G 5.659G 5.654G 5.408G 5.337G 5.278G 5.432G 5.342G 5.668G 5.685G 5.504G 5.417G 5.449G 5.314G 5.392G 5.625G 5.622G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.592G 5.346G 5.700G 5.669G 5.585G 5.296G 5.555G 5.456G 5.717G 5.498G 5.508G 5.427G 5.464G 5.680G 5.538G 5.615G 5.460G 5.469G 5.660G 5.672G 5.347G 5.321G 5.437G 5.463G 5.688G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.263G 5.361G 5.623G 5.344G 5.382G 5.524G 5.710G 5.526G 5.667G 5.478G 5.716G 5.306G 5.712G 5.365G 5.315G 5.674G 5.590G 5.453G 5.353G 5.331G 5.610G 5.415G 5.691G 5.582G 5.266G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.484G 5.576G 5.324G 5.579G 5.601G 5.532G 5.644G 5.627G 5.652G 5.386G 5.599G 5.402G 5.358G 5.442G 5.587G 5.563G 5.542G 5.429G 5.616G 5.393G 5.706G 5.724G 5.407G 5.646G 5.428G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 163 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_04 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.487G 5.312G 5.492G 5.328G 5.440G 5.370G 5.292G 5.541G 5.558G 5.591G 5.437G 5.316G 5.416G 5.260G 5.256G 5.288G 5.604G 5.404G 5.300G 5.415G 5.451G 5.584G 5.525G 5.482G 5.427G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.498G 5.447G 5.699G 5.520G 5.294G 5.405G 5.590G 5.564G 5.319G 5.375G 5.674G 5.636G 5.284G 5.353G 5.600G 5.637G 5.709G 5.508G 5.497G 5.333G 5.443G 5.338G 5.542G 5.666G 5.384G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.707G 5.259G 5.308G 5.318G 5.486G 5.266G 5.459G 5.472G 5.645G 5.678G 5.706G 5.301G 5.321G 5.489G 5.307G 5.631G 5.568G 5.681G 5.633G 5.251G 5.625G 5.647G 5.361G 5.608G 5.457G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.277G 5.548G 5.677G 5.433G 5.258G 5.380G 5.495G 5.680G 5.475G 5.649G 5.460G 5.660G 5.545G 5.334G 5.683G 5.253G 5.697G 5.345G 5.655G 5.374G 5.473G 5.304G 5.650G 5.589G 5.355G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 164 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_05 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.583G 5.275G 5.461G 5.399G 5.487G 5.550G 5.299G 5.321G 5.600G 5.396G 5.659G 5.329G 5.492G 5.620G 5.616G 5.271G 5.318G 5.598G 5.665G 5.489G 5.257G 5.689G 5.674G 5.664G 5.284G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.381G 5.678G 5.670G 5.420G 5.484G 5.333G 5.261G 5.300G 5.509G 5.713G 5.607G 5.708G 5.379G 5.681G 5.591G 5.596G 5.585G 5.251G 5.667G 5.309G 5.697G 5.647G 5.572G 5.706G 5.312G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.662G 5.287G 5.279G 5.479G 5.320G 5.573G 5.263G 5.391G 5.718G 5.457G 5.536G 5.534G 5.653G 5.546G 5.508G 5.500G 5.336G 5.512G 5.682G 5.490G 5.719G 5.568G 5.619G 5.360G 5.367G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.649G 5.452G 5.702G 5.278G 5.433G 5.456G 5.614G 5.551G 5.522G 5.717G 5.370G 5.429G 5.545G 5.715G 5.375G 5.455G 5.657G 5.668G 5.407G 5.418G 5.341G 5.699G 5.408G 5.439G 5.478G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 165 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_06 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.493G 5.367G 5.338G 5.439G 5.384G 5.583G 5.465G 5.611G 5.653G 5.605G 5.637G 5.516G 5.418G 5.682G 5.396G 5.314G 5.691G 5.495G 5.499G 5.692G 5.484G 5.394G 5.471G 5.332G 5.429G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.665G 5.518G 5.467G 5.406G 5.447G 5.697G 5.632G 5.546G 5.660G 5.502G 5.519G 5.346G 5.354G 5.702G 5.441G 5.371G 5.413G 5.419G 5.392G 5.342G 5.491G 5.397G 5.514G 5.680G 5.430G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.291G 5.444G 5.262G 5.267G 5.647G 5.260G 5.268G 5.466G 5.357G 5.604G 5.258G 5.645G 5.644G 5.607G 5.273G 5.306G 5.551G 5.531G 5.347G 5.723G 5.705G 5.534G 5.339G 5.482G 5.464G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.553G 5.350G 5.629G 5.293G 5.716G 5.609G 5.593G 5.478G 5.454G 5.703G 5.601G 5.638G 5.456G 5.503G 5.548G 5.360G 5.485G 5.492G 5.497G 5.356G 5.563G 5.269G 5.640G 5.488G 5.295G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 166 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_07 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.320G 5.603G 5.299G 5.454G 5.434G 5.307G 5.556G 5.336G 5.574G 5.700G 5.272G 5.628G 5.451G 5.539G 5.414G 5.256G 5.504G 5.476G 5.638G 5.255G 5.450G 5.510G 5.296G 5.560G 5.530G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.390G 5.488G 5.545G 5.277G 5.475G 5.317G 5.541G 5.578G 5.382G 5.571G 5.536G 5.595G 5.356G 5.685G 5.679G 5.283G 5.441G 5.462G 5.689G 5.303G 5.611G 5.724G 5.605G 5.612G 5.327G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.286G 5.457G 5.358G 5.687G 5.619G 5.319G 5.623G 5.304G 5.570G 5.491G 5.279G 5.479G 5.309G 5.648G 5.362G 5.376G 5.284G 5.381G 5.357G 5.592G 5.566G 5.680G 5.490G 5.555G 5.573G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.418G 5.410G 5.355G 5.582G 5.627G 5.421G 5.546G 5.325G 5.544G 5.465G 5.402G 5.401G 5.561G 5.693G 5.695G 5.706G 5.449G 5.343G 5.389G 5.675G 5.265G 5.392G 5.631G 5.487G 5.704G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 167 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_08 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.537G 5.583G 5.424G 5.599G 5.521G 5.677G 5.381G 5.296G 5.648G 5.650G 5.469G 5.253G 5.720G 5.438G 5.593G 5.560G 5.649G 5.647G 5.589G 5.689G 5.608G 5.704G 5.686G 5.416G 5.464G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.669G 5.304G 5.441G 5.277G 5.478G 5.581G 5.259G 5.565G 5.563G 5.495G 5.582G 5.323G 5.712G 5.415G 5.427G 5.697G 5.298G 5.467G 5.347G 5.368G 5.473G 5.662G 5.702G 5.553G 5.396G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.683G 5.607G 5.256G 5.349G 5.612G 5.300G 5.637G 5.306G 5.452G 5.503G 5.307G 5.676G 5.679G 5.268G 5.383G 5.675G 5.651G 5.329G 5.628G 5.611G 5.575G 5.342G 5.624G 5.576G 5.386G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.517G 5.656G 5.552G 5.707G 5.302G 5.412G 5.251G 5.285G 5.555G 5.594G 5.255G 5.709G 5.482G 5.636G 5.661G 5.468G 5.400G 5.652G 5.500G 5.387G 5.278G 5.592G 5.434G 5.477G 5.432G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 168 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_09 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.349G 5.530G 5.350G 5.625G 5.432G 5.357G 5.282G 5.467G 5.640G 5.295G 5.278G 5.455G 5.632G 5.721G 5.403G 5.492G 5.508G 5.512G 5.499G 5.608G 5.433G 5.633G 5.601G 5.419G 5.446G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.590G 5.355G 5.724G 5.554G 5.412G 5.389G 5.524G 5.720G 5.329G 5.567G 5.578G 5.327G 5.453G 5.650G 5.373G 5.690G 5.485G 5.687G 5.440G 5.723G 5.612G 5.582G 5.391G 5.598G 5.478G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.466G 5.575G 5.456G 5.713G 5.454G 5.626G 5.697G 5.459G 5.605G 5.302G 5.461G 5.592G 5.422G 5.704G 5.367G 5.618G 5.496G 5.296G 5.579G 5.576G 5.482G 5.437G 5.647G 5.434G 5.551G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.546G 5.709G 5.682G 5.477G 5.402G 5.717G 5.264G 5.313G 5.427G 5.635G 5.700G 5.275G 5.300G 5.380G 5.372G 5.540G 5.548G 5.676G 5.604G 5.703G 5.583G 5.521G 5.393G 5.597G 5.621G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 169 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_10 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.550G 5.657G 5.400G 5.448G 5.381G 5.583G 5.353G 5.706G 5.554G 5.355G 5.380G 5.285G 5.323G 5.447G 5.422G 5.359G 5.690G 5.603G 5.713G 5.551G 5.567G 5.296G 5.430G 5.488G 5.641G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.265G 5.490G 5.263G 5.659G 5.398G 5.333G 5.668G 5.421G 5.503G 5.341G 5.698G 5.425G 5.281G 5.420G 5.638G 5.483G 5.389G 5.688G 5.649G 5.615G 5.442G 5.597G 5.407G 5.631G 5.342G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.435G 5.566G 5.271G 5.549G 5.278G 5.482G 5.460G 5.283G 5.513G 5.532G 5.392G 5.454G 5.544G 5.600G 5.324G 5.628G 5.495G 5.266G 5.465G 5.620G 5.524G 5.360G 5.612G 5.375G 5.443G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.470G 5.303G 5.372G 5.571G 5.511G 5.494G 5.563G 5.703G 5.461G 5.528G 5.582G 5.617G 5.466G 5.676G 5.295G 5.350G 5.252G 5.696G 5.413G 5.358G 5.506G 5.484G 5.619G 5.432G 5.590G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 170 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_11 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.408G 5.321G 5.723G 5.709G 5.261G 5.487G 5.262G 5.568G 5.538G 5.721G 5.300G 5.684G 5.480G 5.603G 5.629G 5.657G 5.515G 5.251G 5.492G 5.676G 5.498G 5.330G 5.652G 5.551G 5.369G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.306G 5.559G 5.451G 5.553G 5.669G 5.589G 5.711G 5.564G 5.484G 5.483G 5.478G 5.663G 5.655G 5.627G 5.365G 5.447G 5.295G 5.458G 5.358G 5.588G 5.491G 5.613G 5.403G 5.343G 5.276G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.263G 5.525G 5.696G 5.257G 5.462G 5.625G 5.362G 5.666G 5.641G 5.659G 5.563G 5.252G 5.521G 5.314G 5.351G 5.270G 5.268G 5.320G 5.357G 5.414G 5.604G 5.317G 5.675G 5.460G 5.532G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.393G 5.427G 5.626G 5.474G 5.348G 5.294G 5.623G 5.413G 5.520G 5.339G 5.269G 5.254G 5.377G 5.364G 5.528G 5.477G 5.383G 5.374G 5.410G 5.399G 5.658G 5.539G 5.642G 5.543G 5.708G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 171 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_12 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.603G 5.678G 5.364G 5.476G 5.561G 5.268G 5.549G 5.583G 5.452G 5.586G 5.424G 5.619G 5.272G 5.696G 5.442G 5.398G 5.624G 5.329G 5.387G 5.690G 5.628G 5.441G 5.341G 5.573G 5.309G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.666G 5.480G 5.297G 5.662G 5.306G 5.498G 5.294G 5.462G 5.260G 5.577G 5.264G 5.500G 5.353G 5.576G 5.432G 5.394G 5.414G 5.634G 5.596G 5.453G 5.451G 5.381G 5.496G 5.365G 5.397G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.522G 5.479G 5.713G 5.437G 5.416G 5.674G 5.558G 5.291G 5.497G 5.658G 5.680G 5.266G 5.661G 5.391G 5.305G 5.368G 5.483G 5.578G 5.650G 5.613G 5.478G 5.552G 5.455G 5.642G 5.568G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.502G 5.281G 5.316G 5.710G 5.463G 5.313G 5.637G 5.492G 5.535G 5.470G 5.347G 5.411G 5.317G 5.376G 5.461G 5.283G 5.458G 5.718G 5.517G 5.653G 5.356G 5.395G 5.469G 5.505G 5.639G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 172 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_13 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.375G 5.612G 5.422G 5.589G 5.657G 5.474G 5.433G 5.668G 5.434G 5.401G 5.277G 5.496G 5.690G 5.367G 5.300G 5.528G 5.599G 5.378G 5.513G 5.571G 5.482G 5.288G 5.723G 5.345G 5.390G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.264G 5.436G 5.631G 5.506G 5.497G 5.629G 5.560G 5.484G 5.356G 5.426G 5.567G 5.675G 5.694G 5.522G 5.468G 5.526G 5.358G 5.478G 5.263G 5.604G 5.366G 5.512G 5.705G 5.486G 5.352G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.273G 5.695G 5.262G 5.326G 5.509G 5.272G 5.399G 5.408G 5.563G 5.393G 5.593G 5.419G 5.373G 5.674G 5.596G 5.537G 5.303G 5.469G 5.586G 5.446G 5.394G 5.551G 5.412G 5.678G 5.649G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.293G 5.549G 5.490G 5.282G 5.660G 5.314G 5.357G 5.325G 5.285G 5.621G 5.559G 5.319G 5.661G 5.265G 5.324G 5.669G 5.648G 5.407G 5.360G 5.479G 5.693G 5.585G 5.711G 5.361G 5.647G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 173 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_14 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.507G 5.503G 5.475G 5.534G 5.389G 5.277G 5.388G 5.312G 5.287G 5.443G 5.500G 5.621G 5.390G 5.722G 5.355G 5.480G 5.482G 5.694G 5.495G 5.465G 5.699G 5.635G 5.348G 5.317G 5.332G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.709G 5.594G 5.275G 5.406G 5.314G 5.302G 5.258G 5.595G 5.408G 5.427G 5.587G 5.588G 5.539G 5.696G 5.656G 5.581G 5.432G 5.580G 5.674G 5.330G 5.645G 5.548G 5.629G 5.384G 5.456G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.352G 5.415G 5.657G 5.612G 5.323G 5.545G 5.386G 5.689G 5.464G 5.416G 5.457G 5.442G 5.425G 5.413G 5.704G 5.632G 5.259G 5.536G 5.347G 5.589G 5.380G 5.563G 5.641G 5.562G 5.262G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.516G 5.255G 5.344G 5.671G 5.544G 5.577G 5.434G 5.420G 5.511G 5.365G 5.395G 5.411G 5.521G 5.529G 5.316G 5.676G 5.438G 5.663G 5.400G 5.519G 5.672G 5.710G 5.509G 5.666G 5.701G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 174 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_15 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.332G 5.366G 5.496G 5.410G 5.269G 5.585G 5.360G 5.604G 5.693G 5.382G 5.273G 5.317G 5.358G 5.528G 5.530G 5.381G 5.415G 5.455G 5.722G 5.390G 5.563G 5.605G 5.492G 5.284G 5.537G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.253G 5.427G 5.474G 5.687G 5.385G 5.509G 5.339G 5.462G 5.337G 5.556G 5.313G 5.324G 5.493G 5.590G 5.640G 5.579G 5.442G 5.300G 5.305G 5.637G 5.607G 5.617G 5.294G 5.298G 5.611G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.256G 5.495G 5.448G 5.686G 5.429G 5.255G 5.335G 5.479G 5.671G 5.523G 5.586G 5.505G 5.456G 5.506G 5.318G 5.667G 5.621G 5.441G 5.331G 5.266G 5.461G 5.403G 5.706G 5.564G 5.645G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.368G 5.322G 5.678G 5.533G 5.261G 5.478G 5.512G 5.562G 5.260G 5.292G 5.668G 5.486G 5.610G 5.517G 5.274G 5.661G 5.552G 5.491G 5.365G 5.591G 5.262G 5.600G 5.507G 5.650G 5.413G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 175 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_16 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.469G 5.330G 5.666G 5.352G 5.693G 5.702G 5.516G 5.724G 5.411G 5.649G 5.504G 5.545G 5.382G 5.317G 5.505G 5.270G 5.707G 5.320G 5.661G 5.619G 5.654G 5.337G 5.251G 5.460G 5.640G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.426G 5.537G 5.332G 5.457G 5.631G 5.403G 5.538G 5.704G 5.717G 5.606G 5.472G 5.480G 5.284G 5.520G 5.463G 5.618G 5.664G 5.464G 5.566G 5.420G 5.714G 5.644G 5.265G 5.413G 5.394G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.347G 5.391G 5.651G 5.686G 5.269G 5.536G 5.490G 5.442G 5.571G 5.319G 5.609G 5.256G 5.543G 5.604G 5.685G 5.662G 5.552G 5.641G 5.299G 5.488G 5.287G 5.648G 5.279G 5.308G 5.348G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.449G 5.687G 5.341G 5.531G 5.525G 5.363G 5.511G 5.441G 5.647G 5.448G 5.438G 5.679G 5.424G 5.397G 5.602G 5.273G 5.294G 5.476G 5.584G 5.593G 5.657G 5.659G 5.359G 5.544G 5.613G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 176 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_17 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.421G 5.583G 5.268G 5.485G 5.467G 5.659G 5.288G 5.489G 5.376G 5.614G 5.587G 5.328G 5.557G 5.714G 5.577G 5.307G 5.617G 5.446G 5.304G 5.397G 5.599G 5.625G 5.501G 5.573G 5.435G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.498G 5.662G 5.654G 5.419G 5.646G 5.620G 5.478G 5.274G 5.719G 5.448G 5.350G 5.710G 5.674G 5.353G 5.482G 5.464G 5.608G 5.561G 5.354G 5.344G 5.567G 5.324G 5.651G 5.411G 5.459G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.713G 5.657G 5.517G 5.276G 5.359G 5.345G 5.637G 5.703G 5.682G 5.256G 5.605G 5.330G 5.437G 5.488G 5.700G 5.423G 5.562G 5.493G 5.495G 5.426G 5.510G 5.707G 5.292G 5.597G 5.282G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.660G 5.641G 5.259G 5.649G 5.642G 5.257G 5.252G 5.534G 5.413G 5.365G 5.447G 5.679G 5.668G 5.427G 5.626G 5.336G 5.443G 5.560G 5.680G 5.425G 5.555G 5.262G 5.424G 5.691G 5.600G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 177 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_18 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.471G 5.446G 5.484G 5.454G 5.270G 5.264G 5.662G 5.301G 5.253G 5.267G 5.468G 5.381G 5.592G 5.710G 5.647G 5.317G 5.481G 5.358G 5.364G 5.457G 5.260G 5.325G 5.373G 5.626G 5.724G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.678G 5.666G 5.489G 5.682G 5.610G 5.415G 5.697G 5.334G 5.439G 5.689G 5.613G 5.250G 5.360G 5.409G 5.668G 5.428G 5.308G 5.466G 5.261G 5.672G 5.683G 5.686G 5.402G 5.702G 5.670G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.410G 5.563G 5.556G 5.554G 5.586G 5.266G 5.379G 5.573G 5.300G 5.539G 5.496G 5.298G 5.532G 5.517G 5.309G 5.597G 5.584G 5.616G 5.655G 5.565G 5.343G 5.353G 5.352G 5.258G 5.444G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.537G 5.355G 5.596G 5.595G 5.549G 5.339G 5.392G 5.643G 5.519G 5.455G 5.665G 5.272G 5.324G 5.467G 5.548G 5.314G 5.622G 5.295G 5.660G 5.652G 5.401G 5.315G 5.599G 5.460G 5.388G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 178 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_19 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.550G 5.713G 5.291G 5.405G 5.390G 5.616G 5.417G 5.376G 5.700G 5.259G 5.250G 5.370G 5.444G 5.265G 5.401G 5.350G 5.260G 5.671G 5.539G 5.607G 5.301G 5.413G 5.471G 5.582G 5.406G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.672G 5.500G 5.288G 5.558G 5.685G 5.333G 5.393G 5.351G 5.365G 5.657G 5.501G 5.689G 5.696G 5.399G 5.667G 5.614G 5.709G 5.418G 5.371G 5.407G 5.640G 5.512G 5.622G 5.360G 5.585G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.305G 5.312G 5.664G 5.313G 5.526G 5.419G 5.427G 5.656G 5.624G 5.470G 5.681G 5.535G 5.337G 5.609G 5.473G 5.516G 5.677G 5.297G 5.280G 5.533G 5.610G 5.577G 5.439G 5.440G 5.342G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.508G 5.704G 5.468G 5.308G 5.394G 5.461G 5.650G 5.494G 5.551G 5.666G 5.496G 5.271G 5.621G 5.722G 5.511G 5.409G 5.590G 5.623G 5.422G 5.316G 5.454G 5.557G 5.361G 5.537G 5.462G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 179 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_20 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.664G 5.596G 5.594G 5.403G 5.643G 5.279G 5.543G 5.323G 5.499G 5.452G 5.328G 5.635G 5.325G 5.605G 5.442G 5.421G 5.636G 5.488G 5.343G 5.406G 5.299G 5.361G 5.724G 5.321G 5.649G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.377G 5.490G 5.393G 5.547G 5.585G 5.294G 5.338G 5.541G 5.410G 5.287G 5.644G 5.566G 5.417G 5.495G 5.524G 5.342G 5.711G 5.719G 5.589G 5.712G 5.576G 5.465G 5.557G 5.368G 5.587G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.595G 5.573G 5.581G 5.428G 5.444G 5.477G 5.720G 5.496G 5.530G 5.423G 5.620G 5.645G 5.523G 5.271G 5.637G 5.435G 5.468G 5.699G 5.379G 5.370G 5.619G 5.517G 5.297G 5.683G 5.582G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.701G 5.706G 5.592G 5.314G 5.405G 5.277G 5.613G 5.270G 5.339G 5.375G 5.333G 5.497G 5.562G 5.693G 5.407G 5.590G 5.288G 5.400G 5.408G 5.268G 5.332G 5.485G 5.586G 5.526G 5.681G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 180 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_21 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.265G 5.551G 5.352G 5.511G 5.524G 5.631G 5.488G 5.361G 5.464G 5.700G 5.591G 5.578G 5.431G 5.709G 5.425G 5.666G 5.597G 5.495G 5.473G 5.411G 5.599G 5.706G 5.322G 5.315G 5.614G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.645G 5.661G 5.635G 5.708G 5.634G 5.445G 5.687G 5.256G 5.330G 5.613G 5.399G 5.571G 5.516G 5.692G 5.293G 5.609G 5.430G 5.479G 5.397G 5.702G 5.497G 5.327G 5.566G 5.590G 5.705G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.335G 5.669G 5.451G 5.721G 5.453G 5.279G 5.292G 5.471G 5.555G 5.695G 5.432G 5.478G 5.371G 5.421G 5.285G 5.377G 5.568G 5.304G 5.643G 5.409G 5.393G 5.660G 5.553G 5.385G 5.276G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.680G 5.387G 5.534G 5.644G 5.698G 5.582G 5.673G 5.523G 5.499G 5.672G 5.664G 5.463G 5.652G 5.480G 5.693G 5.338G 5.489G 5.527G 5.626G 5.512G 5.351G 5.437G 5.501G 5.650G 5.469G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 181 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_22 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.609G 5.345G 5.601G 5.306G 5.658G 5.253G 5.460G 5.252G 5.722G 5.367G 5.435G 5.537G 5.322G 5.361G 5.360G 5.549G 5.467G 5.268G 5.621G 5.529G 5.338G 5.618G 5.477G 5.263G 5.550G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.255G 5.385G 5.535G 5.708G 5.379G 5.498G 5.514G 5.457G 5.681G 5.622G 5.427G 5.312G 5.655G 5.304G 5.724G 5.454G 5.450G 5.663G 5.647G 5.483G 5.698G 5.597G 5.403G 5.465G 5.396G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.447G 5.526G 5.657G 5.495G 5.692G 5.380G 5.545G 5.478G 5.329G 5.286G 5.458G 5.671G 5.308G 5.259G 5.594G 5.314G 5.519G 5.709G 5.648G 5.589G 5.433G 5.393G 5.280G 5.305G 5.637G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.276G 5.623G 5.300G 5.422G 5.502G 5.670G 5.319G 5.707G 5.390G 5.472G 5.715G 5.521G 5.484G 5.418G 5.420G 5.569G 5.444G 5.610G 5.557G 5.377G 5.446G 5.554G 5.719G 5.646G 5.716G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 182 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_23 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.401G 5.383G 5.441G 5.608G 5.590G 5.702G 5.642G 5.633G 5.515G 5.366G 5.482G 5.563G 5.314G 5.393G 5.503G 5.285G 5.365G 5.415G 5.613G 5.723G 5.423G 5.301G 5.547G 5.696G 5.519G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.459G 5.630G 5.384G 5.440G 5.280G 5.422G 5.479G 5.620G 5.546G 5.409G 5.313G 5.617G 5.376G 5.698G 5.605G 5.662G 5.653G 5.315G 5.372G 5.330G 5.618G 5.460G 5.286G 5.484G 5.667G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.412G 5.689G 5.432G 5.593G 5.339G 5.648G 5.354G 5.562G 5.585G 5.375G 5.660G 5.694G 5.447G 5.335G 5.712G 5.576G 5.284G 5.347G 5.425G 5.672G 5.526G 5.652G 5.614G 5.721G 5.407G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.639G 5.673G 5.451G 5.398G 5.257G 5.683G 5.718G 5.334G 5.486G 5.392G 5.279G 5.307G 5.697G 5.358G 5.413G 5.429G 5.687G 5.722G 5.504G 5.473G 5.452G 5.592G 5.603G 5.343G 5.489G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 183 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_24 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.338G 5.452G 5.375G 5.469G 5.708G 5.427G 5.598G 5.383G 5.722G 5.266G 5.437G 5.465G 5.250G 5.587G 5.372G 5.422G 5.497G 5.488G 5.583G 5.535G 5.644G 5.592G 5.305G 5.526G 5.258G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.690G 5.451G 5.403G 5.723G 5.474G 5.521G 5.558G 5.642G 5.664G 5.334G 5.544G 5.379G 5.724G 5.391G 5.645G 5.251G 5.253G 5.697G 5.390G 5.298G 5.625G 5.426G 5.564G 5.315G 5.505G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.513G 5.357G 5.400G 5.707G 5.336G 5.593G 5.652G 5.313G 5.561G 5.685G 5.332G 5.579G 5.283G 5.329G 5.455G 5.609G 5.545G 5.503G 5.647G 5.556G 5.490G 5.280G 5.721G 5.698G 5.606G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.614G 5.646G 5.341G 5.314G 5.416G 5.611G 5.581G 5.649G 5.594G 5.701G 5.603G 5.262G 5.291G 5.382G 5.596G 5.559G 5.438G 5.348G 5.377G 5.571G 5.610G 5.591G 5.285G 5.624G 5.516G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 184 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_25 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.337G 5.403G 5.488G 5.575G 5.619G 5.580G 5.355G 5.648G 5.534G 5.459G 5.322G 5.703G 5.435G 5.374G 5.268G 5.393G 5.638G 5.449G 5.594G 5.448G 5.697G 5.422G 5.589G 5.436G 5.320G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.639G 5.551G 5.253G 5.445G 5.261G 5.657G 5.634G 5.546G 5.723G 5.352G 5.467G 5.415G 5.465G 5.430G 5.432G 5.344G 5.597G 5.504G 5.532G 5.537G 5.522G 5.317G 5.627G 5.680G 5.662G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.406G 5.705G 5.519G 5.511G 5.473G 5.446G 5.334G 5.608G 5.256G 5.293G 5.557G 5.296G 5.260G 5.494G 5.392G 5.416G 5.516G 5.572G 5.628G 5.326G 5.678G 5.602G 5.491G 5.478G 5.525G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.583G 5.571G 5.369G 5.419G 5.710G 5.508G 5.460G 5.674G 5.629G 5.517G 5.672G 5.547G 5.282G 5.640G 5.307G 5.285G 5.690G 5.669G 5.673G 5.266G 5.655G 5.264G 5.701G 5.558G 5.434G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 185 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_26 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.518G 5.417G 5.674G 5.654G 5.318G 5.331G 5.551G 5.448G 5.501G 5.253G 5.565G 5.547G 5.521G 5.300G 5.614G 5.600G 5.405G 5.462G 5.344G 5.341G 5.284G 5.556G 5.481G 5.264G 5.538G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.489G 5.447G 5.631G 5.251G 5.373G 5.695G 5.338G 5.254G 5.596G 5.430G 5.504G 5.307G 5.303G 5.641G 5.588G 5.445G 5.429G 5.464G 5.636G 5.532G 5.414G 5.455G 5.363G 5.633G 5.569G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.280G 5.418G 5.668G 5.570G 5.558G 5.395G 5.678G 5.693G 5.406G 5.315G 5.533G 5.385G 5.383G 5.613G 5.365G 5.387G 5.450G 5.443G 5.611G 5.420G 5.724G 5.499G 5.478G 5.589G 5.524G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.598G 5.400G 5.577G 5.649G 5.544G 5.628G 5.375G 5.273G 5.295G 5.650G 5.664G 5.561G 5.525G 5.291G 5.294G 5.468G 5.288G 5.659G 5.432G 5.449G 5.440G 5.474G 5.456G 5.686G 5.578G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 186 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_27 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.368G 5.428G 5.616G 5.360G 5.353G 5.348G 5.615G 5.272G 5.618G 5.715G 5.275G 5.671G 5.462G 5.422G 5.722G 5.547G 5.624G 5.550G 5.562G 5.379G 5.597G 5.576G 5.667G 5.710G 5.441G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.583G 5.366G 5.556G 5.302G 5.358G 5.292G 5.346G 5.282G 5.580G 5.343G 5.270G 5.307G 5.714G 5.317G 5.598G 5.396G 5.584G 5.440G 5.578G 5.409G 5.337G 5.605G 5.398G 5.636G 5.676G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.564G 5.611G 5.539G 5.581G 5.582G 5.287G 5.531G 5.657G 5.525G 5.534G 5.718G 5.332G 5.451G 5.640G 5.607G 5.523G 5.660G 5.683G 5.513G 5.362G 5.711G 5.645G 5.456G 5.315G 5.593G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.520G 5.390G 5.485G 5.614G 5.325G 5.567G 5.263G 5.554G 5.291G 5.312G 5.696G 5.721G 5.679G 5.695G 5.648G 5.659G 5.452G 5.382G 5.393G 5.297G 5.460G 5.591G 5.380G 5.277G 5.394G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 187 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_28 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.336G 5.715G 5.332G 5.676G 5.503G 5.637G 5.586G 5.333G 5.482G 5.412G 5.499G 5.526G 5.260G 5.716G 5.399G 5.455G 5.250G 5.551G 5.467G 5.490G 5.410G 5.357G 5.318G 5.483G 5.558G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.506G 5.452G 5.606G 5.547G 5.344G 5.454G 5.474G 5.540G 5.549G 5.600G 5.424G 5.625G 5.463G 5.388G 5.327G 5.554G 5.295G 5.595G 5.544G 5.656G 5.494G 5.616G 5.510G 5.535G 5.284G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.514G 5.408G 5.608G 5.568G 5.723G 5.589G 5.267G 5.585G 5.473G 5.620G 5.366G 5.632G 5.679G 5.587G 5.607G 5.688G 5.541G 5.459G 5.358G 5.493G 5.346G 5.339G 5.405G 5.672G 5.460G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.286G 5.722G 5.630G 5.436G 5.331G 5.517G 5.686G 5.678G 5.695G 5.272G 5.594G 5.572G 5.444G 5.592G 5.529G 5.534G 5.402G 5.516G 5.393G 5.639G 5.304G 5.316G 5.697G 5.645G 5.519G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 188 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_29 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.666G 5.611G 5.307G 5.319G 5.415G 5.558G 5.679G 5.406G 5.382G 5.273G 5.544G 5.689G 5.540G 5.536G 5.454G 5.673G 5.680G 5.314G 5.435G 5.368G 5.718G 5.404G 5.669G 5.495G 5.377G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.685G 5.291G 5.486G 5.463G 5.721G 5.574G 5.570G 5.617G 5.448G 5.671G 5.271G 5.709G 5.633G 5.277G 5.595G 5.362G 5.304G 5.723G 5.553G 5.646G 5.552G 5.393G 5.596G 5.268G 5.588G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.395G 5.687G 5.389G 5.445G 5.587G 5.675G 5.488G 5.386G 5.479G 5.458G 5.628G 5.691G 5.623G 5.577G 5.660G 5.692G 5.459G 5.423G 5.562G 5.441G 5.430G 5.420G 5.384G 5.606G 5.352G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.370G 5.327G 5.604G 5.357G 5.585G 5.566G 5.640G 5.592G 5.461G 5.432G 5.343G 5.529G 5.667G 5.625G 5.564G 5.252G 5.436G 5.651G 5.602G 5.412G 5.607G 5.672G 5.428G 5.551G 5.477G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 189 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_30 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 5.458G 5.607G 5.298G 5.351G 5.309G 5.573G 5.389G 5.262G 5.529G 5.566G 5.339G 5.690G 5.491G 5.715G 5.277G 5.388G 5.453G 5.358G 5.609G 5.616G 5.588G 5.373G 5.423G 5.392G 5.562G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.613G 5.589G 5.318G 5.347G 5.502G 5.448G 5.509G 5.571G 5.606G 5.459G 5.408G 5.405G 5.424G 5.686G 5.596G 5.669G 5.658G 5.287G 5.676G 5.625G 5.426G 5.674G 5.418G 5.532G 5.326G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.717G 5.417G 5.710G 5.300G 5.578G 5.462G 5.414G 5.558G 5.419G 5.304G 5.281G 5.335G 5.411G 5.267G 5.457G 5.474G 5.500G 5.338G 5.353G 5.257G 5.556G 5.350G 5.260G 5.478G 5.548G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.475G 5.406G 5.667G 5.619G 5.639G 5.721G 5.443G 5.285G 5.352G 5.398G 5.663G 5.577G 5.581G 5.594G 5.554G 5.720G 5.677G 5.394G 5.379G 5.595G 5.680G 5.628G 5.590G 5.582G 5.286G 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 190 / 250 Report Format Version: 6.1.2 802.11ac (VHT40) Hopping Frequency Sequence Name: HOP_FREQ_SEQ_01 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.603G 5.630G 5.399G 5.532G 5.612G 5.520G 5.414G 5.332G 5.397G 5.620G 5.296G 5.526G 5.649G 5.514G 5.311G 5.255G 5.389G 5.496G 5.299G 5.677G 5.671G 5.683G 5.548G 5.669G 5.495G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.405G 5.712G 5.541G 5.366G 5.467G 5.551G 5.598G 5.288G 5.361G 5.652G 5.631G 5.472G 5.656G 5.348G 5.284G 5.395G 5.297G 5.617G 5.319G 5.643G 5.378G 5.453G 5.356G 5.349G 5.578G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.498G 5.653G 5.704G 5.410G 5.312G 5.575G 5.354G 5.310G 5.390G 5.666G 5.411G 5.628G 5.408G 5.523G 5.552G 5.536G 5.679G 5.283G 5.624G 5.558G 5.680G 5.466G 5.486G 5.504G 5.702G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.670G 5.285G 5.323G 5.581G 5.554G 5.448G 5.708G 5.456G 5.380G 5.457G 5.470G 5.375G 5.393G 5.709G 5.427G 5.626G 5.545G 5.508G 5.440G 5.252G 5.547G 5.471G 5.684G 5.641G 5.706G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 191 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_02 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.328G 5.485G 5.647G 5.392G 5.346G 5.640G 5.531G 5.499G 5.431G 5.376G 5.699G 5.680G 5.676G 5.446G 5.432G 5.386G 5.276G 5.636G 5.303G 5.564G 5.677G 5.538G 5.462G 5.355G 5.416G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.655G 5.342G 5.264G 5.284G 5.381G 5.315G 5.459G 5.263G 5.586G 5.654G 5.327G 5.581G 5.353G 5.532G 5.371G 5.535G 5.718G 5.292G 5.569G 5.335G 5.375G 5.509G 5.682G 5.687G 5.286G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.570G 5.365G 5.362G 5.363G 5.598G 5.500G 5.603G 5.329G 5.536G 5.701G 5.450G 5.270G 5.456G 5.665G 5.269G 5.308G 5.719G 5.490G 5.489G 5.340G 5.664G 5.420G 5.565G 5.652G 5.684G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.291G 5.720G 5.403G 5.461G 5.528G 5.539G 5.372G 5.366G 5.266G 5.285G 5.567G 5.633G 5.454G 5.443G 5.559G 5.451G 5.287G 5.700G 5.364G 5.326G 5.427G 5.344G 5.691G 5.352G 5.425G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 192 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_03 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.715G 5.436G 5.322G 5.468G 5.287G 5.689G 5.364G 5.566G 5.629G 5.400G 5.625G 5.457G 5.706G 5.324G 5.542G 5.601G 5.578G 5.698G 5.537G 5.317G 5.654G 5.380G 5.648G 5.684G 5.617G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.431G 5.354G 5.379G 5.449G 5.393G 5.647G 5.445G 5.610G 5.312G 5.611G 5.412G 5.540G 5.724G 5.539G 5.631G 5.714G 5.453G 5.323G 5.352G 5.257G 5.361G 5.594G 5.683G 5.508G 5.278G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.262G 5.555G 5.513G 5.470G 5.560G 5.707G 5.485G 5.359G 5.296G 5.475G 5.573G 5.264G 5.597G 5.455G 5.367G 5.590G 5.416G 5.605G 5.339G 5.717G 5.511G 5.699G 5.671G 5.337G 5.398G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.608G 5.545G 5.254G 5.616G 5.256G 5.413G 5.615G 5.723G 5.341G 5.463G 5.434G 5.496G 5.299G 5.547G 5.363G 5.365G 5.471G 5.635G 5.378G 5.637G 5.510G 5.600G 5.283G 5.342G 5.497G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 193 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_04 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.267G 5.698G 5.621G 5.570G 5.508G 5.501G 5.363G 5.453G 5.398G 5.557G 5.448G 5.597G 5.270G 5.463G 5.711G 5.429G 5.445G 5.351G 5.661G 5.478G 5.555G 5.549G 5.452G 5.632G 5.466G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.612G 5.718G 5.723G 5.683G 5.451G 5.460G 5.470G 5.426G 5.669G 5.517G 5.629G 5.285G 5.381G 5.298G 5.417G 5.654G 5.499G 5.687G 5.589G 5.659G 5.458G 5.690G 5.473G 5.439G 5.541G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.554G 5.288G 5.322G 5.721G 5.416G 5.527G 5.304G 5.441G 5.333G 5.665G 5.380G 5.318G 5.315G 5.607G 5.717G 5.524G 5.280G 5.584G 5.663G 5.389G 5.502G 5.641G 5.542G 5.250G 5.481G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.569G 5.716G 5.511G 5.530G 5.521G 5.699G 5.623G 5.579G 5.468G 5.610G 5.262G 5.266G 5.401G 5.700G 5.360G 5.496G 5.386G 5.356G 5.657G 5.513G 5.420G 5.648G 5.588G 5.348G 5.562G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 194 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_05 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.538G 5.357G 5.711G 5.519G 5.699G 5.373G 5.403G 5.297G 5.421G 5.299G 5.391G 5.523G 5.556G 5.475G 5.349G 5.390G 5.722G 5.587G 5.590G 5.279G 5.438G 5.346G 5.526G 5.295G 5.714G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.423G 5.593G 5.490G 5.541G 5.653G 5.656G 5.522G 5.402G 5.512G 5.686G 5.313G 5.389G 5.578G 5.532G 5.436G 5.585G 5.280G 5.683G 5.432G 5.693G 5.301G 5.463G 5.434G 5.647G 5.649G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.481G 5.615G 5.550G 5.339G 5.350G 5.672G 5.665G 5.588G 5.537G 5.263G 5.480G 5.692G 5.425G 5.255G 5.424G 5.652G 5.554G 5.321G 5.548G 5.671G 5.544G 5.394G 5.467G 5.602G 5.695G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.307G 5.404G 5.416G 5.612G 5.369G 5.688G 5.675G 5.673G 5.715G 5.679G 5.561G 5.569G 5.517G 5.375G 5.271G 5.486G 5.514G 5.547G 5.657G 5.539G 5.670G 5.567G 5.611G 5.318G 5.630G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 195 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_06 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.527G 5.280G 5.566G 5.528G 5.497G 5.342G 5.322G 5.295G 5.652G 5.374G 5.688G 5.602G 5.347G 5.467G 5.506G 5.317G 5.722G 5.305G 5.720G 5.351G 5.454G 5.496G 5.461G 5.267G 5.468G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.604G 5.665G 5.647G 5.359G 5.669G 5.563G 5.436G 5.441G 5.638G 5.309G 5.345G 5.666G 5.470G 5.480G 5.417G 5.621G 5.266G 5.485G 5.509G 5.556G 5.723G 5.681G 5.711G 5.533G 5.389G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.380G 5.273G 5.694G 5.369G 5.508G 5.531G 5.394G 5.622G 5.308G 5.439G 5.514G 5.254G 5.408G 5.337G 5.512G 5.368G 5.363G 5.352G 5.403G 5.259G 5.291G 5.376G 5.381G 5.367G 5.261G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.393G 5.473G 5.645G 5.564G 5.459G 5.605G 5.611G 5.469G 5.375G 5.626G 5.646G 5.271G 5.700G 5.673G 5.348G 5.557G 5.678G 5.668G 5.460G 5.629G 5.356G 5.689G 5.279G 5.361G 5.357G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 196 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_07 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.273G 5.532G 5.283G 5.516G 5.537G 5.657G 5.440G 5.299G 5.503G 5.310G 5.464G 5.631G 5.590G 5.318G 5.457G 5.569G 5.321G 5.558G 5.306G 5.575G 5.710G 5.528G 5.596G 5.266G 5.416G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.275G 5.396G 5.475G 5.382G 5.386G 5.527G 5.332G 5.385G 5.507G 5.383G 5.674G 5.446G 5.365G 5.402G 5.414G 5.407G 5.384G 5.472G 5.401G 5.654G 5.479G 5.276G 5.353G 5.268G 5.699G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.630G 5.342G 5.423G 5.467G 5.678G 5.340G 5.406G 5.314G 5.335G 5.337G 5.560G 5.270G 5.591G 5.703G 5.278G 5.426G 5.381G 5.684G 5.715G 5.352G 5.690G 5.368G 5.681G 5.291G 5.663G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.277G 5.379G 5.571G 5.429G 5.544G 5.470G 5.373G 5.255G 5.476G 5.518G 5.322G 5.708G 5.706G 5.662G 5.308G 5.376G 5.542G 5.553G 5.458G 5.671G 5.297G 5.585G 5.442G 5.615G 5.293G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 197 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_08 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.706G 5.609G 5.292G 5.430G 5.687G 5.621G 5.540G 5.689G 5.448G 5.561G 5.480G 5.704G 5.321G 5.547G 5.296G 5.705G 5.575G 5.542G 5.643G 5.560G 5.670G 5.584G 5.600G 5.263G 5.307G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.662G 5.471G 5.673G 5.563G 5.719G 5.591G 5.623G 5.370G 5.394G 5.418G 5.414G 5.317G 5.681G 5.457G 5.299G 5.581G 5.436G 5.388G 5.257G 5.647G 5.651G 5.612G 5.489G 5.277G 5.658G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.360G 5.569G 5.486G 5.659G 5.616G 5.329G 5.393G 5.451G 5.588G 5.522G 5.491G 5.291G 5.273G 5.404G 5.358G 5.355G 5.284G 5.267G 5.618G 5.362G 5.656G 5.379G 5.657G 5.583G 5.286G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.585G 5.485G 5.626G 5.287G 5.668G 5.558G 5.712G 5.545G 5.633G 5.707G 5.312G 5.319G 5.473G 5.456G 5.684G 5.592G 5.381G 5.254G 5.332G 5.677G 5.425G 5.368G 5.357G 5.555G 5.487G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 198 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_09 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.358G 5.477G 5.466G 5.395G 5.261G 5.394G 5.692G 5.279G 5.418G 5.607G 5.559G 5.322G 5.564G 5.431G 5.339G 5.511G 5.334G 5.706G 5.381G 5.614G 5.467G 5.504G 5.267G 5.486G 5.633G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.423G 5.387G 5.254G 5.702G 5.360G 5.460G 5.449G 5.558G 5.647G 5.359G 5.642G 5.604G 5.414G 5.298G 5.398G 5.390G 5.609G 5.259G 5.693G 5.566G 5.386G 5.399G 5.670G 5.635G 5.514G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.255G 5.724G 5.611G 5.508G 5.696G 5.592G 5.281G 5.348G 5.661G 5.636G 5.713G 5.667G 5.627G 5.439G 5.457G 5.710G 5.665G 5.484G 5.341G 5.422G 5.492G 5.286G 5.646G 5.615G 5.723G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.380G 5.629G 5.379G 5.543G 5.411G 5.528G 5.285G 5.496G 5.517G 5.650G 5.274G 5.674G 5.489G 5.353G 5.497G 5.407G 5.263G 5.479G 5.351G 5.475G 5.705G 5.610G 5.265G 5.608G 5.372G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 199 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_10 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.597G 5.512G 5.628G 5.681G 5.257G 5.297G 5.505G 5.344G 5.404G 5.309G 5.368G 5.298G 5.716G 5.286G 5.595G 5.613G 5.433G 5.487G 5.606G 5.342G 5.599G 5.603G 5.446G 5.616G 5.412G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.266G 5.712G 5.713G 5.520G 5.393G 5.287G 5.549G 5.402G 5.461G 5.638G 5.288G 5.548G 5.500G 5.547G 5.253G 5.542G 5.469G 5.345G 5.722G 5.459G 5.557G 5.473G 5.443G 5.670G 5.596G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.337G 5.553G 5.392G 5.356G 5.458G 5.637G 5.455G 5.534G 5.363G 5.299G 5.624G 5.694G 5.618G 5.328G 5.723G 5.325G 5.539G 5.634G 5.399G 5.689G 5.478G 5.410G 5.623G 5.376G 5.693G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.578G 5.671G 5.346G 5.488G 5.605G 5.710G 5.385G 5.452G 5.322G 5.445G 5.516G 5.685G 5.431G 5.351G 5.350G 5.255G 5.420G 5.483G 5.386G 5.658G 5.477G 5.540G 5.550G 5.341G 5.347G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 200 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_11 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.481G 5.424G 5.455G 5.534G 5.580G 5.610G 5.627G 5.631G 5.405G 5.533G 5.471G 5.562G 5.628G 5.595G 5.665G 5.540G 5.343G 5.646G 5.569G 5.626G 5.473G 5.480G 5.375G 5.418G 5.638G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.267G 5.457G 5.632G 5.651G 5.705G 5.606G 5.674G 5.475G 5.555G 5.575G 5.657G 5.348G 5.643G 5.450G 5.257G 5.571G 5.347G 5.488G 5.377G 5.666G 5.459G 5.525G 5.602G 5.653G 5.714G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.677G 5.486G 5.637G 5.341G 5.505G 5.682G 5.410G 5.514G 5.659G 5.508G 5.392G 5.497G 5.292G 5.461G 5.454G 5.391G 5.565G 5.608G 5.408G 5.412G 5.402G 5.413G 5.640G 5.681G 5.536G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.358G 5.285G 5.679G 5.376G 5.438G 5.578G 5.370G 5.694G 5.420G 5.266G 5.339G 5.278G 5.528G 5.387G 5.301G 5.568G 5.718G 5.710G 5.572G 5.284G 5.416G 5.519G 5.478G 5.421G 5.673G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 201 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_12 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.585G 5.611G 5.657G 5.291G 5.630G 5.386G 5.365G 5.463G 5.323G 5.612G 5.588G 5.315G 5.387G 5.445G 5.271G 5.715G 5.515G 5.625G 5.665G 5.474G 5.410G 5.339G 5.521G 5.601G 5.476G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.257G 5.538G 5.628G 5.341G 5.648G 5.711G 5.337G 5.420G 5.640G 5.329G 5.295G 5.573G 5.311G 5.381G 5.705G 5.507G 5.604G 5.714G 5.475G 5.716G 5.496G 5.565G 5.275G 5.593G 5.498G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.621G 5.556G 5.508G 5.300G 5.697G 5.584G 5.501G 5.668G 5.629G 5.469G 5.418G 5.517G 5.595G 5.318G 5.712G 5.623G 5.267G 5.581G 5.616G 5.423G 5.471G 5.266G 5.652G 5.681G 5.348G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.720G 5.427G 5.367G 5.485G 5.378G 5.350G 5.272G 5.283G 5.502G 5.701G 5.683G 5.592G 5.580G 5.523G 5.669G 5.491G 5.368G 5.407G 5.276G 5.302G 5.413G 5.352G 5.653G 5.656G 5.446G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 202 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_13 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.303G 5.396G 5.573G 5.492G 5.323G 5.460G 5.643G 5.675G 5.495G 5.344G 5.717G 5.478G 5.566G 5.561G 5.256G 5.487G 5.311G 5.375G 5.295G 5.417G 5.629G 5.572G 5.689G 5.671G 5.510G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.525G 5.518G 5.406G 5.341G 5.653G 5.387G 5.678G 5.626G 5.611G 5.305G 5.411G 5.538G 5.340G 5.661G 5.533G 5.394G 5.635G 5.336G 5.577G 5.592G 5.388G 5.701G 5.266G 5.632G 5.612G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.524G 5.534G 5.468G 5.585G 5.652G 5.443G 5.312G 5.515G 5.633G 5.493G 5.569G 5.673G 5.512G 5.624G 5.322G 5.638G 5.298G 5.694G 5.605G 5.437G 5.414G 5.360G 5.707G 5.596G 5.337G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.392G 5.685G 5.389G 5.540G 5.269G 5.424G 5.526G 5.668G 5.408G 5.623G 5.516G 5.255G 5.463G 5.713G 5.503G 5.436G 5.284G 5.456G 5.625G 5.627G 5.264G 5.508G 5.543G 5.407G 5.576G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 203 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_14 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.320G 5.378G 5.367G 5.695G 5.266G 5.499G 5.345G 5.498G 5.393G 5.608G 5.305G 5.541G 5.555G 5.639G 5.678G 5.397G 5.411G 5.694G 5.693G 5.502G 5.691G 5.344G 5.292G 5.423G 5.425G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.569G 5.686G 5.715G 5.421G 5.450G 5.520G 5.560G 5.602G 5.454G 5.424G 5.374G 5.516G 5.540G 5.641G 5.357G 5.318G 5.538G 5.671G 5.643G 5.528G 5.353G 5.440G 5.355G 5.545G 5.612G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.430G 5.418G 5.444G 5.574G 5.462G 5.455G 5.466G 5.274G 5.268G 5.600G 5.588G 5.463G 5.649G 5.655G 5.547G 5.302G 5.568G 5.323G 5.443G 5.341G 5.368G 5.489G 5.534G 5.470G 5.651G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.515G 5.682G 5.405G 5.293G 5.524G 5.270G 5.491G 5.550G 5.590G 5.276G 5.662G 5.677G 5.484G 5.316G 5.269G 5.596G 5.626G 5.267G 5.598G 5.445G 5.575G 5.501G 5.642G 5.409G 5.688G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 204 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_15 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.679G 5.698G 5.653G 5.303G 5.720G 5.638G 5.619G 5.411G 5.604G 5.397G 5.555G 5.392G 5.363G 5.449G 5.558G 5.717G 5.530G 5.270G 5.646G 5.263G 5.605G 5.362G 5.688G 5.320G 5.296G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.438G 5.642G 5.250G 5.277G 5.279G 5.639G 5.575G 5.645G 5.680G 5.322G 5.523G 5.342G 5.345G 5.319G 5.350G 5.317G 5.597G 5.552G 5.461G 5.387G 5.606G 5.325G 5.390G 5.651G 5.410G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.375G 5.366G 5.299G 5.283G 5.455G 5.323G 5.633G 5.712G 5.284G 5.294G 5.591G 5.401G 5.348G 5.671G 5.464G 5.669G 5.329G 5.634G 5.516G 5.306G 5.687G 5.305G 5.477G 5.499G 5.673G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.447G 5.662G 5.427G 5.574G 5.470G 5.643G 5.710G 5.510G 5.357G 5.681G 5.593G 5.255G 5.281G 5.498G 5.405G 5.526G 5.508G 5.355G 5.380G 5.341G 5.637G 5.326G 5.567G 5.721G 5.586G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 205 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_16 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.426G 5.410G 5.569G 5.679G 5.436G 5.456G 5.526G 5.334G 5.275G 5.665G 5.336G 5.278G 5.345G 5.417G 5.441G 5.372G 5.546G 5.317G 5.516G 5.273G 5.457G 5.672G 5.490G 5.276G 5.257G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.604G 5.543G 5.340G 5.628G 5.547G 5.563G 5.264G 5.363G 5.693G 5.446G 5.416G 5.685G 5.343G 5.309G 5.684G 5.315G 5.268G 5.656G 5.544G 5.574G 5.595G 5.271G 5.699G 5.550G 5.406G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.396G 5.666G 5.348G 5.515G 5.555G 5.499G 5.521G 5.470G 5.493G 5.681G 5.447G 5.263G 5.497G 5.509G 5.397G 5.554G 5.299G 5.318G 5.454G 5.535G 5.548G 5.486G 5.381G 5.487G 5.323G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.259G 5.395G 5.690G 5.588G 5.385G 5.573G 5.528G 5.386G 5.427G 5.382G 5.390G 5.342G 5.653G 5.579G 5.341G 5.540G 5.561G 5.703G 5.414G 5.380G 5.466G 5.650G 5.581G 5.402G 5.371G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 206 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_17 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.421G 5.335G 5.419G 5.406G 5.435G 5.480G 5.708G 5.661G 5.251G 5.283G 5.629G 5.573G 5.353G 5.695G 5.649G 5.509G 5.344G 5.645G 5.260G 5.413G 5.643G 5.624G 5.677G 5.277G 5.651G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.452G 5.378G 5.605G 5.397G 5.596G 5.416G 5.449G 5.483G 5.611G 5.339G 5.594G 5.531G 5.617G 5.269G 5.673G 5.650G 5.614G 5.721G 5.620G 5.340G 5.519G 5.556G 5.439G 5.387G 5.599G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.547G 5.572G 5.553G 5.293G 5.683G 5.575G 5.652G 5.588G 5.667G 5.592G 5.518G 5.323G 5.468G 5.515G 5.299G 5.500G 5.538G 5.368G 5.601G 5.451G 5.444G 5.551G 5.548G 5.252G 5.574G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.598G 5.279G 5.461G 5.401G 5.352G 5.543G 5.372G 5.315G 5.264G 5.363G 5.674G 5.405G 5.671G 5.580G 5.644G 5.467G 5.622G 5.627G 5.356G 5.697G 5.578G 5.355G 5.338G 5.311G 5.600G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 207 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_18 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.487G 5.662G 5.368G 5.538G 5.413G 5.455G 5.283G 5.663G 5.370G 5.299G 5.312G 5.319G 5.546G 5.260G 5.625G 5.492G 5.300G 5.571G 5.551G 5.600G 5.712G 5.393G 5.594G 5.278G 5.653G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.444G 5.308G 5.629G 5.356G 5.700G 5.558G 5.709G 5.689G 5.371G 5.465G 5.549G 5.274G 5.513G 5.251G 5.392G 5.668G 5.647G 5.348G 5.327G 5.406G 5.404G 5.470G 5.637G 5.410G 5.400G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.562G 5.379G 5.514G 5.588G 5.381G 5.352G 5.542G 5.288G 5.577G 5.325G 5.451G 5.682G 5.474G 5.722G 5.418G 5.697G 5.599G 5.460G 5.366G 5.622G 5.421G 5.676G 5.425G 5.486G 5.572G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.715G 5.453G 5.329G 5.391G 5.618G 5.582G 5.394G 5.262G 5.702G 5.503G 5.314G 5.388G 5.713G 5.408G 5.389G 5.482G 5.494G 5.716G 5.509G 5.495G 5.464G 5.617G 5.691G 5.632G 5.426G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 208 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_19 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.329G 5.256G 5.291G 5.693G 5.474G 5.327G 5.457G 5.325G 5.521G 5.408G 5.417G 5.253G 5.708G 5.302G 5.349G 5.383G 5.527G 5.386G 5.684G 5.535G 5.514G 5.705G 5.506G 5.421G 5.491G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.351G 5.715G 5.665G 5.462G 5.262G 5.341G 5.576G 5.671G 5.360G 5.334G 5.694G 5.499G 5.372G 5.711G 5.712G 5.467G 5.540G 5.370G 5.519G 5.298G 5.319G 5.594G 5.714G 5.487G 5.269G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.639G 5.672G 5.459G 5.571G 5.596G 5.326G 5.681G 5.543G 5.485G 5.555G 5.623G 5.544G 5.366G 5.590G 5.305G 5.397G 5.651G 5.580G 5.435G 5.699G 5.473G 5.323G 5.411G 5.258G 5.320G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.713G 5.430G 5.427G 5.573G 5.287G 5.701G 5.620G 5.720G 5.509G 5.315G 5.654G 5.293G 5.520G 5.477G 5.281G 5.388G 5.511G 5.517G 5.444G 5.554G 5.348G 5.484G 5.359G 5.312G 5.641G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 209 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_20 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.288G 5.596G 5.633G 5.684G 5.399G 5.621G 5.349G 5.333G 5.265G 5.548G 5.676G 5.679G 5.361G 5.524G 5.697G 5.525G 5.320G 5.593G 5.368G 5.540G 5.692G 5.570G 5.352G 5.322G 5.345G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.291G 5.598G 5.625G 5.272G 5.586G 5.373G 5.530G 5.618G 5.273G 5.651G 5.682G 5.323G 5.337G 5.513G 5.504G 5.377G 5.661G 5.346G 5.281G 5.538G 5.445G 5.439G 5.581G 5.680G 5.550G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.457G 5.306G 5.374G 5.664G 5.261G 5.280G 5.632G 5.391G 5.594G 5.724G 5.506G 5.649G 5.286G 5.257G 5.492G 5.432G 5.250G 5.456G 5.636G 5.502G 5.590G 5.654G 5.295G 5.327G 5.356G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.252G 5.434G 5.477G 5.441G 5.656G 5.376G 5.348G 5.283G 5.440G 5.584G 5.294G 5.497G 5.268G 5.300G 5.607G 5.310G 5.493G 5.307G 5.382G 5.573G 5.370G 5.443G 5.681G 5.561G 5.609G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 210 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_21 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.269G 5.564G 5.563G 5.531G 5.484G 5.672G 5.486G 5.633G 5.357G 5.442G 5.466G 5.471G 5.398G 5.641G 5.302G 5.328G 5.693G 5.485G 5.505G 5.355G 5.259G 5.510G 5.342G 5.369G 5.424G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.285G 5.523G 5.552G 5.695G 5.456G 5.459G 5.422G 5.532G 5.439G 5.668G 5.470G 5.524G 5.529G 5.688G 5.719G 5.397G 5.265G 5.703G 5.314G 5.389G 5.566G 5.370G 5.609G 5.613G 5.578G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.400G 5.255G 5.625G 5.271G 5.352G 5.292G 5.650G 5.720G 5.472G 5.343G 5.585G 5.307G 5.545G 5.657G 5.687G 5.475G 5.608G 5.554G 5.324G 5.649G 5.645G 5.539G 5.384G 5.718G 5.568G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.637G 5.461G 5.421G 5.590G 5.409G 5.359G 5.407G 5.493G 5.628G 5.638G 5.611G 5.441G 5.325G 5.429G 5.494G 5.626G 5.337G 5.294G 5.405G 5.620G 5.701G 5.423G 5.629G 5.381G 5.427G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 211 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_22 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.576G 5.450G 5.647G 5.530G 5.323G 5.300G 5.283G 5.388G 5.484G 5.446G 5.351G 5.563G 5.285G 5.703G 5.335G 5.628G 5.536G 5.310G 5.585G 5.338G 5.516G 5.579G 5.487G 5.430G 5.456G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.614G 5.715G 5.317G 5.439G 5.513G 5.565G 5.524G 5.583G 5.362G 5.491G 5.533G 5.638G 5.696G 5.669G 5.321G 5.412G 5.334G 5.518G 5.548G 5.440G 5.468G 5.393G 5.592G 5.288G 5.508G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.255G 5.545G 5.546G 5.344G 5.480G 5.341G 5.307G 5.663G 5.658G 5.441G 5.349G 5.613G 5.417G 5.662G 5.438G 5.700G 5.626G 5.282G 5.680G 5.266G 5.644G 5.643G 5.590G 5.387G 5.359G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.381G 5.517G 5.375G 5.541G 5.586G 5.472G 5.284G 5.332G 5.295G 5.570G 5.655G 5.646G 5.358G 5.713G 5.355G 5.674G 5.465G 5.551G 5.376G 5.648G 5.414G 5.537G 5.423G 5.636G 5.425G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 212 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_23 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.650G 5.654G 5.701G 5.405G 5.659G 5.530G 5.394G 5.533G 5.620G 5.677G 5.352G 5.626G 5.452G 5.356G 5.603G 5.404G 5.412G 5.499G 5.619G 5.578G 5.413G 5.621G 5.644G 5.678G 5.721G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.457G 5.255G 5.639G 5.576G 5.278G 5.528G 5.690G 5.614G 5.308G 5.304G 5.339G 5.632G 5.470G 5.585G 5.361G 5.298G 5.697G 5.372G 5.468G 5.268G 5.482G 5.572G 5.279G 5.360G 5.261G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.366G 5.381G 5.310G 5.464G 5.251G 5.567G 5.713G 5.623G 5.379G 5.537G 5.284G 5.287G 5.329G 5.593G 5.408G 5.347G 5.674G 5.676G 5.692G 5.428G 5.579G 5.682G 5.253G 5.627G 5.497G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.672G 5.432G 5.598G 5.529G 5.525G 5.486G 5.315G 5.395G 5.281G 5.364G 5.456G 5.592G 5.388G 5.283G 5.717G 5.332G 5.263G 5.609G 5.577G 5.552G 5.662G 5.625G 5.652G 5.270G 5.441G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 213 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_24 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.564G 5.407G 5.628G 5.640G 5.412G 5.361G 5.621G 5.321G 5.278G 5.562G 5.457G 5.458G 5.402G 5.400G 5.449G 5.541G 5.695G 5.646G 5.595G 5.415G 5.277G 5.719G 5.405G 5.724G 5.559G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.702G 5.670G 5.659G 5.367G 5.355G 5.329G 5.720G 5.424G 5.556G 5.553G 5.439G 5.513G 5.447G 5.515G 5.301G 5.333G 5.365G 5.454G 5.688G 5.428G 5.496G 5.298G 5.497G 5.483G 5.311G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.585G 5.522G 5.485G 5.510G 5.430G 5.389G 5.451G 5.508G 5.387G 5.470G 5.711G 5.500G 5.669G 5.625G 5.484G 5.255G 5.701G 5.613G 5.690G 5.548G 5.323G 5.299G 5.563G 5.271G 5.426G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.465G 5.466G 5.704G 5.722G 5.549G 5.587G 5.320G 5.618G 5.374G 5.276G 5.518G 5.376G 5.524G 5.652G 5.529G 5.354G 5.494G 5.721G 5.487G 5.591G 5.302G 5.614G 5.291G 5.297G 5.360G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 214 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_25 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.336G 5.685G 5.471G 5.267G 5.600G 5.566G 5.598G 5.621G 5.681G 5.673G 5.426G 5.515G 5.711G 5.377G 5.297G 5.345G 5.541G 5.421G 5.674G 5.264G 5.493G 5.450G 5.402G 5.720G 5.405G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.277G 5.545G 5.533G 5.495G 5.279G 5.384G 5.588G 5.475G 5.306G 5.291G 5.491G 5.288G 5.550G 5.265G 5.305G 5.703G 5.456G 5.357G 5.449G 5.257G 5.642G 5.311G 5.567G 5.397G 5.467G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.619G 5.356G 5.724G 5.253G 5.333G 5.718G 5.722G 5.366G 5.595G 5.400G 5.281G 5.519G 5.464G 5.452G 5.565G 5.719G 5.282G 5.351G 5.576G 5.439G 5.668G 5.544G 5.442G 5.665G 5.444G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.303G 5.341G 5.716G 5.460G 5.335G 5.616G 5.591G 5.692G 5.594G 5.269G 5.395G 5.334G 5.525G 5.596G 5.579G 5.298G 5.645G 5.431G 5.539G 5.562G 5.477G 5.707G 5.343G 5.582G 5.693G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 215 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_26 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.474G 5.560G 5.389G 5.672G 5.706G 5.532G 5.435G 5.344G 5.611G 5.263G 5.615G 5.420G 5.453G 5.683G 5.625G 5.265G 5.302G 5.338G 5.352G 5.665G 5.487G 5.624G 5.375G 5.499G 5.278G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.271G 5.447G 5.526G 5.388G 5.556G 5.357G 5.329G 5.250G 5.466G 5.539G 5.572G 5.646G 5.320G 5.700G 5.464G 5.719G 5.391G 5.722G 5.692G 5.603G 5.415G 5.502G 5.272G 5.714G 5.513G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.495G 5.713G 5.400G 5.450G 5.621G 5.587G 5.716G 5.649G 5.612G 5.434G 5.574G 5.501G 5.674G 5.607G 5.699G 5.470G 5.541G 5.475G 5.583G 5.423G 5.381G 5.533G 5.622G 5.578G 5.419G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.592G 5.561G 5.715G 5.325G 5.522G 5.258G 5.571G 5.639G 5.274G 5.645G 5.549G 5.402G 5.491G 5.441G 5.490G 5.494G 5.641G 5.295G 5.529G 5.465G 5.354G 5.688G 5.437G 5.576G 5.383G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 216 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_27 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.668G 5.372G 5.696G 5.306G 5.399G 5.263G 5.522G 5.536G 5.669G 5.550G 5.574G 5.608G 5.439G 5.527G 5.664G 5.589G 5.389G 5.402G 5.257G 5.304G 5.441G 5.250G 5.611G 5.297G 5.501G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.412G 5.376G 5.596G 5.691G 5.429G 5.466G 5.661G 5.326G 5.523G 5.277G 5.461G 5.261G 5.562G 5.497G 5.590G 5.607G 5.640G 5.452G 5.287G 5.684G 5.506G 5.503G 5.561G 5.619G 5.508G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.577G 5.363G 5.650G 5.341G 5.392G 5.567G 5.700G 5.709G 5.582G 5.285G 5.425G 5.317G 5.324G 5.686G 5.478G 5.481G 5.720G 5.313G 5.534G 5.374G 5.444G 5.588G 5.406G 5.405G 5.262G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.421G 5.645G 5.587G 5.256G 5.632G 5.265G 5.511G 5.695G 5.580G 5.557G 5.551G 5.260G 5.414G 5.259G 5.404G 5.689G 5.697G 5.717G 5.553G 5.390G 5.329G 5.442G 5.663G 5.677G 5.474G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 217 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_28 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.307G 5.443G 5.654G 5.679G 5.387G 5.683G 5.281G 5.622G 5.456G 5.301G 5.685G 5.574G 5.478G 5.695G 5.722G 5.678G 5.381G 5.547G 5.523G 5.521G 5.619G 5.434G 5.449G 5.604G 5.322G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.649G 5.285G 5.581G 5.486G 5.608G 5.430G 5.257G 5.359G 5.569G 5.488G 5.503G 5.558G 5.549G 5.371G 5.349G 5.401G 5.644G 5.458G 5.391G 5.286G 5.668G 5.356G 5.660G 5.314G 5.347G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.482G 5.390G 5.263G 5.279G 5.487G 5.436G 5.539G 5.251G 5.628G 5.338G 5.411G 5.468G 5.283G 5.304G 5.453G 5.284G 5.422G 5.274G 5.719G 5.435G 5.565G 5.374G 5.544G 5.499G 5.675G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.315G 5.326G 5.687G 5.680G 5.724G 5.320G 5.255G 5.418G 5.643G 5.584G 5.697G 5.355G 5.648G 5.705G 5.591G 5.481G 5.590G 5.446G 5.296G 5.336G 5.343G 5.278G 5.363G 5.531G 5.273G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 218 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_29 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.587G 5.627G 5.449G 5.372G 5.568G 5.251G 5.549G 5.464G 5.555G 5.257G 5.675G 5.277G 5.588G 5.431G 5.322G 5.677G 5.717G 5.650G 5.535G 5.556G 5.612G 5.546G 5.623G 5.720G 5.311G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.271G 5.604G 5.613G 5.263G 5.386G 5.270G 5.451G 5.424G 5.530G 5.595G 5.317G 5.522G 5.517G 5.364G 5.405G 5.492G 5.459G 5.314G 5.715G 5.531G 5.435G 5.407G 5.634G 5.558G 5.607G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.622G 5.309G 5.340G 5.252G 5.639G 5.614G 5.335G 5.291G 5.510G 5.724G 5.695G 5.686G 5.518G 5.542G 5.402G 5.446G 5.357G 5.688G 5.380G 5.616G 5.656G 5.346G 5.325G 5.478G 5.273G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.676G 5.666G 5.579G 5.665G 5.480G 5.698G 5.685G 5.400G 5.278G 5.645G 5.722G 5.597G 5.707G 5.513G 5.560G 5.268G 5.655G 5.528G 5.648G 5.586G 5.659G 5.516G 5.420G 5.644G 5.444G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 219 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_30 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.490G 5.430G 5.521G 5.311G 5.600G 5.291G 5.637G 5.455G 5.413G 5.459G 5.536G 5.663G 5.689G 5.266G 5.355G 5.699G 5.389G 5.571G 5.380G 5.664G 5.435G 5.277G 5.638G 5.585G 5.697G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.296G 5.516G 5.544G 5.677G 5.446G 5.581G 5.588G 5.541G 5.701G 5.714G 5.260G 5.532G 5.326G 5.387G 5.297G 5.551G 5.607G 5.629G 5.643G 5.550G 5.442G 5.582G 5.354G 5.539G 5.619G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.458G 5.414G 5.721G 5.386G 5.549G 5.316G 5.612G 5.385G 5.515G 5.502G 5.614G 5.273G 5.578G 5.299G 5.569G 5.648G 5.450G 5.345G 5.656G 5.554G 5.715G 5.460G 5.265G 5.711G 5.552G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.553G 5.618G 5.438G 5.382G 5.422G 5.359G 5.288G 5.557G 5.254G 5.528G 5.451G 5.482G 5.537G 5.513G 5.262G 5.679G 5.421G 5.623G 5.500G 5.269G 5.284G 5.412G 5.323G 5.390G 5.650G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 220 / 250 Report Format Version: 6.1.2 802.11ac (VHT80) Hopping Frequency Sequence Name: HOP_FREQ_SEQ_01 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.540G 5.501G 5.338G 5.447G 5.688G 5.404G 5.588G 5.278G 5.666G 5.410G 5.327G 5.408G 5.703G 5.662G 5.619G 5.306G 5.592G 5.433G 5.504G 5.687G 5.293G 5.291G 5.367G 5.640G 5.472G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.513G 5.717G 5.534G 5.554G 5.715G 5.374G 5.277G 5.710G 5.551G 5.303G 5.701G 5.584G 5.376G 5.423G 5.281G 5.337G 5.379G 5.271G 5.296G 5.533G 5.300G 5.456G 5.348G 5.559G 5.707G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.526G 5.590G 5.388G 5.593G 5.350G 5.571G 5.407G 5.366G 5.531G 5.267G 5.358G 5.477G 5.683G 5.632G 5.429G 5.596G 5.362G 5.384G 5.712G 5.599G 5.302G 5.505G 5.527G 5.436G 5.607G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.574G 5.373G 5.493G 5.566G 5.713G 5.420G 5.610G 5.301G 5.339G 5.538G 5.581G 5.357G 5.413G 5.668G 5.289G 5.286G 5.351G 5.614G 5.452G 5.561G 5.718G 5.636G 5.558G 5.613G 5.680G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 221 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_02 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.641G 5.429G 5.353G 5.366G 5.367G 5.514G 5.424G 5.528G 5.356G 5.391G 5.292G 5.408G 5.594G 5.706G 5.576G 5.407G 5.687G 5.360G 5.422G 5.669G 5.337G 5.682G 5.372G 5.701G 5.473G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.581G 5.315G 5.255G 5.343G 5.288G 5.630G 5.662G 5.289G 5.585G 5.505G 5.572G 5.612G 5.495G 5.525G 5.270G 5.455G 5.656G 5.349G 5.328G 5.561G 5.518G 5.562G 5.534G 5.384G 5.388G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.679G 5.582G 5.260G 5.478G 5.595G 5.327G 5.482G 5.700G 5.506G 5.511G 5.329G 5.532G 5.499G 5.692G 5.549G 5.448G 5.335G 5.504G 5.311G 5.521G 5.441G 5.466G 5.284G 5.251G 5.280G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.580G 5.604G 5.425G 5.310G 5.719G 5.606G 5.683G 5.541G 5.297G 5.333G 5.553G 5.423G 5.607G 5.390G 5.468G 5.565G 5.649G 5.661G 5.307G 5.342G 5.436G 5.539G 5.537G 5.445G 5.285G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 222 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_03 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.284G 5.670G 5.581G 5.641G 5.428G 5.435G 5.382G 5.554G 5.563G 5.280G 5.498G 5.720G 5.617G 5.350G 5.277G 5.294G 5.501G 5.516G 5.263G 5.717G 5.644G 5.526G 5.411G 5.436G 5.685G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.304G 5.409G 5.467G 5.407G 5.355G 5.640G 5.712G 5.383G 5.326G 5.352G 5.618G 5.495G 5.623G 5.338G 5.367G 5.584G 5.267G 5.650G 5.458G 5.418G 5.396G 5.699G 5.671G 5.424G 5.463G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.456G 5.574G 5.637G 5.281G 5.260G 5.683G 5.391G 5.261G 5.652G 5.588G 5.596G 5.542G 5.723G 5.332G 5.572G 5.529G 5.536G 5.664G 5.528G 5.560G 5.416G 5.443G 5.510G 5.459G 5.288G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.489G 5.448G 5.651G 5.321G 5.276G 5.333G 5.401G 5.315G 5.393G 5.595G 5.307G 5.469G 5.440G 5.602G 5.611G 5.678G 5.301G 5.662G 5.707G 5.604G 5.514G 5.674G 5.257G 5.273G 5.275G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 223 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_04 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.278G 5.685G 5.641G 5.675G 5.346G 5.285G 5.357G 5.520G 5.605G 5.694G 5.252G 5.397G 5.296G 5.356G 5.429G 5.475G 5.484G 5.412G 5.565G 5.578G 5.276G 5.572G 5.688G 5.253G 5.628G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.505G 5.270G 5.680G 5.542G 5.327G 5.434G 5.286G 5.438G 5.451G 5.671G 5.395G 5.716G 5.693G 5.527G 5.592G 5.636G 5.405G 5.607G 5.379G 5.610G 5.495G 5.398G 5.590G 5.617G 5.376G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.563G 5.545G 5.568G 5.406G 5.558G 5.720G 5.362G 5.418G 5.516G 5.518G 5.482G 5.349G 5.414G 5.704G 5.353G 5.508G 5.348G 5.294G 5.279G 5.477G 5.308G 5.387G 5.485G 5.632G 5.282G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.422G 5.321G 5.284G 5.426G 5.423G 5.538G 5.522G 5.448G 5.319G 5.553G 5.419G 5.661G 5.670G 5.566G 5.361G 5.718G 5.650G 5.721G 5.433G 5.571G 5.698G 5.597G 5.497G 5.363G 5.490G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 224 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_05 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.535G 5.264G 5.462G 5.340G 5.560G 5.519G 5.477G 5.682G 5.480G 5.657G 5.473G 5.597G 5.689G 5.515G 5.539G 5.413G 5.648G 5.540G 5.636G 5.711G 5.501G 5.398G 5.558G 5.253G 5.590G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.444G 5.349G 5.632G 5.494G 5.435G 5.401G 5.482G 5.308G 5.593G 5.587G 5.441G 5.517G 5.456G 5.350G 5.582G 5.414G 5.345G 5.289G 5.381G 5.693G 5.486G 5.259G 5.426G 5.662G 5.569G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.468G 5.554G 5.490G 5.323G 5.367G 5.616G 5.669G 5.293G 5.268G 5.712G 5.442G 5.279G 5.529G 5.434G 5.604G 5.285G 5.489G 5.598G 5.347G 5.319G 5.280G 5.570G 5.706G 5.362G 5.531G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.719G 5.387G 5.478G 5.320G 5.544G 5.485G 5.553G 5.496G 5.324G 5.635G 5.649G 5.454G 5.391G 5.505G 5.370G 5.605G 5.671G 5.542G 5.522G 5.431G 5.647G 5.504G 5.291G 5.667G 5.405G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 225 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_06 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.642G 5.526G 5.624G 5.323G 5.720G 5.344G 5.326G 5.370G 5.260G 5.660G 5.712G 5.681G 5.445G 5.490G 5.476G 5.680G 5.682G 5.668G 5.473G 5.360G 5.264G 5.300G 5.579G 5.643G 5.437G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.685G 5.604G 5.389G 5.274G 5.453G 5.349G 5.693G 5.285G 5.275G 5.460G 5.312G 5.631G 5.514G 5.654G 5.716G 5.439G 5.644G 5.677G 5.517G 5.485G 5.711G 5.592G 5.649G 5.575G 5.408G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.613G 5.329G 5.696G 5.293G 5.655G 5.399G 5.674G 5.666G 5.409G 5.324G 5.480G 5.714G 5.354G 5.386G 5.362G 5.541G 5.414G 5.609G 5.482G 5.684G 5.355G 5.303G 5.340G 5.396G 5.561G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.701G 5.551G 5.599G 5.416G 5.608G 5.605G 5.255G 5.578G 5.715G 5.509G 5.375G 5.512G 5.483G 5.291G 5.265G 5.573G 5.422G 5.705G 5.549G 5.317G 5.596G 5.594G 5.667G 5.436G 5.421G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 226 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_07 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.597G 5.587G 5.676G 5.458G 5.596G 5.532G 5.495G 5.656G 5.371G 5.261G 5.683G 5.569G 5.426G 5.520G 5.325G 5.469G 5.538G 5.539G 5.654G 5.320G 5.548G 5.343G 5.599G 5.263G 5.369G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.360G 5.521G 5.338G 5.498G 5.295G 5.650G 5.481G 5.648G 5.441G 5.398G 5.567G 5.256G 5.264G 5.466G 5.383G 5.253G 5.467G 5.313G 5.299G 5.479G 5.671G 5.710G 5.474G 5.604G 5.262G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.666G 5.471G 5.722G 5.620G 5.317G 5.558G 5.485G 5.365G 5.702G 5.392G 5.585G 5.505G 5.640G 5.593G 5.300G 5.285G 5.519G 5.713G 5.446G 5.492G 5.698G 5.443G 5.502G 5.393G 5.711G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.431G 5.553G 5.347G 5.641G 5.605G 5.700G 5.390G 5.708G 5.504G 5.572G 5.623G 5.649G 5.690G 5.568G 5.389G 5.724G 5.686G 5.312G 5.366G 5.340G 5.674G 5.503G 5.437G 5.372G 5.527G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 227 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_08 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.667G 5.527G 5.469G 5.517G 5.292G 5.433G 5.416G 5.386G 5.635G 5.391G 5.529G 5.409G 5.698G 5.657G 5.385G 5.674G 5.251G 5.260G 5.640G 5.677G 5.300G 5.256G 5.443G 5.491G 5.428G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.626G 5.365G 5.694G 5.354G 5.254G 5.604G 5.551G 5.648G 5.605G 5.641G 5.590G 5.336G 5.594G 5.668G 5.278G 5.536G 5.601G 5.288G 5.556G 5.651G 5.683G 5.684G 5.712G 5.364G 5.553G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.314G 5.653G 5.496G 5.481G 5.569G 5.404G 5.603G 5.369G 5.399G 5.518G 5.520G 5.567G 5.564G 5.689G 5.688G 5.544G 5.438G 5.711G 5.664G 5.277G 5.573G 5.533G 5.612G 5.338G 5.595G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.440G 5.652G 5.634G 5.505G 5.649G 5.349G 5.561G 5.252G 5.485G 5.607G 5.514G 5.679G 5.419G 5.306G 5.423G 5.435G 5.280G 5.389G 5.718G 5.420G 5.702G 5.362G 5.606G 5.417G 5.583G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 228 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_09 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.652G 5.653G 5.724G 5.682G 5.605G 5.367G 5.651G 5.498G 5.496G 5.582G 5.568G 5.558G 5.549G 5.379G 5.366G 5.319G 5.356G 5.332G 5.664G 5.286G 5.531G 5.527G 5.709G 5.636G 5.611G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.260G 5.659G 5.711G 5.307G 5.534G 5.672G 5.541G 5.336G 5.707G 5.631G 5.671G 5.595G 5.434G 5.419G 5.516G 5.596G 5.300G 5.626G 5.600G 5.490G 5.634G 5.578G 5.525G 5.521G 5.632G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.508G 5.381G 5.577G 5.258G 5.520G 5.355G 5.274G 5.420G 5.361G 5.289G 5.455G 5.363G 5.602G 5.554G 5.285G 5.394G 5.641G 5.674G 5.523G 5.259G 5.489G 5.322G 5.535G 5.323G 5.282G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.643G 5.683G 5.333G 5.603G 5.491G 5.372G 5.666G 5.701G 5.608G 5.386G 5.279G 5.352G 5.362G 5.686G 5.405G 5.385G 5.280G 5.295G 5.440G 5.593G 5.559G 5.589G 5.537G 5.716G 5.598G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 229 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_10 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.448G 5.676G 5.662G 5.491G 5.625G 5.577G 5.672G 5.612G 5.347G 5.422G 5.364G 5.644G 5.587G 5.568G 5.252G 5.714G 5.597G 5.316G 5.537G 5.276G 5.679G 5.723G 5.594G 5.496G 5.342G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.353G 5.609G 5.516G 5.438G 5.559G 5.254G 5.282G 5.569G 5.607G 5.329G 5.374G 5.277G 5.604G 5.534G 5.466G 5.682G 5.392G 5.274G 5.533G 5.505G 5.259G 5.656G 5.339G 5.503G 5.711G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.542G 5.518G 5.357G 5.408G 5.652G 5.556G 5.639G 5.555G 5.647G 5.501G 5.702G 5.626G 5.677G 5.497G 5.571G 5.552G 5.370G 5.506G 5.546G 5.484G 5.285G 5.673G 5.268G 5.323G 5.410G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.384G 5.454G 5.406G 5.263G 5.280G 5.472G 5.527G 5.630G 5.425G 5.704G 5.554G 5.418G 5.558G 5.401G 5.584G 5.610G 5.456G 5.523G 5.645G 5.684G 5.668G 5.255G 5.502G 5.273G 5.661G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 230 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_11 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.407G 5.358G 5.542G 5.332G 5.578G 5.648G 5.697G 5.279G 5.283G 5.471G 5.669G 5.549G 5.425G 5.514G 5.392G 5.427G 5.411G 5.386G 5.437G 5.370G 5.551G 5.571G 5.402G 5.694G 5.463G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.441G 5.316G 5.393G 5.675G 5.291G 5.476G 5.658G 5.431G 5.378G 5.295G 5.366G 5.633G 5.387G 5.634G 5.516G 5.570G 5.412G 5.655G 5.302G 5.667G 5.525G 5.605G 5.644G 5.662G 5.521G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.498G 5.659G 5.592G 5.608G 5.614G 5.273G 5.349G 5.484G 5.401G 5.470G 5.290G 5.430G 5.511G 5.297G 5.270G 5.289G 5.711G 5.409G 5.617G 5.601G 5.292G 5.395G 5.631G 5.540G 5.486G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.515G 5.695G 5.682G 5.588G 5.282G 5.312G 5.600G 5.372G 5.505G 5.341G 5.475G 5.539G 5.373G 5.461G 5.280G 5.310G 5.568G 5.374G 5.572G 5.447G 5.481G 5.496G 5.432G 5.489G 5.616G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 231 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_12 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.544G 5.508G 5.327G 5.273G 5.686G 5.351G 5.589G 5.333G 5.664G 5.667G 5.711G 5.301G 5.398G 5.541G 5.543G 5.423G 5.413G 5.473G 5.674G 5.614G 5.494G 5.650G 5.637G 5.718G 5.640G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.339G 5.431G 5.379G 5.617G 5.415G 5.688G 5.703G 5.286G 5.582G 5.555G 5.372G 5.585G 5.421G 5.504G 5.556G 5.678G 5.296G 5.722G 5.359G 5.622G 5.326G 5.435G 5.355G 5.676G 5.645G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.529G 5.596G 5.662G 5.651G 5.488G 5.260G 5.632G 5.507G 5.461G 5.367G 5.537G 5.288G 5.291G 5.384G 5.496G 5.624G 5.706G 5.424G 5.325G 5.294G 5.394G 5.659G 5.258G 5.447G 5.276G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.472G 5.270G 5.462G 5.377G 5.380G 5.530G 5.609G 5.693G 5.358G 5.570G 5.267G 5.583G 5.445G 5.299G 5.477G 5.353G 5.685G 5.525G 5.489G 5.573G 5.482G 5.400G 5.449G 5.549G 5.533G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 232 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_13 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.358G 5.439G 5.721G 5.538G 5.307G 5.487G 5.644G 5.692G 5.573G 5.380G 5.342G 5.529G 5.474G 5.429G 5.673G 5.375G 5.390G 5.596G 5.506G 5.524G 5.296G 5.340G 5.261G 5.595G 5.410G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.430G 5.310G 5.494G 5.337G 5.409G 5.282G 5.622G 5.658G 5.576G 5.586G 5.275G 5.724G 5.608G 5.478G 5.297G 5.285G 5.268G 5.605G 5.351G 5.521G 5.347G 5.299G 5.510G 5.457G 5.509G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.615G 5.399G 5.352G 5.438G 5.503G 5.417G 5.383G 5.598G 5.491G 5.527G 5.492G 5.269G 5.553G 5.312G 5.369G 5.558G 5.656G 5.591G 5.281G 5.461G 5.435G 5.680G 5.265G 5.280G 5.379G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.653G 5.722G 5.449G 5.262G 5.419G 5.295G 5.334G 5.372G 5.621G 5.698G 5.630G 5.411G 5.602G 5.318G 5.377G 5.260G 5.370G 5.629G 5.336G 5.367G 5.329G 5.448G 5.555G 5.359G 5.447G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 233 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_14 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.393G 5.528G 5.653G 5.252G 5.268G 5.321G 5.284G 5.400G 5.689G 5.571G 5.607G 5.423G 5.574G 5.407G 5.633G 5.589G 5.715G 5.442G 5.716G 5.657G 5.517G 5.587G 5.272G 5.662G 5.485G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.673G 5.625G 5.342G 5.520G 5.450G 5.371G 5.403G 5.482G 5.290G 5.368G 5.399G 5.369G 5.724G 5.543G 5.700G 5.585G 5.280G 5.558G 5.508G 5.554G 5.269G 5.502G 5.707G 5.387G 5.605G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.362G 5.315G 5.572G 5.685G 5.259G 5.531G 5.599G 5.281G 5.481G 5.440G 5.713G 5.445G 5.639G 5.476G 5.417G 5.435G 5.697G 5.286G 5.634G 5.461G 5.584G 5.431G 5.667G 5.610G 5.526G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.390G 5.383G 5.613G 5.292G 5.674G 5.381G 5.549G 5.454G 5.540G 5.555G 5.301G 5.566G 5.406G 5.660G 5.439G 5.500G 5.366G 5.448G 5.488G 5.721G 5.693G 5.405G 5.418G 5.536G 5.279G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 234 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_15 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.293G 5.308G 5.419G 5.363G 5.446G 5.272G 5.311G 5.671G 5.283G 5.526G 5.343G 5.342G 5.410G 5.512G 5.445G 5.716G 5.282G 5.703G 5.325G 5.403G 5.497G 5.377G 5.251G 5.592G 5.262G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.401G 5.684G 5.660G 5.470G 5.302G 5.335G 5.550G 5.667G 5.719G 5.481G 5.505G 5.259G 5.516G 5.554G 5.634G 5.613G 5.252G 5.586G 5.514G 5.387G 5.454G 5.431G 5.420G 5.579G 5.364G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.260G 5.527G 5.495G 5.517G 5.567G 5.582G 5.378G 5.452G 5.536G 5.657G 5.542G 5.710G 5.489G 5.571G 5.345G 5.541G 5.442G 5.349G 5.456G 5.406G 5.307G 5.382G 5.638G 5.463G 5.388G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.640G 5.417G 5.628G 5.412G 5.712G 5.500G 5.601G 5.271G 5.652G 5.254G 5.483G 5.545G 5.696G 5.433G 5.434G 5.268G 5.488G 5.544G 5.508G 5.653G 5.430G 5.539G 5.676G 5.678G 5.261G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 235 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_16 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.700G 5.669G 5.266G 5.420G 5.389G 5.380G 5.360G 5.417G 5.656G 5.395G 5.278G 5.686G 5.614G 5.259G 5.345G 5.517G 5.489G 5.440G 5.407G 5.671G 5.264G 5.271G 5.514G 5.646G 5.638G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.350G 5.409G 5.526G 5.267G 5.299G 5.418G 5.328G 5.423G 5.296G 5.255G 5.648G 5.569G 5.422G 5.461G 5.307G 5.281G 5.339G 5.634G 5.625G 5.282G 5.536G 5.568G 5.664G 5.315G 5.599G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.410G 5.462G 5.681G 5.516G 5.490G 5.523G 5.397G 5.540G 5.491G 5.556G 5.295G 5.439G 5.336G 5.566G 5.319G 5.581G 5.436G 5.504G 5.601G 5.710G 5.633G 5.559G 5.326G 5.340G 5.670G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.401G 5.338G 5.337G 5.629G 5.398G 5.655G 5.639G 5.342G 5.635G 5.254G 5.576G 5.476G 5.367G 5.702G 5.289G 5.673G 5.352G 5.411G 5.678G 5.324G 5.499G 5.644G 5.294G 5.408G 5.561G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 236 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_17 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.563G 5.374G 5.525G 5.323G 5.291G 5.489G 5.621G 5.420G 5.498G 5.413G 5.266G 5.467G 5.512G 5.667G 5.455G 5.555G 5.320G 5.677G 5.400G 5.480G 5.473G 5.690G 5.411G 5.351G 5.415G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.478G 5.492G 5.252G 5.681G 5.517G 5.654G 5.593G 5.375G 5.376G 5.269G 5.626G 5.518G 5.315G 5.625G 5.286G 5.594G 5.685G 5.585G 5.541G 5.507G 5.412G 5.295G 5.343G 5.285G 5.530G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.723G 5.469G 5.350G 5.388G 5.253G 5.704G 5.435G 5.587G 5.661G 5.701G 5.516G 5.586G 5.639G 5.495G 5.324G 5.662G 5.282G 5.526G 5.488G 5.449G 5.714G 5.619G 5.664G 5.691G 5.692G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.319G 5.292G 5.608G 5.545G 5.383G 5.616G 5.332G 5.610G 5.596G 5.510G 5.483G 5.255G 5.316G 5.560G 5.678G 5.505G 5.335G 5.670G 5.477G 5.385G 5.549G 5.683G 5.637G 5.554G 5.452G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 237 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_18 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.497G 5.351G 5.263G 5.643G 5.515G 5.358G 5.496G 5.607G 5.320G 5.522G 5.378G 5.574G 5.434G 5.281G 5.428G 5.393G 5.504G 5.395G 5.463G 5.507G 5.598G 5.595G 5.275G 5.549G 5.668G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.599G 5.278G 5.572G 5.487G 5.492G 5.293G 5.467G 5.513G 5.418G 5.407G 5.542G 5.449G 5.613G 5.608G 5.661G 5.411G 5.399G 5.553G 5.423G 5.480G 5.376G 5.521G 5.443G 5.693G 5.586G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.670G 5.388G 5.364G 5.486G 5.373G 5.562G 5.679G 5.489G 5.621G 5.303G 5.678G 5.546G 5.650G 5.524G 5.544G 5.471G 5.638G 5.273G 5.307G 5.360G 5.494G 5.305G 5.316G 5.269G 5.719G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.665G 5.600G 5.532G 5.631G 5.442G 5.355G 5.707G 5.485G 5.416G 5.357G 5.452G 5.610G 5.469G 5.529G 5.512G 5.462G 5.298G 5.578G 5.516G 5.721G 5.398G 5.446G 5.437G 5.295G 5.615G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 238 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_19 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.691G 5.688G 5.460G 5.620G 5.477G 5.472G 5.613G 5.525G 5.648G 5.498G 5.411G 5.353G 5.617G 5.666G 5.520G 5.634G 5.334G 5.575G 5.713G 5.492G 5.288G 5.486G 5.421G 5.518G 5.582G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.551G 5.622G 5.446G 5.571G 5.503G 5.542G 5.700G 5.305G 5.684G 5.335G 5.420G 5.266G 5.588G 5.669G 5.306G 5.654G 5.685G 5.641G 5.479G 5.493G 5.296G 5.597G 5.405G 5.590G 5.303G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.579G 5.294G 5.270G 5.384G 5.553G 5.528G 5.434G 5.644G 5.488G 5.441G 5.396G 5.451G 5.374G 5.314G 5.272G 5.619G 5.690G 5.297G 5.663G 5.668G 5.413G 5.286G 5.536G 5.608G 5.449G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.350G 5.547G 5.541G 5.633G 5.629G 5.544G 5.358G 5.516G 5.478G 5.361G 5.515G 5.386G 5.532G 5.431G 5.279G 5.504G 5.646G 5.282G 5.695G 5.327G 5.511G 5.661G 5.719G 5.408G 5.414G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 239 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_20 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.680G 5.475G 5.311G 5.605G 5.370G 5.465G 5.709G 5.623G 5.617G 5.649G 5.599G 5.566G 5.618G 5.564G 5.338G 5.696G 5.317G 5.366G 5.481G 5.655G 5.262G 5.540G 5.381G 5.408G 5.427G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.483G 5.321G 5.524G 5.367G 5.504G 5.282G 5.267G 5.299G 5.322G 5.546G 5.630G 5.537G 5.374G 5.312G 5.372G 5.507G 5.384G 5.705G 5.287G 5.670G 5.676G 5.337G 5.505G 5.690G 5.342G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.416G 5.633G 5.678G 5.691G 5.488G 5.266G 5.445G 5.419G 5.498G 5.446G 5.256G 5.534G 5.455G 5.693G 5.272G 5.695G 5.297G 5.300G 5.698G 5.264G 5.683G 5.326G 5.515G 5.306G 5.356G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.549G 5.278G 5.521G 5.672G 5.433G 5.701G 5.385G 5.707G 5.632G 5.541G 5.568G 5.277G 5.283G 5.436G 5.369G 5.529G 5.494G 5.715G 5.301G 5.420G 5.394G 5.431G 5.275G 5.359G 5.462G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 240 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_21 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.600G 5.718G 5.622G 5.683G 5.570G 5.602G 5.677G 5.483G 5.595G 5.269G 5.712G 5.311G 5.440G 5.411G 5.497G 5.509G 5.559G 5.271G 5.443G 5.370G 5.430G 5.560G 5.607G 5.463G 5.536G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.680G 5.298G 5.505G 5.583G 5.549G 5.544G 5.713G 5.363G 5.384G 5.624G 5.345G 5.656G 5.320G 5.561G 5.423G 5.472G 5.585G 5.313G 5.381G 5.580G 5.596G 5.592G 5.385G 5.437G 5.296G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.444G 5.441G 5.286G 5.428G 5.553G 5.377G 5.629G 5.636G 5.474G 5.665G 5.418G 5.507G 5.540G 5.352G 5.576G 5.641G 5.626G 5.420G 5.647G 5.323G 5.523G 5.314G 5.628G 5.646G 5.312G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.459G 5.605G 5.634G 5.667G 5.353G 5.341G 5.321G 5.504G 5.625G 5.375G 5.457G 5.429G 5.477G 5.317G 5.367G 5.597G 5.336G 5.448G 5.431G 5.548G 5.530G 5.422G 5.421G 5.648G 5.409G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 241 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_22 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.290G 5.411G 5.308G 5.499G 5.638G 5.684G 5.640G 5.324G 5.722G 5.702G 5.498G 5.299G 5.459G 5.335G 5.272G 5.441G 5.580G 5.486G 5.675G 5.586G 5.625G 5.591G 5.510G 5.466G 5.513G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.317G 5.700G 5.568G 5.570G 5.399G 5.616G 5.647G 5.323G 5.345G 5.384G 5.693G 5.482G 5.582G 5.286G 5.365G 5.581G 5.612G 5.608G 5.525G 5.336G 5.356G 5.688G 5.624G 5.475G 5.686G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.630G 5.507G 5.400G 5.528G 5.398G 5.659G 5.357G 5.327G 5.302G 5.305G 5.255G 5.446G 5.288G 5.541G 5.529G 5.386G 5.601G 5.511G 5.567G 5.291G 5.412G 5.374G 5.321G 5.655G 5.352G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.724G 5.263G 5.252G 5.461G 5.254G 5.285G 5.279G 5.626G 5.483G 5.651G 5.564G 5.704G 5.720G 5.457G 5.618G 5.650G 5.557G 5.664G 5.678G 5.387G 5.706G 5.401G 5.339G 5.328G 5.261G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 242 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_23 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.367G 5.388G 5.475G 5.432G 5.442G 5.542G 5.613G 5.286G 5.357G 5.497G 5.482G 5.715G 5.633G 5.550G 5.289G 5.549G 5.539G 5.368G 5.460G 5.290G 5.530G 5.320G 5.663G 5.495G 5.431G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.276G 5.552G 5.441G 5.462G 5.489G 5.594G 5.275G 5.595G 5.690G 5.393G 5.344G 5.602G 5.471G 5.526G 5.582G 5.362G 5.423G 5.684G 5.436G 5.260G 5.682G 5.486G 5.401G 5.319G 5.327G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.659G 5.452G 5.514G 5.545G 5.271G 5.411G 5.426G 5.645G 5.543G 5.435G 5.570G 5.548G 5.605G 5.445G 5.535G 5.527G 5.268G 5.553G 5.448G 5.444G 5.418G 5.404G 5.580G 5.267G 5.252G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.686G 5.285G 5.266G 5.348G 5.277G 5.517G 5.661G 5.688G 5.364G 5.345G 5.593G 5.451G 5.324G 5.651G 5.251G 5.294G 5.400G 5.703G 5.309G 5.588G 5.560G 5.428G 5.484G 5.618G 5.547G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 243 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_24 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.280G 5.340G 5.501G 5.375G 5.477G 5.445G 5.523G 5.650G 5.564G 5.528G 5.341G 5.394G 5.467G 5.611G 5.396G 5.487G 5.666G 5.721G 5.455G 5.469G 5.481G 5.710G 5.692G 5.491G 5.406G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.283G 5.620G 5.456G 5.630G 5.453G 5.407G 5.428G 5.270G 5.673G 5.334G 5.636G 5.271G 5.423G 5.313G 5.688G 5.308G 5.464G 5.605G 5.567G 5.640G 5.329G 5.489G 5.292G 5.626G 5.450G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.409G 5.366G 5.573G 5.291G 5.513G 5.401G 5.655G 5.348G 5.362G 5.365G 5.411G 5.420G 5.427G 5.584G 5.516G 5.296G 5.389G 5.555G 5.585G 5.629G 5.342G 5.343G 5.702G 5.644G 5.569G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.651G 5.353G 5.583G 5.333G 5.510G 5.671G 5.603G 5.367G 5.378G 5.568G 5.549G 5.724G 5.580G 5.553G 5.433G 5.338G 5.421G 5.447G 5.656G 5.424G 5.610G 5.442G 5.601G 5.641G 5.690G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 244 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_25 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.615G 5.327G 5.448G 5.604G 5.312G 5.718G 5.425G 5.313G 5.565G 5.661G 5.452G 5.692G 5.601G 5.501G 5.571G 5.281G 5.701G 5.499G 5.515G 5.719G 5.458G 5.453G 5.469G 5.416G 5.640G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.657G 5.300G 5.690G 5.694G 5.598G 5.475G 5.677G 5.436G 5.371G 5.649G 5.410G 5.270G 5.513G 5.557G 5.264G 5.423G 5.525G 5.582G 5.514G 5.606G 5.447G 5.263G 5.275G 5.444G 5.632G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.676G 5.337G 5.417G 5.516G 5.696G 5.603G 5.320G 5.463G 5.411G 5.391G 5.484G 5.386G 5.602G 5.494G 5.573G 5.358G 5.446G 5.717G 5.461G 5.483G 5.616G 5.542G 5.295G 5.599G 5.472G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.592G 5.680G 5.567G 5.503G 5.383G 5.464G 5.367G 5.699G 5.659G 5.589G 5.302G 5.279G 5.673G 5.254G 5.440G 5.500G 5.369G 5.664G 5.631G 5.449G 5.482G 5.399G 5.291G 5.522G 5.583G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 245 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_26 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.339G 5.660G 5.551G 5.454G 5.465G 5.289G 5.584G 5.326G 5.355G 5.425G 5.394G 5.596G 5.652G 5.376G 5.412G 5.363G 5.499G 5.487G 5.333G 5.619G 5.600G 5.625G 5.569G 5.281G 5.713G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.672G 5.647G 5.542G 5.592G 5.417G 5.286G 5.518G 5.371G 5.609G 5.404G 5.431G 5.575G 5.494G 5.457G 5.396G 5.379G 5.622G 5.587G 5.321G 5.386G 5.500G 5.359G 5.456G 5.314G 5.275G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.594G 5.656G 5.295G 5.582G 5.512G 5.277G 5.505G 5.374G 5.618G 5.711G 5.703G 5.515G 5.358G 5.279G 5.319G 5.544G 5.476G 5.452G 5.528G 5.633G 5.504G 5.485G 5.573G 5.721G 5.686G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.694G 5.705G 5.316G 5.303G 5.710G 5.440G 5.597G 5.639G 5.463G 5.506G 5.489G 5.655G 5.648G 5.707G 5.430G 5.364G 5.536G 5.418G 5.574G 5.467G 5.265G 5.372G 5.581G 5.650G 5.708G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 246 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_27 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.452G 5.602G 5.529G 5.380G 5.522G 5.300G 5.670G 5.260G 5.722G 5.485G 5.564G 5.619G 5.316G 5.687G 5.327G 5.537G 5.551G 5.574G 5.585G 5.469G 5.504G 5.286G 5.684G 5.404G 5.302G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.650G 5.448G 5.515G 5.524G 5.411G 5.691G 5.318G 5.425G 5.712G 5.424G 5.439G 5.552G 5.643G 5.419G 5.293G 5.583G 5.255G 5.588G 5.534G 5.488G 5.671G 5.507G 5.438G 5.711G 5.575G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.373G 5.593G 5.598G 5.371G 5.715G 5.433G 5.319G 5.530G 5.501G 5.638G 5.376G 5.347G 5.269G 5.573G 5.611G 5.444G 5.364G 5.680G 5.365G 5.406G 5.651G 5.414G 5.520G 5.586G 5.490G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.568G 5.367G 5.338G 5.401G 5.590G 5.430G 5.333G 5.708G 5.654G 5.445G 5.442G 5.408G 5.484G 5.473G 5.475G 5.661G 5.349G 5.497G 5.721G 5.348G 5.375G 5.519G 5.265G 5.657G 5.464G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 247 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_28 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.434G 5.369G 5.315G 5.533G 5.707G 5.656G 5.694G 5.499G 5.320G 5.665G 5.620G 5.545G 5.698G 5.420G 5.446G 5.720G 5.398G 5.697G 5.594G 5.718G 5.584G 5.577G 5.483G 5.478G 5.617G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.680G 5.305G 5.475G 5.627G 5.356G 5.563G 5.468G 5.255G 5.653G 5.268G 5.611G 5.716G 5.558G 5.359G 5.354G 5.618G 5.410G 5.253G 5.286G 5.576G 5.462G 5.459G 5.490G 5.292G 5.367G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.335G 5.710G 5.269G 5.702G 5.687G 5.581G 5.456G 5.391G 5.298G 5.623G 5.313G 5.524G 5.278G 5.722G 5.474G 5.582G 5.634G 5.519G 5.599G 5.682G 5.525G 5.714G 5.347G 5.274G 5.472G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.560G 5.275G 5.460G 5.661G 5.328G 5.361G 5.304G 5.647G 5.536G 5.721G 5.570G 5.628G 5.723G 5.492G 5.638G 5.326G 5.344G 5.424G 5.264G 5.432G 5.336G 5.449G 5.277G 5.377G 5.337G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 248 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_29 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.410G 5.304G 5.311G 5.305G 5.302G 5.412G 5.626G 5.328G 5.605G 5.289G 5.673G 5.573G 5.548G 5.629G 5.434G 5.527G 5.542G 5.483G 5.612G 5.596G 5.621G 5.650G 5.721G 5.640G 5.539G 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.585G 5.466G 5.677G 5.601G 5.655G 5.709G 5.487G 5.345G 5.430G 5.694G 5.288G 5.424G 5.696G 5.390G 5.724G 5.428G 5.641G 5.478G 5.476G 5.388G 5.353G 5.469G 5.432G 5.295G 5.325G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.609G 5.262G 5.590G 5.404G 5.668G 5.286G 5.257G 5.651G 5.588G 5.365G 5.458G 5.654G 5.440G 5.334G 5.485G 5.360G 5.423G 5.537G 5.445G 5.544G 5.402G 5.327G 5.646G 5.606G 5.468G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.523G 5.617G 5.283G 5.690G 5.389G 5.631G 5.491G 5.275G 5.705G 5.307G 5.363G 5.354G 5.701G 5.507G 5.444G 5.377G 5.446G 5.293G 5.702G 5.499G 5.603G 5.313G 5.680G 5.604G 5.484G Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 249 / 250 Report Format Version: 6.1.2 Hopping Frequency Sequence Name: HOP_FREQ_SEQ_30 SEQ# Frequency
(Hz) SEQ# Frequency
(Hz) SEQ#
Frequency
(Hz) SEQ#
Frequency
(Hz) 2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 5.628G 5.427G 5.504G 5.647G 5.291G 5.458G 5.397G 5.430G 5.708G 5.474G 5.328G 5.489G 5.723G 5.721G 5.476G 5.266G 5.371G 5.654G 5.526G 5.388G 5.390G 5.404G 5.257G 5.327G 5.637G 3 7 11 15 19 23 27 31 35 39 43 47 51 55 59 63 67 71 75 79 83 87 91 95 99 5.645G 5.333G 5.600G 5.646G 5.362G 5.546G 5.260G 5.391G 5.698G 5.703G 5.277G 5.575G 5.644G 5.261G 5.345G 5.407G 5.571G 5.678G 5.487G 5.446G 5.550G 5.664G 5.392G 5.614G 5.715G 4 8 12 16 20 24 28 32 36 40 44 48 52 56 60 64 68 72 76 80 84 88 92 96 100 5.347G 5.692G 5.551G 5.406G 5.394G 5.563G 5.636G 5.460G 5.544G 5.416G 5.617G 5.268G 5.590G 5.259G 5.459G 5.488G 5.556G 5.354G 5.468G 5.520G 5.482G 5.465G 5.516G 5.594G 5.329G 1 5 9 13 17 21 25 29 33 37 41 45 49 53 57 61 65 69 73 77 81 85 89 93 97 5.631G 5.591G 5.441G 5.271G 5.613G 5.470G 5.318G 5.576G 5.361G 5.258G 5.657G 5.449G 5.294G 5.256G 5.514G 5.462G 5.286G 5.588G 5.472G 5.508G 5.418G 5.337G 5.598G 5.448G 5.633G
--- END ---
Report No.: RF181023C12A-2 Reference No.: 181023C11 Page No. 250 / 250 Report Format Version: 6.1.2
1 2 3 | Declaration for DFS Master Devices | Cover Letter(s) | 420.59 KiB | / December 02 2019 |
Netgear Incorporated 350 East Plumeria Drive, San Jose, CA 95134, USA Tel:408-890-3657/Fax:408-907-8097 Date: 1/3/2019 FCC ID: PY318300422 Declaration for DFS master devices We, Netgear Incorporated hereby declare that the device meets all the other requirements specified in Part 15E Section 15.407. If you should have any question(s) regarding this declaration, please dont hesitate to contact us. Thank you!
---------------------------------------------------------
David Kay / Regulatory Compliance Director Netgear Incorporated TEL: 4088903657 FAX: 4089078097 E-mail: david.kay@netgear.com
1 2 3 | Declaration for DTS UNII | Cover Letter(s) | 83.65 KiB | / December 02 2019 |
NETGEAR, Inc. 350 East Plumeria Drive, San Jose, CA 95134, USA TEL:+1 408 890 3657 FAX:+1 408 907 8097
d^hE//>
7RZKRPLWPD\FRQFHUQ
:HKDYHGHFODUHGEHORZIHDWXUHGIRU)&&HTXLSPHQWDXWKRUL]DWLRQ
Device FCC: PY318300422
'HYLFH)&&3<
')6'HYLFH
0DVWHU
&OLHQWZLWKRXWUDGDUGHWHFWLRQFDSDELOLW\
&OLHQWZLWK5DGDUGHWHFWLRQFDSDELOLW\
1$
$FWLYH3DVVLYH6FDQQLQJDGKRFPRGHDFFHVVSRLQWFDSDELOLW\
)UHTXHQF\%DQG
0+]
0+]
0+]
0+]
0+]
0+]
$FWLYH6FDQQLQJ
WKHGHYLFHFDQWUDQVPLW
DSUREHEHDFRQ
SDVVLYHVFDQQLQJ
ZKHUHWKHGHYLFHLVFDQ
OLVWHQRQO\ZLWKQR
$G+RF0RGHRU
:,),'LUHFW
FDSDELOLW\
<HV
<HV
<HV
<HV
<HV
1R
1R
1R
1R
1R
SUREHV
<HV
<HV
<HV
<HV
<HV
1R
1R
1R
1R
1R
<HV
<HV
<HV
<HV
<HV
1R
1R
1R
1R
1R
$FFHVVSRLQW
FDSDELOLW\
<HV
<HV
<HV
<HV
<HV
1R
1R
1R
1R
1R
&RXQWU\FRGHVHOHFWLRQDELOLW\
,I\HVSOVH[SODLQKRZLWZDVLPSOHPHQWHGSOVDOVRKHOSWRSURYLGHGHWDLORIRSWLRQVIRUHDFKFRXQWU\VHOHFWLRQ
SOVFKHFNEHORZ
0HHWUHTXLUHPHQW
<HV
<HV
1R
1R
$PDVWHUGHYLFHLVGHILQHGDVDGHYLFHRSHUDWLQJLQDPRGHLQZKLFKLWKDVWKHFDSDELOLW\WRWUDQVPLWZLWKRXWUHFHLYLQJDQHQDEOLQJVLJQDO,QWKLVPRGHLWLVDEOHWRVHOHFW
DFKDQQHODQGLQLWLDWHDQHWZRUNE\VHQGLQJHQDEOLQJVLJQDOVWRRWKHUGHYLFHV
$FOLHQWGHYLFHLVGHILQHGDVDGHYLFHRSHUDWLQJLQDPRGHLQZKLFKWKHWUDQVPLVVLRQVRIWKHGHYLFHDUHXQGHUFRQWURORIWKHPDVWHU$GHYLFHLQFOLHQWPRGHLVQRWDEOH
WRLQLWLDWHDQHWZRUN
EDQGVGHYLFHVZLWKPXOWLSOHHTXLSPHQWFODVVHVRUWKRVHWKDWRSHUDWHRQQRQ')6IUHTXHQFLHVRUPRGXODUGHYLFHVZKLFKFRQILJXUHWKHPRGHVRIRSHUDWLRQVWKURXJK
VRIWZDUHWKHDSSOLFDWLRQPXVWSURYLGHVRIWZDUHDQGRSHUDWLRQVGHVFULSWLRQRQKRZWKHVRIWZDUHDQGRUKDUGZDUHLVLPSOHPHQWHGWRHQVXUHWKDWSURSHURSHUDWLRQVPRGHV
FDQQRWEHPRGLILHGE\HQGXVHURUDQLQVWDOOHU
)RUFOLHQWGHYLFHVWKDWKDYHVRIWZDUHFRQILJXUDWLRQFRQWUROWRRSHUDWHLQGLIIHUHQWPRGHVDFWLYHVFDQQLQJLQVRPHDQGSDVVLYHVFDQQLQJLQRWKHUVLQGLIIHUHQW
$SSO\
1R$SSO\,IDSSO\SOVKHOSWRSURYLGHH[SODQDWLRQRQLWZDVLPSOHPHQWDQGKRZVRIWZDUHZDVFRQWUROOHG
3OHDVHKHOSWRSURYLGHMXVWLILFDWLRQKRZGHYLFHZDVUHVWULFWHGWRRSHUDWHLQ0+]LQEHORZ
D,
'DYLG.D\5HJXODWRU\&RPSOLDQFH'LUHFWRU
1HWJHDU,QFRUSRUDWHG
7(/
)$;
(PDLOGDYLGND\#QHWJHDUFRP
1 2 3 | MPE Calculation | RF Exposure Info | 69.57 KiB | / December 02 2019 |
RF Exposure Report Report No.: SA181023C12A FCC ID: PY318300422 Test Model: EX7300v2 Series Model: EX6400v2 Received Date: Oct. 23, 2018 Test Date: Nov. 05 ~ Dec. 26, 2018 Issued Date: Jan. 07, 2019 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan
(R.O.C.) Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth ourfindings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product unless specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies. Report No.: SA181023C12A Reference No.: 181023C11 Page No. 1 / 6 Report Format Version: 6.1.1 Table of Contents Release Control Record .................................................................................................................................. 3 Certificate of Conformity ...................................................................................................................... 4 1 RF Exposure .......................................................................................................................................... 5 2 Limits for Maximum Permissible Exposure (MPE) .............................................................................. 5 2.1 2.2 MPE Calculation Formula ................................................................................................................... 5 2.3 Classification ....................................................................................................................................... 5 Calculation Result of Maximum Conducted Power ........................................................................... 6 3 Report No.: SA181023C12A Reference No.: 181023C11 Page No. 2 / 6 Report Format Version: 6.1.1 Issue No. SA181023C12A Description Original release Release Control Record Date Issued Jan. 07, 2019 Report No.: SA181023C12A Reference No.: 181023C11 Page No. 3 / 6 Report Format Version: 6.1.1 1 Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender, AC1900 WiFi Mesh Extender Brand: NETGEAR Test Model: EX7300v2 Series Model: EX6400v2 Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Nov. 05 ~ Dec. 26, 2018 Standards: FCC Part 2 (Section 2.1091) KDB 447498 D01 General RF Exposure Guidance v06 IEEE C95.1-1992 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Jan. 07, 2019 Approved by :
, Date:
Jan. 07, 2019 Bruce Chen / Project Engineer Report No.: SA181023C12A Reference No.: 181023C11 Page No. 4 / 6 Report Format Version: 6.1.1 2 RF Exposure 2.1 Limits for Maximum Permissible Exposure (MPE) Frequency Range
(MHz) Electric Field Strength (V/m) Magnetic Field Strength (A/m)
(mW/cm2) Limits For General Population / Uncontrolled Exposure Power Density Average Time
(minutes) 300-1500 1500-100,000 F/1500 1.0 30 30 F = Frequency in MHz 2.2 MPE Calculation Formula Pd = (Pout*G) / (4*pi*r2) where Pd = power density in mW/cm2 Pout = output power to antenna in mW G = gain of antenna in linear scale Pi = 3.1416 R = distance between observation point and center of the radiator in cm 2.3 Classification The antenna of this product, under normal use condition, is at least 21cm away from the body of the user. So, this device is classified as Mobile Device. Report No.: SA181023C12A Reference No.: 181023C11 Page No. 5 / 6 Report Format Version: 6.1.1 3 Calculation Result of Maximum Conducted Power Frequency Band Antenna Gain Max Power
(MHz)
(dBm)
(dBi) Distance
(cm) Power Density
(mW/cm2) Limit
(mW/cm2) 2412-2462 5180-5240 5260-5320 5500-5720 5745-5825 5180-5240 5180-5240 5260-5320 5745-5825 26.19 29.32 23.64 23.34 29.35 29.05 23.64 23.34 29.29 Model: EX7300v2 CDD Mode 7.60 5.49 5.48 5.11 5.14 21 21 21 21 21 Beamforming Mode 5.49 5.48 5.11 21 21 21 5.14 21 Model: EX6400v2 CDD Mode:
0.432 0.546 0.147 0.126 0.507 0.513 0.147 0.126 0.500 2412-2462 24.88 6.07 21 0.225 1 1 1 1 1 1 1 1 1 1 Note:
Model: EX7300v2 2412 ~ 2462MHz: 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/4]= 7.60dBi 5180 ~ 5240MHz: Directional gain = 5.49dBi 5260 ~ 5320MHz: Directional gain = 5.48dBi 5500 ~ 5700MHz: Directional gain = 5.11dBi 5745 ~ 5825MHz: Directional gain = 5.14dBi Model: EX6400v2 2412 ~ 2462MHz: 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/3]= 6.07dBi Conclusion:
Both of the WLAN 2.4G & WLAN 5G can transmit simultaneously, the formula of calculated the MPE is:
CPD1 / LPD1 + CPD2 / LPD2 + etc. < 1 CPD = Calculation power density LPD = Limit of power density 2.4G + 5G = 0.432 / 1 + 0.546 / 1 = 0.978 Therefore the maximum calculations of above situations are less than the 1 limit.
---END---
Report No.: SA181023C12A Reference No.: 181023C11 Page No. 6 / 6 Report Format Version: 6.1.1
1 2 3 | NII Test Report | Test Report | 699.50 KiB | / December 02 2019 |
FCC Test Report Report No.: RF181023C12A FCC ID: PY318300422 Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Received Date: Oct. 23, 2018 Test Date: Nov. 05 ~ Dec. 26, 2018 Issued Date: Jan. 07, 2019 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan
(R.O.C.) Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth our findings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product unless specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 1 / 84 Report Format Version:6.1.2 Table of Contents 4 3 Release Control Record .................................................................................................................................. 4 1 Certificate of Conformity ...................................................................................................................... 5 Summary of Test Results ..................................................................................................................... 6 2 2.1 Measurement Uncertainty ................................................................................................................... 6 2.2 Modification Record ............................................................................................................................ 6 General Information .............................................................................................................................. 7 3.1 General Description of EUT ................................................................................................................ 7 3.2 Description of Test Modes ................................................................................................................... 9 3.2.1 Test Mode Applicability and Tested Channel Detail ........................................................................... 10 3.3 Duty Cycle of Test Signal .................................................................................................................. 12 3.4 Description of Support Units ............................................................................................................. 13 3.4.1 Configuration of System under Test .................................................................................................. 13 3.5 General Description of Applied Standards ........................................................................................ 13 Test Types and Results ...................................................................................................................... 14 4.1 Radiated Emission and Bandedge Measurement ............................................................................. 14 4.1.1 Limits of Radiated Emission and Bandedge Measurement .............................................................. 14 4.1.2 Test Instruments ................................................................................................................................ 15 4.1.3 Test Procedures ................................................................................................................................. 16 4.1.4 Deviation from Test Standard ............................................................................................................ 16 4.1.5 Test Setup .......................................................................................................................................... 17 4.1.6 EUT Operating Conditions ................................................................................................................. 18 4.1.7 Test Results ....................................................................................................................................... 19 4.2 Conducted Emission Measurement .................................................................................................. 45 4.2.1 Limits of Conducted Emission Measurement .................................................................................... 45 4.2.2 Test Instruments ................................................................................................................................ 45 4.2.3 Test Procedures ................................................................................................................................. 46 4.2.4 Deviation from Test Standard ............................................................................................................ 46 4.2.5 Test Setup .......................................................................................................................................... 46 4.2.6 EUT Operating Conditions ................................................................................................................. 46 4.2.7 Test Results ....................................................................................................................................... 47 4.3 Transmit Power Measurement .......................................................................................................... 49 4.3.1 Limits of Transmit Power Measurement ............................................................................................ 49 4.3.2 Test Setup .......................................................................................................................................... 49 4.3.3 Test Instruments ................................................................................................................................ 49 4.3.4 Test Procedure .................................................................................................................................. 50 4.3.5 Deviation from Test Standard ............................................................................................................ 50 4.3.6 EUT Operating Conditions ................................................................................................................. 50 4.3.7 Test Result ......................................................................................................................................... 51 4.4 Occupied Bandwidth Measurement .................................................................................................. 68 4.4.1 Test Setup .......................................................................................................................................... 68 4.4.2 Test Instruments ................................................................................................................................ 68 4.4.3 Test Procedure .................................................................................................................................. 68 4.4.4 Test Result ......................................................................................................................................... 69 4.5 Peak Power Spectral Density Measurement .................................................................................... 71 4.5.1 Limits of Peak Power Spectral Density Measurement ...................................................................... 71 4.5.2 Test Setup .......................................................................................................................................... 71 4.5.3 Test Instruments ................................................................................................................................ 71 4.5.4 Test Procedures ................................................................................................................................. 71 4.5.5 Deviation from Test Standard ............................................................................................................ 72 4.5.6 EUT Operating Conditions ................................................................................................................. 72 4.5.7 Test Results ....................................................................................................................................... 73 4.6 Frequency Stability ............................................................................................................................ 78 4.6.1 Limits of Frequency Stability Measurement ...................................................................................... 78 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 2 / 84 Report Format Version:6.1.2 4.6.2 Test Setup .......................................................................................................................................... 78 4.6.3 Test Instruments ................................................................................................................................ 78 4.6.4 Test Procedure .................................................................................................................................. 78 4.6.5 Deviation from Test Standard ............................................................................................................ 79 4.6.6 EUT Operating Condition .................................................................................................................. 79 4.6.7 Test Results ....................................................................................................................................... 79 4.7 6dB Bandwidth Measurement ........................................................................................................... 80 4.7.1 Limits of 6dB Bandwidth Measurement ............................................................................................. 80 4.7.2 Test Setup .......................................................................................................................................... 80 4.7.3 Test Instruments ................................................................................................................................ 80 4.7.4 Test Procedure .................................................................................................................................. 80 4.7.5 Deviation from Test Standard ............................................................................................................ 80 4.7.6 EUT Operating Condition .................................................................................................................. 80 4.7.7 Test Results ....................................................................................................................................... 81 5 Pictures of Test Arrangements .......................................................................................................... 83 Appendix Information on the Testing Laboratories ................................................................................ 84 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 3 / 84 Report Format Version:6.1.2 Release Control Record Issue No. RF181023C12A Description Original release Date Issued Jan. 07, 2019 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 4 / 84 Report Format Version:6.1.2 1 Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender (refer to item 3.1 for more details) Brand: NETGEAR Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Nov. 05 ~ Dec. 26, 2018 Standards: 47 CFR FCC Part 15, Subpart E (Section 15.407) ANSI C63.10:2013 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Jan. 07, 2019 Approved by :
, Date:
Jan. 07, 2019 Bruce Chen / Project Engineer Report No.: RF181023C12A Reference No.: 181023C11 Page No. 5 / 84 Report Format Version:6.1.2 2 Summary of Test Results FCC Clause 47 CFR FCC Part 15, Subpart E (Section 15.407) Test Item Result Remarks 15.407(b)(6) AC Power Conducted Emissions Pass 15.407(b)
(1/2/3/4(i/ii)/6) Radiated Emissions & Band Edge Measurement 15.407(a)(1/2/3) Max Average Transmit Power Pass Pass Meet the requirement of limit. Minimum passing margin is -11.43dB at 0.15000MHz. Meet the requirement of limit. Minimum passing margin is -0.1dB at 5364.00MHz & 5470.00MHz. Meet the requirement of limit.
---
Occupied Bandwidth Measurement 15.407(a)(1/2/3) Peak Power Spectral Density 15.407(e) 6dB bandwidth 15.407(g) Frequency Stability 15.203 Antenna Requirement
-
Reference only. Pass Pass Pass Pass Meet the requirement of limit. Meet the requirement of limit.
(U-NII-3 Band only) Meet the requirement of limit. No antenna connector is used. 2.1 Measurement Uncertainty Where relevant, the following measurement uncertainty levels have been estimated for tests performed on the EUT as specified in CISPR 16-4-2:
Expanded Uncertainty Measurement Conducted Emissions at mains ports Radiated Emissions up to 1 GHz Radiated Emissions above 1 GHz Frequency 150kHz ~ 30MHz 30MHz ~ 200MHz 200MHz ~1000MHz 1GHz ~ 18GHz 18GHz ~ 40GHz 2.2 Modification Record There were no modifications required for compliance.
(k=2) () 2.94 dB 3.63 dB 3.64 dB 2.29 dB 2.29 dB Report No.: RF181023C12A Reference No.: 181023C11 Page No. 6 / 84 Report Format Version:6.1.2 3 General Information 3.1 General Description of EUT Product Brand Test Model Series Model Model Difference Sample Status Power Supply Rating Modulation Type Modulation Technology Transfer Rate Operating Frequency Number of Channel Conducted Output Power Nighthawk X4 AC2200 WiFi Mesh Extender (refer to note for more details) NETGEAR EX7300v2 EX6400v2 Refer to Note Engineering sample 100-240Vac 256QAM, 64QAM, 16QAM, QPSK, BPSK OFDM 802.11a: 54/48/36/24/18/12/9/6Mbps 802.11n: up to 600Mbps 802.11ac: 1733.3Mbps 5260 ~ 5320MHz, 5500 ~ 5720MHz 5260 ~ 5320MHz:
802.11a, 802.11n (HT20), 802.11ac (VHT20): 4 802.11n (HT40), 802.11ac (VHT40): 2 802.11ac (VHT80): 1 5500 ~ 5720MHz:
802.11a, 802.11n (HT20), 802.11ac (VHT20): 12 802.11n (HT40), 802.11ac (VHT40): 6 802.11ac (VHT80): 3 CDD Mode:
5260 ~ 5320MHz: 231.217mW 5500 ~ 5720MHz: 215.895mW Beamforming Mode:
5260 ~ 5320MHz: 231.217mW 5500 ~ 5720MHz: 215.895mW Refer to note Refer to note NA NA Antenna Type Antenna Connector Accessory Device Cable Supplied Note:
1. This report is prepared for FCC class II permissive change. The differences compared with the original report (BV CPS report no.: RF181023C12-1) are adding 5.26GHz to 5.32GHz and 5.50GHz to 5.72GHz by software. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 7 / 84 Report Format Version:6.1.2 2. All models are listed as below. Product Name Brand Model Difference NETGEAR Nighthawk X4 AC2200 WiFi Mesh Extender EX7300v2 AC1900 WiFi Mesh Extender EX6400v2 The listed models are electrically and mechanically identical. The intention of these models is only for RF output transmit antenna (EX7300v2 2.4G: 4T4R;
EX6400v2 2.4G: 3T3R) and different NETGEAR logo
(EX7300v2 has silver coating. EX6400v2 has no silver coating) purpose.
* For above two model are presented in power output test item. For other test items, model EX7300v2 is the worst case for final tests after pretesting. 3. The EUT incorporates a MIMO function. Physically, the EUT provides 4 completed transmitters and 4 receivers. Modulation Mode 802.11a 802.11n (HT20) 802.11n (HT40) 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) TX Function 4TX 4TX 4TX 4TX 4TX 4TX Beamforming Not Support Support Support Support Support Support
* The modulation and bandwidth are similar for 802.11n mode for HT20/HT40 and 802.11ac mode for VHT20/VHT40, therefore investigated worst case to representative mode in test report. (Final test mode refer section 3.2.1)
* CDD mode is the worst case for final tests except output power test after pretesting CDD mode and beamforming mode. 4. The EUT uses following antennas. Model: EX6400v2 & EX7300v2 Ant. Type Connecter Type Frequency 5150~5250MHz 5250~5350MHz 5470~5725MHz 5725~5850MHz PIFA NA Directional Gain (dBi) 5.49 5.48 5.11 5.14 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 8 / 84 Report Format Version:6.1.2 3.2 Description of Test Modes For 5260 ~ 5320MHz:
4 channels are provided for 802.11a, 802.11n (HT20):
Channel 52 56 Frequency 5260 MHz 5280 MHz 2 channels are provided for 802.11n (HT40):
Channel 54 Frequency 5270 MHz 1 channel is provided for 802.11ac (VHT80):
Channel 58 Frequency 5290MHz Channel 60 64 Channel 62 For 5500 ~ 5720MHz:
12 channels are provided for 802.11a, 802.11n (HT20), 802.11ac (VHT20):
Channel 100 104 108 112 116 120 Frequency 5500 MHz 5520 MHz 5540 MHz 5560 MHz 5580 MHz 5600 MHz Channel 124 128 132 136 140 144 6 channels are provided for 802.11n (HT40), 802.11ac (VHT40):
Channel 102 110 118 Frequency 5510 MHz 5550 MHz 5590 MHz 3 channels are provided for 802.11ac (VHT80):
Frequency 5530 MHz 5690 MHz 106 138 Channel Channel 126 134 142 Channel 122 Frequency 5300 MHz 5320 MHz Frequency 5310 MHz Frequency 5620 MHz 5640 MHz 5660 MHz 5680 MHz 5700 MHz 5720 MHz Frequency 5630 MHz 5670 MHz 5710 MHz Frequency 5610 MHz Report No.: RF181023C12A Reference No.: 181023C11 Page No. 9 / 84 Report Format Version:6.1.2 3.2.1 Test Mode Applicability and Tested Channel Detail EUT Configure Mode
-
Where RE1G RE<1G Applicable to PLC RE1G: Radiated Emission above 1GHz & Bandedge Measurement PLC: Power Line Conducted Emission APCM Description
-
RE<1G: Radiated Emission below 1GHz Note: The EUT had been pre-tested on the positioned of each 3 axis. The worst case was found when positioned on Z-plane. APCM: Antenna Port Conducted Measurement Radiated Emission Test (Above 1GHz):
Mode
-
-
Mode
-
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Mode Frequency Band (MHz) 802.11a 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) 802.11a 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) 5260-5320 5500-5720 Available Channel 52 to 64 52 to 64 54 to 62 58 100 to 144 100 to 144 102 to 142 106 to 138 Tested Channel Modulation Technology Data Rate
(Mbps) 52, 60, 64 52, 60, 64 54, 62 58 100, 116, 140, 144 100, 116, 140, 144 102, 110, 134, 142 106, 122, 138 OFDM OFDM OFDM OFDM OFDM OFDM OFDM OFDM 6.0 6.5 13.5 29.3 6.0 6.5 13.5 29.3 Radiated Emission Test (Below 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Tested Channel Mode 802.11a 802.11a Frequency Band (MHz) 5260-5320 5500-5720 Available Channel 52 to 64 100 to 144 Modulation Technology OFDM OFDM Data Rate
(Mbps) 6.0 6.0 Power Line Conducted Emission Test:
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Tested Channel Mode
-
Mode 802.11a 802.11a Frequency Band (MHz) 5260-5320 5500-5720 Available Channel 52 to 64 100 to 144 Modulation Technology OFDM OFDM Data Rate
(Mbps) 6.0 6.0 52 52 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 10 / 84 Report Format Version:6.1.2 Antenna Port Conducted Measurement:
mode. Mode
-
-
This item includes all test value of each mode, but only includes spectrum plot of worst value of each Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Mode Frequency Band (MHz) 802.11a 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) 802.11a 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) 5260-5320 5500-5720 Available Channel 52 to 64 52 to 64 54 to 62 58 100 to 144 100 to 144 102 to 142 106 to 138 Tested Channel Modulation Technology Data Rate
(Mbps) 52, 60, 64 52, 60, 64 54, 62 58 100, 116, 140, 144 100, 116, 140, 144 102, 110, 134, 142 106, 122, 138 OFDM OFDM OFDM OFDM OFDM OFDM OFDM OFDM 6.0 6.5 13.5 29.3 6.0 6.5 13.5 29.3 Test Condition:
Applicable to Environmental Conditions Input Power RE1G RE<1G PLC APCM 25deg. C, 70%RH 25deg. C, 71%RH 25deg. C, 71%RH 25deg. C, 60%RH 120Vac, 60Hz 120Vac, 60Hz 120Vac, 60Hz 120Vac, 60Hz Tested by Noah Chang Luis Lee Noah Chang Noah Chang Alan Wu Report No.: RF181023C12A Reference No.: 181023C11 Page No. 11 / 84 Report Format Version:6.1.2 3.3 Duty Cycle of Test Signal Duty cycle of test signal is < 98%, duty factor is required. 802.11a: Duty cycle = 2.059/2.142 = 0.961, Duty factor = 10 * log (1/0.961) = 0.17 802.11ac (VHT20): Duty cycle = 4.990/5.080 = 0.982 802.11ac (VHT40): Duty cycle = 2.420/2.515 = 0.962, Duty factor = 10 * log (1/0.962) = 0.17 802.11ac (VHT80): Duty cycle = 1.144/1.209 = 0.946, Duty factor = 10 * log (1/0.946) = 0.24 802.11ac (VHT20) 802.11a 802.11ac (VHT40) 802.11ac (VHT80) Report No.: RF181023C12A Reference No.: 181023C11 Page No. 12 / 84 Report Format Version:6.1.2 3.4 Description of Support Units The EUT has been tested as an independent unit together with other necessary accessories or support units. The following support units or accessories were used to form a representative test configuration during the tests. ID A. Serial No. 1HC2XM1 FCC DoC Approved -
Product Notebook Brand DELL Model No. Remarks FCC ID E5410 Note:
1. All power cords of the above support units are non-shielded (1.8m). 2. Item A acted as a communication partner to transfer data. ID Descriptions Qty. Length (m) Shielding
(Yes/No) Cores (Qty.) Remarks 1. RJ45, Cat5e 1 6 N 0
-
(1) EUT 3.4.1 Configuration of System under Test 3.5 General Description of Applied Standards The EUT is a RF Product. According to the specifications of the manufacturer, it must comply with the requirements of the following standards:
FCC Part 15, Subpart E (15.407) KDB 789033 D02 General UNII Test Procedure New Rules v02r01 KDB 662911 D01 Multiple Transmitter Output v02r01 ANSI C63.10:2013 All test items have been performed and recorded as per the above standards. Notebook (A) Remote site Report No.: RF181023C12A Reference No.: 181023C11 Page No. 13 / 84 Report Format Version:6.1.2 Test Types and Results 4 4.1 Radiated Emission and Bandedge Measurement 4.1.1 Limits of Radiated Emission and Bandedge Measurement Radiated emissions which fall in the restricted bands must comply with the radiated emission limits specified as below table. Frequencies (MHz) Field Strength (microvolts/meter) Measurement Distance (meters) 0.009 ~ 0.490 0.490 ~ 1.705 1.705 ~ 30.0 30 ~ 88 88 ~ 216 216 ~ 960 Above 960 2400/F(kHz) 24000/F(kHz) 30 100 150 200 500 300 30 30 3 3 3 3 Note:
1. 2. 3. The lower limit shall apply at the transition frequencies. Emission level (dBuV/m) = 20 log Emission level (uV/m). For frequencies above 1000MHz, the field strength limits are based on average detector, however, the peak field strength of any emission shall not exceed the maximum permitted average limits, specified above by more than 20dB under any condition of modulation. Limits of unwanted emission out of the restricted bands Applicable To 789033 D02 General UNII Test Procedure New Rules v02r01 Limit Field Strength at 3m PK: 74 (dBV/m) AV: 54 (dBV/m) Frequency Band Applicable To EIRP Limit Equivalent Field Strength at 3m 5150~5250 MHz 5250~5350 MHz 5470~5725 MHz 15.407(b)(1) 15.407(b)(2) 15.407(b)(3) PK: -27 (dBm/MHz) PK: 68.2(dBV/m) 5725~5850 MHz 15.407(b)(4)(i) PK: -27 (dBm/MHz) *1 PK: 10 (dBm/MHz) *2 PK: 15.6 (dBm/MHz) *3 PK: 27 (dBm/MHz) *4 PK: 68.2(dBV/m) *1 PK: 105.2 (dBV/m) *2 PK: 110.8(dBV/m) *3 PK: 122.2 (dBV/m) *4 15.407(b)(4)(ii) Emission limits in section 15.247(d)
*1 beyond 75 MHz or more above of the band edge.
*3 below the band edge increasing linearly to a level of 15.6 dBm/MHz at 5 MHz above.
*2 below the band edge increasing linearly to 10 dBm/MHz at 25 MHz above.
*4 from 5 MHz above or below the band edge increasing linearly to a level of 27 dBm/MHz at the band edge. Note: The following formula is used to convert the equipment isotropic radiated power (eirp) to field strength:
V/m, where P is the eirp (Watts). 1000000 3 E =
30 P Report No.: RF181023C12A Reference No.: 181023C11 Page No. 14 / 84 Report Format Version:6.1.2 4.1.2 Test Instruments Description & Manufacturer Test Receiver ROHDE & SCHWARZ Spectrum Analyzer ROHDE & SCHWARZ BILOG Antenna SCHWARZBECK HORN Antenna SCHWARZBECK HORN Antenna SCHWARZBECK Loop Antenna TESEQ Preamplifier Agilent
(Below 1GHz) Preamplifier KEYSIGHT
(Above 1GHz) RF signal cable HUBER+SUHNER RF signal cable HUBER+SUHNER Software BV ADT Antenna Tower inn-co GmbH Antenna Tower Controller BV ADT Turn Table BV ADT Turn Table Controller BV ADT Boresight Antenna Fixture Pre-amplifier (18GHz-40GHz) EMC Serial No. 100187 100040 9168-155 Model No. ESIB7 FSP40 VULB9168 BBHA 9120D 9120D-1170 BBHA 9170 BBHA9170241 HLA 6121 45745 Cal. Date Cal. Due May 29, 2018 May 28, 2019 Sep. 25, 2018 Sep. 24, 2019 Dec. 11, 2017 Dec. 10, 2018 Nov. 21, 2018 Nov. 20, 2019 Mar. 25, 2018 Mar. 24, 2019 Dec. 01, 2017 Nov. 30, 2018 Nov. 25, 2018 Nov. 24, 2019 Jun. 14, 2018 Jun. 13, 2019 8447D 2944A10631 Aug. 08, 2018 Aug. 07, 2019 83017A MY53270295 Jul. 02, 2018 Jul. 01, 2019 SUCOFLEX 104 MY 13380+295012/04 Aug. 08, 2018 Aug. 07, 2019 SUCOFLEX 104 Cable-CH4-03 (250724) Aug. 08, 2018 Aug. 07, 2019 ADT_Radiated_ NA NA NA V7.6.15.9.5 MA 4000 AT100 TT100 SC100 FBA-01 010303 AT93021703 TT93021703 SC93021703 FBA-SIP01 NA NA NA NA NA NA NA NA NA NA EMC184045B 980175 Nov. 14, 2017 Nov. 13, 2018 Nov. 14, 2018 Nov. 13, 2019 USB Wideband Power Sensor KEYSIGHT Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are traceable Jul. 17, 2018 Jul. 16, 2019 U2021XA 005 MY55050005/MY5519000 4/MY55190007/MY55210 to NML/ROC and NIST/USA. 2. The test was performed in HwaYa Chamber 4. 3. The FCC Designation Number is TW0003. The number will be varied with the Lab location and scope as attached. 4. The IC Site Registration No. is 7450F-4. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 15 / 84 Report Format Version:6.1.2 4.1.3 Test Procedures For Radiated emission below 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters above the ground at a 3 meter chamber room. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. Parallel, perpendicular, and ground-parallel orientations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to Quasi-Peak Detect Function and Specified Bandwidth with Maximum Hold Mode. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 9kHz at frequency below 30MHz. For Radiated emission above 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters (for 30MHz ~ 1GHz) / 1.5 meters (for above 1GHz) above the ground at 3 meter chamber room for test. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. The height of antenna is varied from one meter to four meters above the ground to determine the maximum value of the field strength. Both horizontal and vertical polarizations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and then the antenna was tuned to heights from 1 meter to 4 meters and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to quasi-peak detect function and specified bandwidth with maximum f. hold mode when the test frequency is below 1 GHz. The test-receiver system was set to peak and average detect function and specified bandwidth with maximum hold mode when the test frequency is above 1 GHz. If the peak reading value also meets average limit, measurement with the average detector is unnecessary. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 120kHz for Quasi-peak detection (QP) at frequency below 1GHz. 2. The resolution bandwidth of test receiver/spectrum analyzer is 1 MHz and the video bandwidth is 3 MHz for Peak detection (PK) at frequency above 1GHz. 3. The resolution bandwidth of test receiver/spectrum analyzer is 1MHz and the video bandwidth is 1/T
(Duty cycle < 98%) or 10Hz (Duty cycle 98%) for Average detection (AV) at frequency above 1GHz. 4. All modes of operation were investigated and the worst-case emissions are reported. 4.1.4 Deviation from Test Standard No deviation. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 16 / 84 Report Format Version:6.1.2 4.1.5 Test Setup For Radiated emission below 30MHz 1 m EUT&
Support Units 80cm 3m Turn Table Ground Plane Test Receiver For Radiated emission 30MHz to 1GHz EUT&
Support Units 80cm 3m 10m Turn Table Ant. Tower 1-4m Variable Ground Plane Test Receiver Report No.: RF181023C12A Reference No.: 181023C11 Page No. 17 / 84 Report Format Version:6.1.2 For Radiated emission above 1GHz EUT&
Support Units 3m Ant. Tower 1-4m Variable Turn Table Absorber 150cm Ground Plane Test Receiver For the actual test configuration, please refer to the attached file (Test Setup Photo). 4.1.6 EUT Operating Conditions a. Placed the EUT on the testing table. b. Prepared a notebook to act as a communication partner and placed it outside of testing area. c. The communication partner connected with EUT via a RJ45 cable and ran a test program (provided by manufacturer) to enable EUT under transmission condition continuously at specific channel frequency. d. The communication partner sent data to EUT by command "PING". Report No.: RF181023C12A Reference No.: 181023C11 Page No. 18 / 84 Report Format Version:6.1.2 4.1.7 Test Results Above 1GHz data:
CHANNEL TX Channel 52 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. 1 2 3 4 5 FREQ.
(MHz) 5150.00 5150.00
*5260.00
*5260.00 11520.00 NO. FREQ.
(MHz) 1 2 3 4 5 5150.00 5150.00
*5260.00
*5260.00
#10520.00 Remarks:
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 59.4 PK 47.6 46.3 AV 34.5 115.1 PK 74.6 104.4 AV 63.9 63.0 PK 39.7 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.18 H 1.18 H 1.18 H 1.18 H 2.63 H 235 235 235 235 201
-14.6
-7.7 74.0 54.0 68.2
-5.2
(m) ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 60.3 PK 47.1 AV 118.9 PK 108.3 AV 62.3 PK LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2
(dB)
-13.7
-6.9
-5.9
(m) 2.12 V 2.12 V 2.12 V 2.12 V 1.82 V 167 167 167 167 246 RAW VALUE
(dBuV) 48.5 35.3 78.4 67.8 40.0 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.5 40.5 23.3 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.5 40.5 22.3 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 19 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 60 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 114.2 PK 73.8 103.6 AV 63.2 61.1 PK 38.8 48.4 AV 26.1 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.20 H 1.20 H 2.33 H 2.33 H TABLE ANGLE
(Degree) 231 231 195 195
-12.9
-5.6 74.0 54.0
(m) LEVEL
(dBuV/m) 117.4 PK 107.2 AV 62.0 PK 48.8 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-12.0
-5.2 ANTENNA HEIGHT
(m) 2.11 V 2.11 V 1.83 V 1.83 V TABLE ANGLE
(Degree) 169 169 214 214 RAW VALUE
(dBuV) 77.0 66.8 39.7 26.5 CORRECTION FACTOR
(dB/m) 40.4 40.4 22.3 22.3 CORRECTION FACTOR
(dB/m) 40.4 40.4 22.3 22.3 NO. FREQ.
(MHz) 1 2 3 4
*5300.00
*5300.00 10600.00 10600.00 NO. FREQ.
(MHz) 1 2 3 4
*5300.00
*5300.00 10600.00 10600.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 20 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 64 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 109.5 PK 68.9 98.5 AV 57.9 62.1 PK 50.2 50.7 AV 38.8 61.6 PK 39.1 49.3 AV 26.8 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.21 H 1.21 H 1.21 H 1.21 H 2.97 H 2.97 H 233 233 233 233 188 188
-11.9
-3.3
-12.4
-4.7 74.0 54.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 112.5 PK 101.9 AV 65.2 PK 53.6 AV 62.7 PK 49.3 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0 74.0 54.0
-8.8
-0.4
-11.3
-4.7
(m) 2.33 V 2.33 V 2.33 V 2.33 V 1.73 V 1.73 V RAW VALUE
(dBuV) 71.9 61.3 53.3 41.7 40.2 26.8 174 174 174 174 239 239 CORRECTION FACTOR
(dB/m) 40.6 40.6 11.9 11.9 22.5 22.5 CORRECTION FACTOR
(dB/m) 40.6 40.6 11.9 11.9 22.5 22.5 NO. FREQ.
(MHz) 1 2 3 4 5 6
*5320.00
*5320.00 5350.00 5350.00 10640.00 10640.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
*5320.00
*5320.00 5350.00 5350.00 10640.00 10640.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 21 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 100 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 64.0 PK 51.5 52.4 AV 39.9 65.3 PK 52.8 115.2 PK 73.7 104.6 AV 63.1 61.9 PK 39.2 49.2 AV 26.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.15 H 1.15 H 1.15 H 1.15 H 1.15 H 2.76 H 2.76 H 229 229 229 229 229 182 182
-10.0
-1.6
-2.9
-12.1
-4.8 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 64.3 PK 53.2 AV 65.7 PK 117.4 PK 106.7 AV 62.5 PK 49.4 AV
(dBuV/m) 74.0 54.0 68.2 74.0 54.0
(dB)
-9.7
-0.8
-2.5
-11.5
-4.6 TABLE ANGLE
(Degree) 167 167 167 167 167 258 258 RAW VALUE
(dBuV) 51.8 40.7 53.2 75.9 65.2 39.8 26.7
(m) 2.06 V 2.06 V 2.06 V 2.06 V 2.06 V 1.96 V 1.96 V CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.5 41.5 22.7 22.7 CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.5 41.5 22.7 22.7 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5460.00 5460.00
#5470.00
*5500.00
*5500.00 11000.00 11000.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5460.00 5460.00
#5470.00
*5500.00
*5500.00 11000.00 11000.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 22 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 116 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 115.2 PK 73.4 104.6 AV 62.8 61.6 PK 38.9 49.1 AV 26.4 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.19 H 1.19 H 2.33 H 2.33 H TABLE ANGLE
(Degree) 234 234 164 164
-12.4
-4.9 74.0 54.0
(m) LEVEL
(dBuV/m) 117.4 PK 106.8 AV 62.2 PK 49.0 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-11.8
-5.0 ANTENNA HEIGHT
(m) 2.11 V 2.11 V 2.61 V 2.61 V TABLE ANGLE
(Degree) 178 178 174 174 RAW VALUE
(dBuV) 75.6 65.0 39.5 26.3 CORRECTION FACTOR
(dB/m) 41.8 41.8 22.7 22.7 CORRECTION FACTOR
(dB/m) 41.8 41.8 22.7 22.7 NO. 1 2 3 4 NO. 1 2 3 4 FREQ.
(MHz)
*5580.00
*5580.00 11160.00 11160.00 FREQ.
(MHz)
*5580.00
*5580.00 11160.00 11160.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 23 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 140 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 115.6 PK 73.5 105.1 AV 63.0 65.7 PK 52.9 62.6 PK 38.8 50.3 AV 26.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.22 H 1.22 H 1.15 H 3.19 H 3.19 H 231 231 229 254 254
-2.5
-11.4
-3.7 68.2 74.0 54.0
(m) ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 118.0 PK 107.4 AV 67.1 PK 63.6 PK 51.1 AV LIMIT MARGIN
(dBuV/m)
(dB) 68.2 74.0 54.0
-1.1
-10.4
-2.9
(m) 2.00 V 2.00 V 2.00 V 2.98 V 2.98 V 174 174 174 156 156 RAW VALUE
(dBuV) 75.9 65.3 54.3 39.8 27.3 CORRECTION FACTOR
(dB/m) 42.1 42.1 12.8 23.8 23.8 CORRECTION FACTOR
(dB/m) 42.1 42.1 12.8 23.8 23.8 NO. FREQ.
(MHz) 1 2 3 4 5
*5700.00
*5700.00
#5725.00 11400.00 11400.00 NO. FREQ.
(MHz) 1 2 3 4 5
*5700.00
*5700.00
#5725.00 11400.00 11400.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 24 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 144 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) 68.2 LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 60.6 PK 48.1 114.4 PK 72.3 103.7 AV 61.6 62.3 PK 48.5 64.7 PK 41.1 51.1 AV 27.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.05 H 1.05 H 1.05 H 1.05 H 2.18 H 2.18 H 87 87 87 87 305 305 68.2 74.0 54.0
-5.9
-9.3
-2.9
-7.6 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 61.0 PK 116.8 PK 105.9 AV 62.7 PK 64.9 PK 51.5 AV
(dBuV/m) 68.2 68.2 74.0 54.0
(dB)
-7.2
-5.5
-9.1
-2.5 TABLE ANGLE
(Degree) 164 164 164 164 214 214 RAW VALUE
(dBuV) 48.5 74.7 63.8 48.9 41.3 27.9
(m) 1.84 V 1.84 V 1.84 V 1.84 V 1.58 V 1.58 V CORRECTION FACTOR
(dB/m) 12.5 42.1 42.1 13.8 23.6 23.6 CORRECTION FACTOR
(dB/m) 12.5 42.1 42.1 13.8 23.6 23.6 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5720.00
*5720.00
#5850.00 11440.00 11440.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5720.00
*5720.00
#5850.00 11440.00 11440.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 25 / 84 Report Format Version:6.1.2 802.11ac (VHT20) CHANNEL TX Channel 52 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. FREQ.
(MHz) 1 2 3 4 5 5150.00 5150.00
*5260.00
*5260.00
#10520.00 NO. FREQ.
(MHz) 1 2 3 4 5 5150.00 5150.00
*5260.00
*5260.00
#10520.00 Remarks:
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 60.1 PK 48.3 46.0 AV 34.2 114.8 PK 74.3 103.3 AV 62.8 61.1 PK 38.8 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.11 H 1.11 H 1.11 H 1.11 H 1.63 H 234 234 234 234 264
-13.9
-8.0 74.0 54.0 68.2
-7.1
(m) ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 60.3 PK 46.7 AV 116.7 PK 105.3 AV 62.1 PK LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2
(dB)
-13.7
-7.3
-6.1
(m) 2.40 V 2.40 V 2.40 V 2.40 V 1.69 V 182 182 182 182 255 RAW VALUE
(dBuV) 48.5 34.9 76.2 64.8 39.8 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.5 40.5 22.3 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.5 40.5 22.3 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 26 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 60 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 113.9 PK 73.5 103.6 AV 63.2 61.2 PK 38.9 48.7 AV 26.4 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.24 H 1.24 H 2.88 H 2.88 H TABLE ANGLE
(Degree) 239 239 189 189
-12.8
-5.3 74.0 54.0
(m) LEVEL
(dBuV/m) 116.8 PK 106.1 AV 62.0 PK 49.1 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-12.0
-4.9 ANTENNA HEIGHT
(m) 2.46 V 2.46 V 1.71 V 1.71 V TABLE ANGLE
(Degree) 183 183 263 263 RAW VALUE
(dBuV) 76.4 65.7 39.7 26.8 CORRECTION FACTOR
(dB/m) 40.4 40.4 22.3 22.3 CORRECTION FACTOR
(dB/m) 40.4 40.4 22.3 22.3 NO. FREQ.
(MHz) 1 2 3 4
*5300.00
*5300.00 10600.00 10600.00 NO. FREQ.
(MHz) 1 2 3 4
*5300.00
*5300.00 10600.00 10600.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 27 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 64 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 109.9 PK 69.3 98.2 AV 57.6 63.0 PK 51.0 51.1 AV 39.1 61.4 PK 38.9 48.8 AV 26.3 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.11 H 1.11 H 1.11 H 1.11 H 2.41 H 2.41 H 234 234 234 234 136 136
-11.0
-2.9
-12.6
-5.2 74.0 54.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 111.9 PK 101.4 AV 65.3 PK 53.7 AV 62.1 PK 49.4 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0 74.0 54.0
-8.7
-0.3
-11.9
-4.6
(m) 2.63 V 2.63 V 2.63 V 2.63 V 1.94 V 1.94 V RAW VALUE
(dBuV) 71.3 60.8 53.3 41.7 39.6 26.9 187 187 187 187 220 220 CORRECTION FACTOR
(dB/m) 40.6 40.6 12.0 12.0 22.5 22.5 CORRECTION FACTOR
(dB/m) 40.6 40.6 12.0 12.0 22.5 22.5 NO. FREQ.
(MHz) 1 2 3 4 5 6
*5320.00
*5320.00 5362.00 5362.00 10640.00 10640.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
*5320.00
*5320.00 5362.00 5362.00 10640.00 10640.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 28 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 100 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 62.8 PK 50.3 50.9 AV 38.4 62.7 PK 50.2 113.8 PK 72.3 103.4 AV 61.9 61.6 PK 38.9 49.0 AV 26.3 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.26 H 1.26 H 1.29 H 1.29 H 1.29 H 2.46 H 2.46 H 85 85 85 85 85 181 181
-11.2
-3.1
-5.5
-12.4
-5.0 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 65.1 PK 52.6 AV 65.9 PK 116.7 PK 105.4 AV 61.9 PK 49.5 AV
(dBuV/m) 74.0 54.0 68.2 74.0 54.0
(dB)
-8.9
-1.4
-2.3
-12.1
-4.5 TABLE ANGLE
(Degree) 166 166 166 166 166 241 241 RAW VALUE
(dBuV) 52.6 40.1 53.4 75.2 63.9 39.2 26.8
(m) 2.00 V 2.00 V 2.00 V 2.00 V 2.00 V 1.63 V 1.63 V CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.5 41.5 22.7 22.7 CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.5 41.5 22.7 22.7 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5460.00 5460.00
#5470.00
*5500.00
*5500.00 11000.00 11000.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5460.00 5460.00
#5470.00
*5500.00
*5500.00 11000.00 11000.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 29 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 116 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 114.9 PK 73.1 103.8 AV 62.0 61.3 PK 38.6 48.8 AV 26.1 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.32 H 1.32 H 2.70 H 2.70 H TABLE ANGLE
(Degree) 96 96 163 163
-12.7
-5.2 74.0 54.0
(m) LEVEL
(dBuV/m) 117.1 PK 105.8 AV 61.6 PK 49.6 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-12.4
-4.4 ANTENNA HEIGHT
(m) 2.37 V 2.37 V 1.73 V 1.73 V TABLE ANGLE
(Degree) 174 174 205 205 RAW VALUE
(dBuV) 75.3 64.0 38.9 26.9 CORRECTION FACTOR
(dB/m) 41.8 41.8 22.7 22.7 CORRECTION FACTOR
(dB/m) 41.8 41.8 22.7 22.7 NO. 1 2 3 4 NO. 1 2 3 4 FREQ.
(MHz)
*5580.00
*5580.00 11160.00 11160.00 FREQ.
(MHz)
*5580.00
*5580.00 11160.00 11160.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 30 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 140 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 114.6 PK 72.5 103.5 AV 61.4 65.7 PK 52.9 62.4 PK 38.6 50.3 AV 26.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.24 H 1.24 H 1.24 H 2.94 H 2.94 H 87 87 87 166 166
-2.5
-11.6
-3.7 68.2 74.0 54.0
(m) ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 116.9 PK 105.8 AV 67.5 PK 63.3 PK 50.7 AV LIMIT MARGIN
(dBuV/m)
(dB) 68.2 74.0 54.0
-0.7
-10.7
-3.3
(m) 2.20 V 2.20 V 2.20 V 1.89 V 1.89 V 161 161 161 254 254 RAW VALUE
(dBuV) 74.8 63.7 54.7 39.5 26.9 CORRECTION FACTOR
(dB/m) 42.1 42.1 12.8 23.8 23.8 CORRECTION FACTOR
(dB/m) 42.1 42.1 12.8 23.8 23.8 NO. FREQ.
(MHz) 1 2 3 4 5
*5700.00
*5700.00
#5725.00 11400.00 11400.00 NO. FREQ.
(MHz) 1 2 3 4 5
*5700.00
*5700.00
#5725.00 11400.00 11400.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 31 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 144 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) 68.2 LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 60.5 PK 48.0 114.5 PK 72.4 103.6 AV 61.5 62.0 PK 48.2 64.8 PK 41.2 50.5 AV 26.9 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.01 H 1.01 H 1.01 H 1.01 H 2.85 H 2.85 H 93 93 93 93 163 163 68.2 74.0 54.0
-6.2
-9.2
-3.5
-7.7 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 60.9 PK 116.9 PK 105.5 AV 62.5 PK 65.2 PK 51.4 AV
(dBuV/m) 68.2 68.2 74.0 54.0
(dB)
-7.3
-5.7
-8.8
-2.6 TABLE ANGLE
(Degree) 178 178 178 178 245 245 RAW VALUE
(dBuV) 48.4 74.8 63.4 48.7 41.6 27.8
(m) 2.00 V 2.00 V 2.00 V 2.00 V 1.95 V 1.95 V CORRECTION FACTOR
(dB/m) 12.5 42.1 42.1 13.8 23.6 23.6 CORRECTION FACTOR
(dB/m) 12.5 42.1 42.1 13.8 23.6 23.6 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5720.00
*5720.00
#5850.00 11440.00 11440.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5720.00
*5720.00
#5850.00 11440.00 11440.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 32 / 84 Report Format Version:6.1.2 802.11ac (VHT40) CHANNEL TX Channel 54 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. FREQ.
(MHz) 1 2 3 4 5 5150.00 5150.00
*5270.00
*5270.00
#10540.00 NO. FREQ.
(MHz) 1 2 3 4 5 5150.00 5150.00
*5270.00
*5270.00
#10540.00 Remarks:
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 59.4 PK 47.6 46.5 AV 34.7 110.3 PK 69.9 100.5 AV 60.1 61.4 PK 39.2 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.03 H 1.03 H 1.03 H 1.03 H 2.94 H 235 235 235 235 173
-14.6
-7.5 74.0 54.0 68.2
-6.8
(m) ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 60.2 PK 47.1 AV 113.1 PK 103.8 AV 62.1 PK LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2
(dB)
-13.8
-6.9
-6.1
(m) 2.58 V 2.58 V 2.58 V 2.58 V 1.88 V 183 183 183 183 239 RAW VALUE
(dBuV) 48.4 35.3 72.7 63.4 39.9 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.4 40.4 22.2 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.4 40.4 22.2 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 33 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 62 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 109.5 PK 69.0 99.7 AV 59.2 67.4 PK 55.5 51.8 AV 39.9 61.2 PK 38.9 48.6 AV 26.3 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.01 H 1.01 H 1.01 H 1.01 H 2.95 H 2.95 H 237 237 237 237 145 145
-6.6
-2.2
-12.8
-5.4 74.0 54.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 112.3 PK 103.0 AV 69.0 PK 53.5 AV 62.0 PK 48.8 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0 74.0 54.0
-5.0
-0.5
-12.0
-5.2
(m) 2.35 V 2.35 V 2.35 V 2.35 V 1.52 V 1.52 V RAW VALUE
(dBuV) 71.8 62.5 57.1 41.6 39.7 26.5 201 201 201 201 270 270 CORRECTION FACTOR
(dB/m) 40.5 40.5 11.9 11.9 22.3 22.3 CORRECTION FACTOR
(dB/m) 40.5 40.5 11.9 11.9 22.3 22.3 NO. FREQ.
(MHz) 1 2 3 4 5 6
*5310.00
*5310.00 5350.00 5350.00 10620.00 10620.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
*5310.00
*5310.00 5354.00 5354.00 10620.00 10620.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 34 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 102 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 61.7 PK 49.2 47.8 AV 35.3 65.1 PK 52.6 111.5 PK 69.9 100.9 AV 59.3 61.8 PK 39.1 49.5 AV 26.8 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.33 H 1.33 H 1.33 H 1.33 H 1.33 H 2.61 H 2.61 H 86 86 86 86 86 144 144
-12.3
-6.2
-3.1
-12.2
-4.5 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 61.9 PK 48.1 AV 66.2 PK 113.0 PK 103.5 AV 61.6 PK 49.4 AV
(dBuV/m) 74.0 54.0 68.2 74.0 54.0
(dB)
-12.1
-5.9
-2.0
-12.4
-4.6 TABLE ANGLE
(Degree) 180 180 180 180 180 224 224 RAW VALUE
(dBuV) 49.4 35.6 53.7 71.4 61.9 38.9 26.7
(m) 2.35 V 2.35 V 2.35 V 2.35 V 2.35 V 1.69 V 1.69 V CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.6 41.6 22.7 22.7 CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.6 41.6 22.7 22.7 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5460.00 5460.00
#5470.00
*5510.00
*5510.00 11020.00 11020.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5460.00 5460.00
#5470.00
*5510.00
*5510.00 11020.00 11020.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 35 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 110 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 111.0 PK 69.3 100.8 AV 59.1 62.0 PK 39.1 49.3 AV 26.4 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.42 H 1.42 H 2.66 H 2.66 H TABLE ANGLE
(Degree) 91 91 189 189
-12.0
-4.7 74.0 54.0
(m) LEVEL
(dBuV/m) 113.5 PK 103.7 AV 61.8 PK 49.4 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-12.2
-4.6 ANTENNA HEIGHT
(m) 2.36 V 2.36 V 1.68 V 1.68 V TABLE ANGLE
(Degree) 177 177 259 259 RAW VALUE
(dBuV) 71.8 62.0 38.9 26.5 CORRECTION FACTOR
(dB/m) 41.7 41.7 22.9 22.9 CORRECTION FACTOR
(dB/m) 41.7 41.7 22.9 22.9 NO. 1 2 3 4 NO. 1 2 3 4 FREQ.
(MHz)
*5550.00
*5550.00 11100.00 11100.00 FREQ.
(MHz)
*5550.00
*5550.00 11100.00 11100.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 36 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 134 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 109.9 PK 68.2 100.2 AV 58.5 61.7 PK 48.9 62.5 PK 39.2 49.7 AV 26.4 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.36 H 1.36 H 1.36 H 2.14 H 2.14 H 81 81 81 183 183
-6.5
-11.5
-4.3 68.2 74.0 54.0
(m) ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 112.2 PK 102.5 AV 62.8 PK 62.8 PK 50.0 AV LIMIT MARGIN
(dBuV/m)
(dB) 68.2 74.0 54.0
-5.4
-11.2
-4.0
(m) 2.27 V 2.27 V 2.27 V 1.63 V 1.63 V 159 159 159 295 295 RAW VALUE
(dBuV) 70.5 60.8 50.0 39.5 26.7 CORRECTION FACTOR
(dB/m) 41.7 41.7 12.8 23.3 23.3 CORRECTION FACTOR
(dB/m) 41.7 41.7 12.8 23.3 23.3 NO. FREQ.
(MHz) 1 2 3 4 5
*5670.00
*5670.00
#5725.00 11340.00 11340.00 NO. FREQ.
(MHz) 1 2 3 4 5
*5670.00
*5670.00
#5725.00 11340.00 11340.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 37 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 142 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) 68.2 LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 61.0 PK 48.5 111.7 PK 69.6 101.9 AV 59.8 62.1 PK 48.3 64.3 PK 40.5 50.6 AV 26.8 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.10 H 1.10 H 1.10 H 1.10 H 2.63 H 2.63 H 90 90 90 90 117 117 68.2 74.0 54.0
-6.1
-9.7
-3.4
-7.2 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 61.4 PK 113.4 PK 103.8 AV 62.8 PK 64.9 PK 51.3 AV
(dBuV/m) 68.2 68.2 74.0 54.0
(dB)
-6.8
-5.4
-9.1
-2.7 TABLE ANGLE
(Degree) 180 180 180 180 261 261 RAW VALUE
(dBuV) 48.9 71.3 61.7 49.0 41.1 27.5
(m) 1.99 V 1.99 V 1.99 V 1.99 V 1.98 V 1.98 V CORRECTION FACTOR
(dB/m) 12.5 42.1 42.1 13.8 23.8 23.8 CORRECTION FACTOR
(dB/m) 12.5 42.1 42.1 13.8 23.8 23.8 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5710.00
*5710.00
#5850.00 11420.00 11420.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5710.00
*5710.00
#5850.00 11420.00 11420.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 38 / 84 Report Format Version:6.1.2 802.11ac (VHT80) CHANNEL TX Channel 58 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5150.00 5150.00
*5290.00
*5290.00 5364.00 5364.00
#10580.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 5150.00 5150.00
*5290.00
*5290.00 5364.00 5364.00
#10580.00 Remarks:
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 59.8 PK 48.0 47.5 AV 35.7 104.6 PK 64.2 94.8 AV 54.4 64.2 PK 52.2 50.9 AV 38.9 61.3 PK 39.1 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.15 H 1.15 H 1.15 H 1.15 H 1.15 H 1.15 H 2.75 H 236 236 236 236 236 236 146 74.0 54.0 68.2
-9.8
-3.1
-6.9
-14.2
-6.5 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 62.4 PK 48.7 AV 108.7 PK 99.3 AV 68.4 PK 53.9 AV 61.9 PK
(dBuV/m) 74.0 54.0 74.0 54.0 68.2
(dB)
-11.6
-5.3
-5.6
-0.1
-6.3 TABLE ANGLE
(Degree) 166 166 166 166 166 166 280 RAW VALUE
(dBuV) 50.6 36.9 68.3 58.9 56.4 41.9 39.7
(m) 2.37 V 2.37 V 2.37 V 2.37 V 2.37 V 2.37 V 1.46 V CORRECTION FACTOR
(dB/m) 11.8 11.8 40.4 40.4 12.0 12.0 22.2 CORRECTION FACTOR
(dB/m) 11.8 11.8 40.4 40.4 12.0 12.0 22.2 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 39 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 106 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 64.2 PK 51.7 50.5 AV 38.0 66.3 PK 53.8 106.3 PK 64.6 96.2 AV 54.5 61.2 PK 48.4 61.3 PK 38.5 48.8 AV 26.0 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.33 H 1.33 H 1.33 H 1.33 H 1.33 H 1.33 H 2.97 H 2.97 H 90 90 90 90 90 90 184 184
-7.0
-12.7
-5.2 68.2 74.0 54.0
-9.8
-3.5
-1.9 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 64.7 PK 50.8 AV 68.1 PK 107.4 PK 97.6 AV 61.4 PK 61.7 PK 49.1 AV
(dBuV/m) 74.0 54.0 68.2 68.2 74.0 54.0
(dB)
-9.3
-3.2
-0.1
-6.8
-12.3
-4.9 TABLE ANGLE
(Degree) 167 167 167 167 167 167 301 301 RAW VALUE
(dBuV) 52.2 38.3 55.6 65.7 55.9 48.6 38.9 26.3
(m) 2.04 V 2.04 V 2.04 V 2.04 V 2.04 V 2.04 V 1.26 V 1.26 V CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.7 41.7 12.8 22.8 22.8 CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.7 41.7 12.8 22.8 22.8 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 8 5460.00 5460.00
#5470.00
*5530.00
*5530.00
#5725.00 11060.00 11060.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 8 5460.00 5460.00
#5470.00
*5530.00
*5530.00
#5725.00 11060.00 11060.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 40 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 122 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 68.2 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 63.6 PK 51.1 49.9 AV 37.4 65.1 PK 52.6 106.4 PK 64.7 96.2 AV 54.5 66.0 PK 53.2 61.0 PK 38.4 49.0 AV 26.4 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.29 H 1.29 H 1.29 H 1.29 H 1.29 H 1.29 H 2.39 H 2.39 H 85 85 85 85 85 85 177 177
-10.4
-4.1
-3.1
-2.2
-13.0
-5.0 68.2 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 64.9 PK 50.4 AV 66.8 PK 107.7 PK 98.2 AV 67.6 PK 61.2 PK 49.3 AV
(dBuV/m) 74.0 54.0 68.2 68.2 74.0 54.0
(dB)
-9.1
-3.6
-1.4
-0.6
-12.8
-4.7 TABLE ANGLE
(Degree) 164 164 164 164 164 164 230 230 RAW VALUE
(dBuV) 52.4 37.9 54.3 66.0 56.5 54.8 38.6 26.7
(m) 2.05 V 2.05 V 2.05 V 2.05 V 2.05 V 2.05 V 1.96 V 1.96 V CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.7 41.7 12.8 22.6 22.6 CORRECTION FACTOR
(dB/m) 12.5 12.5 12.5 41.7 41.7 12.8 22.6 22.6 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 8 5460.00 5460.00
#5470.00
*5610.00
*5610.00
#5725.00 11220.00 11220.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 8 5460.00 5460.00
#5470.00
*5610.00
*5610.00
#5725.00 11220.00 11220.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 41 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 138 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) 68.2 LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 60.7 PK 48.2 107.5 PK 65.5 98.5 AV 56.5 63.3 PK 49.5 64.1 PK 40.5 50.7 AV 27.1 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.00 H 1.00 H 1.00 H 1.00 H 1.97 H 1.97 H 90 90 90 90 225 225 68.2 74.0 54.0
-4.9
-9.9
-3.3
-7.5 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 60.9 PK 110.0 PK 99.8 AV 63.9 PK 64.7 PK 51.4 AV
(dBuV/m) 68.2 68.2 74.0 54.0
(dB)
-7.3
-4.3
-9.3
-2.6 TABLE ANGLE
(Degree) 175 175 175 175 281 281 RAW VALUE
(dBuV) 48.4 68.0 57.8 50.1 41.1 27.8
(m) 2.23 V 2.23 V 2.23 V 2.23 V 1.64 V 1.64 V CORRECTION FACTOR
(dB/m) 12.5 42.0 42.0 13.8 23.6 23.6 CORRECTION FACTOR
(dB/m) 12.5 42.0 42.0 13.8 23.6 23.6 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5690.00
*5690.00
#5850.00 11380.00 11380.00 NO. FREQ.
(MHz) 1 2 3 4 5 6
#5470.00
*5690.00
*5690.00
#5850.00 11380.00 11380.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 42 / 84 Report Format Version:6.1.2 Below 1GHz Worst-Case Data:
802.11a CHANNEL TX Channel 52 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE NO. FREQ. (MHz) 1 2 3 4 5 6 31.84 64.83 190.95 353.95 742.03 932.19 Remarks:
LEVEL
(dBuV/m) 24.5 QP 28.0 QP 22.4 QP 24.2 QP 31.2 QP 34.4 QP LIMIT
(dBuV/m) 40.0 40.0 43.5 46.0 46.0 46.0
-15.5
-12.0
-21.1
-21.8
-14.8
-11.6 1.00 H 1.00 H 1.00 H 1.00 H 1.00 H 1.00 H 112 104 4 9 264 216 CORRECTION FACTOR
(dB/m)
-10.2
-9.7
-11.4
-7.3 1.0 4.1
(dBuV) 34.7 37.7 33.8 31.5 30.2 30.3 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit of frequency range 30MHz ~ 1000MHz 4. Margin value = Emission Level Limit value 5. The emission levels were very low against the limit of frequency range 9kHz ~ 30MHz: the amplitude of spurious emissions attenuated more than 20 dB below the permissible value to be report Report No.: RF181023C12A Reference No.: 181023C11 Page No. 43 / 84 Report Format Version:6.1.2 CHANNEL TX Channel 52 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION LEVEL
(dBuV/m) 35.0 QP 28.5 QP 26.9 QP 27.0 QP 36.0 QP 31.8 QP LIMIT
(dBuV/m) MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE
(dBuV) 40.0 43.5 46.0 46.0 46.0 54.0
-5.0
-15.0
-19.1
-19.0
-10.0
-22.2 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 67 33 146 157 184 16 44.4 38.2 34.2 28.6 31.8 27.2 CORRECTION FACTOR
(dB/m)
-9.4
-9.7
-7.3
-1.6 4.2 4.6 NO. FREQ. (MHz) 1 2 3 4 5 6 39.60 134.68 336.48 635.30 939.95 1000.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit of frequency range 30MHz ~ 1000MHz 4. Margin value = Emission Level Limit value 5. The emission levels were very low against the limit of frequency range 9kHz ~ 30MHz: the amplitude of spurious emissions attenuated more than 20 dB below the permissible value to be report Report No.: RF181023C12A Reference No.: 181023C11 Page No. 44 / 84 Report Format Version:6.1.2 4.2 Conducted Emission Measurement 4.2.1 Limits of Conducted Emission Measurement Frequency (MHz) 0.15 - 0.5 0.50 - 5.0 5.0 - 30.0 Quasi-peak 66 - 56 56 60 Conducted Limit (dBuV) Average 56 - 46 46 50 Note: 1. The lower limit shall apply at the transition frequencies. 2. The limit decreases in line with the logarithm of the frequency in the range of 0.15 to 0.50MHz. 4.2.2 Test Instruments Description & Manufacturer Model No. Serial No. Cal. Date Cal. Due 5D-FB 100291 ESCS30 Sep. 03, 2018 Sep. 02, 2019 Cable-cond1-01 Sep. 05, 2018 Sep. 04, 2019 Test Receiver ROHDE & SCHWARZ RF signal cable Woken LISN ROHDE & SCHWARZ
(EUT) LISN ROHDE & SCHWARZ
(Peripheral) Software ADT Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are traceable Aug. 19, 2018 Aug. 18, 2019 Feb. 26, 2018 Feb. 25, 2019 BV ADT_Cond_ ESH3-Z5 V7.3.7.4 ENV216 101826 100311 NA NA NA to NML/ROC and NIST/USA. 2. The test was performed in HwaYa Shielded Room 1. 3. The VCCI Site Registration No. is C-2040. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 45 / 84 Report Format Version:6.1.2 4.2.3 Test Procedures a. The EUT was placed 0.4 meters from the conducting wall of the shielded room with EUT being connected to the power mains through a line impedance stabilization network (LISN). Other support units were connected to the power mains through another LISN. The two LISNs provide 50 ohm/ 50uH of coupling impedance for the measuring instrument. b. Both lines of the power mains connected to the EUT were checked for maximum conducted interference. c. The frequency range from 150kHz to 30MHz was searched. Emission levels under (Limit - 20dB) was not recorded. Note: The resolution bandwidth and video bandwidth of test receiver is 9kHz for quasi-peak detection (QP) and average detection (AV) at frequency 0.15MHz-30MHz. 4.2.4 Deviation from Test Standard No deviation. 4.2.5 Test Setup Vertical Ground Reference Plane 40cm EUT LISN 80cm Test Receiver Note: 1.Support units were connected to second LISN. Horizontal Ground Reference Plane For the actual test configuration, please refer to the attached file (Test Setup Photo). 4.2.6 EUT Operating Conditions Same as 4.1.6. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 46 / 84 Report Format Version:6.1.2 4.2.7 Test Results Worst-case data:
Phase No 1 2 3 4 5 6 Freq.
[MHz]
0.15000 0.16562 0.20469 0.46250 0.54063 0.95469 Line (L) Detector Function Quasi-Peak (QP) /
Average (AV) Corr. Factor
(dB) 9.67 9.67 9.67 9.66 9.66 9.65 Reading Value Emission Level
[dB (uV)]
[dB (uV)]
Limit
[dB (uV)]
Q.P. 44.90 43.54 39.45 24.40 25.12 12.70 AV. 29.04 29.17 24.65 12.01 15.82 2.62 Q.P. 54.57 53.21 49.12 34.06 34.78 22.35 AV. 38.71 38.84 34.32 21.67 25.48 12.27 Q.P. 66.00 65.18 63.42 56.65 56.00 56.00 AV. 56.00 55.18 53.42 46.65 46.00 46.00 Margin
(dB) Q.P.
-11.43
-11.97
-14.30
-22.59
-21.22
-33.65 AV.
-17.29
-16.34
-19.10
-24.98
-20.52
-33.73 Remarks:
1. Q.P. and AV. are abbreviations of quasi-peak and average individually. 2. The emission levels of other frequencies were very low against the limit. 3. Margin value = Emission level - Limit value 4. Correction factor = Insertion loss + Cable loss 5. Emission Level = Correction Factor + Reading Value. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 47 / 84 Report Format Version:6.1.2 Phase Neutral (N) Detector Function Quasi-Peak (QP) /
Average (AV) No 1 2 3 4 5 6 Freq.
[MHz]
0.15000 0.17344 0.18906 0.36875 0.54063 0.93906 Corr. Factor
(dB) 9.68 9.68 9.67 9.67 9.67 9.65 Reading Value Emission Level
[dB (uV)]
[dB (uV)]
Limit
[dB (uV)]
Q.P. 43.75 42.26 40.35 25.89 23.69 14.56 AV. 27.80 27.39 25.51 12.73 15.70 5.85 Q.P. 53.43 51.94 50.02 35.56 33.36 24.21 AV. 37.48 37.07 35.18 22.40 25.37 15.50 Q.P. 66.00 64.79 64.08 58.53 56.00 56.00 AV. 56.00 54.79 54.08 48.53 46.00 46.00 Margin
(dB) Q.P.
-12.57
-12.85
-14.06
-22.97
-22.64
-31.79 AV.
-18.52
-17.72
-18.90
-26.13
-20.63
-30.50 Remarks:
1. Q.P. and AV. are abbreviations of quasi-peak and average individually. 2. The emission levels of other frequencies were very low against the limit. 3. Margin value = Emission level - Limit value 4. Correction factor = Insertion loss + Cable loss 5. Emission Level = Correction Factor + Reading Value. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 48 / 84 Report Format Version:6.1.2 4.3 Transmit Power Measurement 4.3.1 Limits of Transmit Power Measurement Operation Band U-NII-1 U-NII-2A U-NII-2C U-NII-3 EUT Category Limit Outdoor Access Point Fixed point-to-point Access Point Indoor Access Point Mobile and Portable client device 1 Watt (30 dBm)
(Max. e.i.r.p 125mW(21 dBm) at any elevation angle above 30 degrees as measured from the horizon) 1 Watt (30 dBm) 1 Watt (30 dBm) 250mW (24 dBm) 250mW (24 dBm) or 11 dBm+10 log B*
250mW (24 dBm) or 11 dBm+10 log B*
1 Watt (30 dBm)
*B is the 26 dB emission bandwidth in megahertz Per KDB 662911 Method of conducted output power measurement on IEEE 802.11 devices, Array Gain = 0 dB (i.e., no array gain) for NANT 4;
Array Gain = 0 dB (i.e., no array gain) for channel widths 40 MHz for any NANT;
Array Gain = 5 log(NANT/NSS) dB or 3 dB, whichever is less for 20-MHz channel widths with NANT 5. EUT For power measurements on all other devices: Array Gain = 10 log(NANT/NSS) dB. 4.3.2 Test Setup For Power Output For 26dB Bandwidth 4.3.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. Spectrum Analyzer Power Sensor Attenuator Attenuator EUT Report No.: RF181023C12A Reference No.: 181023C11 Page No. 49 / 84 Report Format Version:6.1.2 4.3.4 Test Procedure For Average Power Measurement 802.11a, 802.11ac (VHT20), 802.11ac (VHT40) Method PM is used to perform output power measurement, trigger and gating function of wide band power meter is enabled to measure max output power of TX on burst and set the detector to average. Duty factor is not added to measured value. For 26dB Bandwidth a. Set RBW = approximately 1% of the emission bandwidth. b. Set the VBW > RBW. c. Detector = Peak. d. Trace mode = max hold. e. Measure the maximum width of the emission that is 26 dB down from the peak of the emission. Compare this with the RBW setting of the analyzer. Readjust RBW and repeat measurement as needed until the RBW/EBW ratio is approximately 1%. 4.3.5 Deviation from Test Standard No deviation. 4.3.6 EUT Operating Conditions The software provided by client to enable the EUT under transmission condition continuously at lowest, middle and highest channel frequencies individually. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 50 / 84 Report Format Version:6.1.2 4.3.7 Test Result Power Output:
CDD Mode 802.11a Chan. Freq.
(MHz) 52 60 64 100 116 140 144 5260 5300 5320 5500 5580 5700 5720
(For U-NII-2C) 5720 Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 17.29 17.16 17.30 17.14 14.53 14.83 17.43 17.07 17.39 16.98 17.45 17.08 17.55 17.33 15.37 16.92 17.02 17.48 17.36 17.26 15.13 17.36 17.59 17.24 Total Power
(mW) 216.915 Total Power
(dBm) 23.36 Power Limit
(dBm) 23.86 212.750 23.28 23.87 125.807 21.00 23.92 209.922 23.22 23.94 212.478 23.27 23.91 215.582 23.34 23.94 Pass /
Fail Pass Pass Pass Pass Pass Pass 14.75 15.07 14.55 14.41 122.868 20.89 22.65 Pass 8.54 30.645 14.86 30.00 Pass 7.64 9.08 9.25
(For U-NII-3) 144 Note:
For U-NII-2A, U-NII-2C Band:
Chain 0 1. 11dBm + 10log (19.94) = 23.99 < 24dBm 2. 11dBm + 10log (19.93) = 23.99 < 24dBm 3. 11dBm + 10log (20.05) = 24.02 > 24dBm 4. 11dBm + 10log (20.13) = 24.03 > 24dBm 5. 11dBm + 10log (20.02) = 24.01 > 24dBm 6. 11dBm + 10log (20.19) = 24.05 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.78) = 22.82 < 24dBm Chain 1 1. 11dBm + 10log (19.78) = 23.96 < 24dBm 2. 11dBm + 10log (19.48) = 23.89 < 24dBm 3. 11dBm + 10log (19.94) = 23.99 < 24dBm 4. 11dBm + 10log (19.84) = 23.97 < 24dBm 5. 11dBm + 10log (19.94) = 23.99 < 24dBm 6. 11dBm + 10log (20.25) = 24.06 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.84) = 22.80 < 24dBm Report No.: RF181023C12A Reference No.: 181023C11 Page No. 51 / 84 Report Format Version:6.1.2 Chain 2 1. 11dBm + 10log (19.35) = 23.86 < 24dBm 2. 11dBm + 10log (19.40) = 23.87 < 24dBm 3. 11dBm + 10log (19.63) = 23.92 < 24dBm 4. 11dBm + 10log (19.77) = 23.96 < 24dBm 5. 11dBm + 10log (19.86) = 23.97 < 24dBm 6. 11dBm + 10log (20.06) = 24.02 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.91) = 22.78 < 24dBm Chain 3 1. 11dBm + 10log (19.73) = 23.95 < 24dBm 2. 11dBm + 10log (20.32) = 24.07 > 24dBm 3. 11dBm + 10log (20.15) = 24.04 > 24dBm 4. 11dBm + 10log (19.69) = 23.94 < 24dBm 5. 11dBm + 10log (19.55) = 23.91 < 24dBm 6. 11dBm + 10log (19.69) = 23.94 < 24dBm 7. 11dBm + 10log (5725.00 - 5710.35) = 22.65 < 24dBm For reference only - power meter value The power value was measured by power meter with average sensor Chan. 144 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5720 213.796 23.30 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 52 / 84 Report Format Version:6.1.2 802.11ac (VHT20) Chan. Freq.
(MHz) 52 60 64 100 116 140 144 5260 5300 5320 5500 5580 5700 5720
(For U-NII-2C) 5720 Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 17.02 17.00 17.17 17.01 14.76 14.91 17.41 17.20 17.45 17.17 17.25 17.20 17.33 17.63 15.77 17.33 17.22 17.22 17.28 17.58 15.66 17.32 17.44 17.21 Total Power
(mW) 208.000 Total Power
(dBm) 23.18 Power Limit
(dBm) 24.00 217.576 23.38 24.00 135.467 21.32 24.00 215.588 215.895 210.894 23.34 24.00 23.34 24.00 23.24 24.00 Pass /
Fail Pass Pass Pass Pass Pass Pass 15.19 15.10 15.40 14.74 129.855 21.13 22.84 Pass 10.09 37.739 15.77 30.00 Pass 9.77 9.38 9.72
(For U-NII-3) 144 Note:
For U-NII-2A, U-NII-2C Band:
Chain 0 1. 11dBm + 10log (20.54) = 24.12 > 24dBm 2. 11dBm + 10log (20.64) = 24.14 > 24dBm 3. 11dBm + 10log (20.75) = 24.17 > 24dBm 4. 11dBm + 10log (20.58) = 24.13 > 24dBm 5. 11dBm + 10log (20.67) = 24.15 > 24dBm 6. 11dBm + 10log (20.72) = 24.16 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.65) = 22.86 < 24dBm Chain 1 1. 11dBm + 10log (20.74) = 24.16 > 24dBm 2. 11dBm + 10log (20.62) = 24.14 > 24dBm 3. 11dBm + 10log (20.57) = 24.13 > 24dBm 4. 11dBm + 10log (20.54) = 24.12 > 24dBm 5. 11dBm + 10log (20.60) = 24.13 > 24dBm 6. 11dBm + 10log (20.67) = 24.15 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.66) = 22.85 < 24dBm Chain 2 1. 11dBm + 10log (20.57) = 24.13 > 24dBm 2. 11dBm + 10log (20.57) = 24.13 > 24dBm 3. 11dBm + 10log (20.65) = 24.14 > 24dBm 4. 11dBm + 10log (20.64) = 24.14 > 24dBm 5. 11dBm + 10log (20.67) = 24.15 > 24dBm 6. 11dBm + 10log (20.79) = 24.17 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.62) = 22.86 < 24dBm Report No.: RF181023C12A Reference No.: 181023C11 Page No. 53 / 84 Report Format Version:6.1.2 Chain 3 1. 11dBm + 10log (20.49) = 24.11 > 24dBm 2. 11dBm + 10log (20.42) = 24.10 > 24dBm 3. 11dBm + 10log (20.46) = 24.10 > 24dBm 4. 11dBm + 10log (20.45) = 24.10 > 24dBm 5. 11dBm + 10log (20.61) = 24.14 > 24dBm 6. 11dBm + 10log (20.68) = 24.15 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.70) = 22.84 < 24dBm For reference only - power meter value The power value was measured by power meter with average sensor Chan. 144 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5720 209.894 23.22 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 54 / 84 Report Format Version:6.1.2 802.11ac (VHT40) Chan. 54 62 102 110 134 142 Freq.
(MHz) 5270 5310 5510 5550 5670 5710
(For Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 17.26 17.23 17.52 17.25 17.15 16.89 17.29 16.95 17.11 16.97 17.67 17.89 16.85 16.91 17.46 17.49 17.79 17.15 17.16 17.28 Total Power
(mW) 220.640 231.217 201.042 Total Power
(dBm) 23.44 Power Limit
(dBm) 24.00 23.64 24.00 23.03 24.00 204.216 23.10 24.00 210.353 23.23 24.00 Pass /
Fail Pass Pass Pass Pass Pass 14.97 15.72 15.68 14.77 141.032 21.49 24.00 Pass 5.24 11.434 10.58 30.00 Pass U-NII-2C) 5710
(For U-NII-3) 4.10 4.65 3.37 142 Note:
For U-NII-2A, U-NII-2C Band:
Chain 0 1. 11dBm + 10log (40.83) = 27.10 > 24dBm 2. 11dBm + 10log (40.82) = 27.10 > 24dBm 3. 11dBm + 10log (40.72) = 27.09 > 24dBm 4. 11dBm + 10log (40.72) = 27.09 > 24dBm 5. 11dBm + 10log (40.69) = 27.09 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.70) = 26.47 > 24dBm Chain 1 1. 11dBm + 10log (40.69) = 27.09 > 24dBm 2. 11dBm + 10log (40.79) = 27.10 > 24dBm 3. 11dBm + 10log (40.95) = 27.12 > 24dBm 4. 11dBm + 10log (40.90) = 27.11 > 24dBm 5. 11dBm + 10log (40.93) = 27.12 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.67) = 26.48 > 24dBm Chain 2 1. 11dBm + 10log (40.57) = 27.08 > 24dBm 2. 11dBm + 10log (40.71) = 27.09 > 24dBm 3. 11dBm + 10log (40.63) = 27.08 > 24dBm 4. 11dBm + 10log (40.48) = 27.07 > 24dBm 5. 11dBm + 10log (40.57) = 27.08 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.75) = 26.47 > 24dBm Chain 3 1. 11dBm + 10log (40.60) = 27.08 > 24dBm 2. 11dBm + 10log (40.61) = 27.08 > 24dBm 3. 11dBm + 10log (40.41) = 27.06 > 24dBm 4. 11dBm + 10log (40.49) = 27.07 > 24dBm 5. 11dBm + 10log (40.54) = 27.07 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.79) = 26.46 > 24dBm Report No.: RF181023C12A Reference No.: 181023C11 Page No. 55 / 84 Report Format Version:6.1.2 For reference only - power meter value The power value was measured by power meter with average sensor Chan. 142 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5710 210.378 23.23 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 56 / 84 Report Format Version:6.1.2 802.11ac (VHT80) Chan. 58 106 122 138 Freq.
(MHz) 5290 5530 5610 5690
(For Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 15.37 15.26 16.04 16.14 16.91 16.31 16.05 15.96 16.75 15.77 16.46 17.05 Total Power
(mW) 146.038 Total Power
(dBm) 21.64 Power Limit
(dBm) 24.00 164.999 22.17 24.00 189.861 22.78 24.00 Pass /
Fail Pass Pass Pass 14.95 14.21 14.76 14.45 121.965 20.86 24.00 Pass 4.5351 6.57 30.00 Pass U-NII-2C) 5690
(For U-NII-3)
-1.48 1.19 0.16 0.89 138 Note:
For U-NII-2A, U-NII-2C Band:
1. 11dBm + 10log (84.03) = 30.24 > 24dBm 2. 11dBm + 10log (83.83) = 30.23 > 24dBm 3. 11dBm + 10log (83.83) = 30.23 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.20) = 29.85 > 24dBm Chain 1 1. 11dBm + 10log (83.91) = 30.23 > 24dBm 2. 11dBm + 10log (84.03) = 30.24 > 24dBm 3. 11dBm + 10log (84.13) = 30.24 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.09) = 29.85 > 24dBm Chain 2 1. 11dBm + 10log (84.23) = 30.25 > 24dBm 2. 11dBm + 10log (84.10) = 30.24 > 24dBm 3. 11dBm + 10log (84.12) = 30.24 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.05) = 29.86 > 24dBm Chain 3 1. 11dBm + 10log (83.23) = 30.20 > 24dBm 2. 11dBm + 10log (83.32) = 30.20 > 24dBm 3. 11dBm + 10log (82.86) = 30.18 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.55) = 29.83 > 24dBm For reference only - power meter value The power value was measured by power meter with average sensor Chan. 138 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5690 215.278 23.33 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 57 / 84 Report Format Version:6.1.2 Beamforming Mode 802.11ac (VHT20) Chan. Freq.
(MHz) 52 60 64 100 116 140 144 5260 5300 5320 5500 5580 5700 5720
(For U-NII-2C) 5720 Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 17.02 17.00 17.17 17.01 14.76 14.91 17.41 17.20 17.45 17.17 17.25 17.20 17.33 17.63 15.77 17.33 17.22 17.22 17.28 17.58 15.66 17.32 17.44 17.21 Total Power
(mW) 208.000 Total Power
(dBm) 23.18 Power Limit
(dBm) 24.00 217.576 23.38 24.00 135.467 21.32 24.00 215.588 215.895 210.894 23.34 24.00 23.34 24.00 23.24 24.00 Pass /
Fail Pass Pass Pass Pass Pass Pass 15.19 15.10 15.40 14.74 129.855 21.13 22.84 Pass 30.00 Pass 9.77 9.38 9.72 10.09 15.77 37.739
(For U-NII-3) 144 Note:
1. 5260~5320MHz Directional gain = 5.48dBi < 6dBi, so the limit no need to be reduced. 2. 5500~5720MHz Directional gain = 5.11dBi < 6dBi, so the limit no need to be reduced. 3. 5745~5825MHz Directional gain = 5.14dBi < 6dBi, so the limit no need to be reduced. For U-NII-2A, U-NII-2C Band:
Chain 0 1. 11dBm + 10log (20.54) = 24.12 > 24dBm 2. 11dBm + 10log (20.64) = 24.14 > 24dBm 3. 11dBm + 10log (20.75) = 24.17 > 24dBm 4. 11dBm + 10log (20.58) = 24.13 > 24dBm 5. 11dBm + 10log (20.67) = 24.15 > 24dBm 6. 11dBm + 10log (20.72) = 24.16 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.65) = 22.86 < 24dBm Chain 1 1. 11dBm + 10log (20.74) = 24.16 > 24dBm 2. 11dBm + 10log (20.62) = 24.14 > 24dBm 3. 11dBm + 10log (20.57) = 24.13 > 24dBm 4. 11dBm + 10log (20.54) = 24.12 > 24dBm 5. 11dBm + 10log (20.60) = 24.13 > 24dBm 6. 11dBm + 10log (20.67) = 24.15 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.66) = 22.85 < 24dBm Report No.: RF181023C12A Reference No.: 181023C11 Page No. 58 / 84 Report Format Version:6.1.2 Chain 2 1. 11dBm + 10log (20.57) = 24.13 > 24dBm 2. 11dBm + 10log (20.57) = 24.13 > 24dBm 3. 11dBm + 10log (20.65) = 24.14 > 24dBm 4. 11dBm + 10log (20.64) = 24.14 > 24dBm 5. 11dBm + 10log (20.67) = 24.15 > 24dBm 6. 11dBm + 10log (20.79) = 24.17 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.62) = 22.86 < 24dBm Chain 3 1. 11dBm + 10log (20.49) = 24.11 > 24dBm 2. 11dBm + 10log (20.42) = 24.10 > 24dBm 3. 11dBm + 10log (20.46) = 24.10 > 24dBm 4. 11dBm + 10log (20.45) = 24.10 > 24dBm 5. 11dBm + 10log (20.61) = 24.14 > 24dBm 6. 11dBm + 10log (20.68) = 24.15 > 24dBm 7. 11dBm + 10log (5725.00 - 5709.70) = 22.84 < 24dBm For reference only - power meter value The power value was measured by power meter with average sensor Chan. 144 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5720 209.894 23.22 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 59 / 84 Report Format Version:6.1.2 802.11ac (VHT40) Chan. 54 62 102 110 134 142 Freq.
(MHz) 5270 5310 5510 5550 5670 5710
(For U-NII-2C) 5710
(For U-NII-3) Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 17.26 17.23 17.52 17.25 17.15 16.89 17.29 16.95 17.11 16.97 17.67 17.89 16.85 16.91 17.46 17.49 17.79 17.15 17.16 17.28 Total Power
(mW) 220.640 231.217 201.042 Total Power
(dBm) 23.44 Power Limit
(dBm) 24.00 23.64 24.00 23.03 24.00 204.216 23.10 24.00 210.353 23.23 24.00 Pass /
Fail Pass Pass Pass Pass Pass 14.97 15.72 15.68 14.77 141.032 21.49 24.00 Pass 30.00 Pass 5.24 4.10 4.65 3.37 11.434 10.58 142 Note:
1. 5260~5320MHz Directional gain = 5.48dBi < 6dBi, so the limit no need to be reduced. 2. 5500~5720MHz Directional gain = 5.11dBi < 6dBi, so the limit no need to be reduced. 3. 5745~5825MHz Directional gain = 5.14dBi < 6dBi, so the limit no need to be reduced. For U-NII-2A, U-NII-2C Band:
Chain 0 1. 11dBm + 10log (40.83) = 27.10 > 24dBm 2. 11dBm + 10log (40.82) = 27.10 > 24dBm 3. 11dBm + 10log (40.72) = 27.09 > 24dBm 4. 11dBm + 10log (40.72) = 27.09 > 24dBm 5. 11dBm + 10log (40.69) = 27.09 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.70) = 26.47 > 24dBm Chain 1 1. 11dBm + 10log (40.69) = 27.09 > 24dBm 2. 11dBm + 10log (40.79) = 27.10 > 24dBm 3. 11dBm + 10log (40.95) = 27.12 > 24dBm 4. 11dBm + 10log (40.90) = 27.11 > 24dBm 5. 11dBm + 10log (40.93) = 27.12 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.67) = 26.48 > 24dBm Chain 2 1. 11dBm + 10log (40.57) = 27.08 > 24dBm 2. 11dBm + 10log (40.71) = 27.09 > 24dBm 3. 11dBm + 10log (40.63) = 27.08 > 24dBm 4. 11dBm + 10log (40.48) = 27.07 > 24dBm 5. 11dBm + 10log (40.57) = 27.08 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.75) = 26.47 > 24dBm Report No.: RF181023C12A Reference No.: 181023C11 Page No. 60 / 84 Report Format Version:6.1.2 Chain 3 1. 11dBm + 10log (40.60) = 27.08 > 24dBm 2. 11dBm + 10log (40.61) = 27.08 > 24dBm 3. 11dBm + 10log (40.41) = 27.06 > 24dBm 4. 11dBm + 10log (40.49) = 27.07 > 24dBm 5. 11dBm + 10log (40.54) = 27.07 > 24dBm 6. 11dBm + 10log (5725.00 - 5689.79) = 26.46 > 24dBm For reference only - power meter value The power value was measured by power meter with average sensor Chan. 142 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5710 210.378 23.23 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 61 / 84 Report Format Version:6.1.2 802.11ac (VHT80) Chan. 58 106 122 138 Freq.
(MHz) 5290 5530 5610 5690
(For Average Power (dBm) Chain 0 Chain 1 Chain 2 Chain 3 15.37 15.26 16.04 16.14 16.91 16.31 16.05 15.96 16.75 15.77 16.46 17.05 Total Power
(mW) 146.038 Total Power
(dBm) 21.64 Power Limit
(dBm) 24.00 164.999 22.17 24.00 189.861 22.78 24.00 Pass /
Fail Pass Pass Pass 14.95 14.21 14.76 14.45 121.965 20.86 24.00 Pass 30.00 Pass U-NII-2C) 5690
(For U-NII-3)
-1.48 6.57 1.19 0.16 0.89 4.5351 138 Note:
1. 5260~5320MHz Directional gain = 5.48dBi < 6dBi, so the limit no need to be reduced. 2. 5500~5720MHz Directional gain = 5.11dBi < 6dBi, so the limit no need to be reduced. 3. 5745~5825MHz Directional gain = 5.14dBi < 6dBi, so the limit no need to be reduced. For U-NII-2A, U-NII-2C Band:
1. 11dBm + 10log (84.03) = 30.24 > 24dBm 2. 11dBm + 10log (83.83) = 30.23 > 24dBm 3. 11dBm + 10log (83.83) = 30.23 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.20) = 29.85 > 24dBm Chain 1 1. 11dBm + 10log (83.91) = 30.23 > 24dBm 2. 11dBm + 10log (84.03) = 30.24 > 24dBm 3. 11dBm + 10log (84.13) = 30.24 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.09) = 29.85 > 24dBm Chain 2 1. 11dBm + 10log (84.23) = 30.25 > 24dBm 2. 11dBm + 10log (84.10) = 30.24 > 24dBm 3. 11dBm + 10log (84.12) = 30.24 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.05) = 29.86 > 24dBm Chain 3 1. 11dBm + 10log (83.23) = 30.20 > 24dBm 2. 11dBm + 10log (83.32) = 30.20 > 24dBm 3. 11dBm + 10log (82.86) = 30.18 > 24dBm 4. 11dBm + 10log (5725.00 - 5648.55) = 29.83 > 24dBm For reference only - power meter value The power value was measured by power meter with average sensor Chan. 138 Freq. (MHz) Conducted Power (mW) Conducted Power (dBm) 5690 215.278 23.33 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 62 / 84 Report Format Version:6.1.2 26dB Bandwidth:
802.11a Chan. 5700 5720
(For U-NII-2C) 5720
(For U-NII-3) Freq.
(MHz) 5260 5300 5320 5500 5580 Freq.
(MHz) 5260 5300 5320 5500 5580 5700 5720
(For U-NII-2C) 5720
(For U-NII-3) 52 60 64 100 116 140 144 144 52 60 64 100 116 140 144 144 802.11ac (VHT20) Chan. 26dBc Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 19.94 19.93 20.05 20.13 20.02 20.19 15.22 4.89 19.78 19.48 19.94 19.84 19.94 20.25 15.16 4.86 19.35 19.40 19.63 19.77 19.86 20.06 15.09 4.70 19.73 20.32 20.15 19.69 19.55 19.69 14.65 4.92 26dBc Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 20.54 20.64 20.75 20.58 20.67 20.72 15.35 20.54 20.74 20.62 20.57 20.54 20.60 20.67 15.34 20.74 20.57 20.57 20.65 20.64 20.67 20.79 15.38 20.57 20.49 20.42 20.46 20.45 20.61 20.68 15.30 20.49 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 63 / 84 Report Format Version:6.1.2 802.11ac (VHT40) 26dBc Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 40.83 40.82 40.72 40.72 40.69 35.30 5.44 40.69 40.79 40.95 40.90 40.93 35.33 5.53 40.57 40.71 40.63 40.48 40.57 35.25 5.24 40.60 40.61 40.41 40.49 40.54 35.21 5.25 26dBc Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 84.03 83.83 83.83 76.80 7.20 83.91 84.03 84.13 76.91 7.25 84.23 84.10 84.12 76.95 7.19 83.23 83.32 82.86 76.45 6.52 Chan. 54 62 102 110 134 142 142 Freq.
(MHz) 5270 5310 5510 5550 5670 5710
(For U-NII-2C) 5710
(For U-NII-3) 802.11ac (VHT80) Chan. 58 106 122 138 138 Freq.
(MHz) 5290 5530 5610 5690
(For U-NII-2C) 5690
(For U-NII-3) Report No.: RF181023C12A Reference No.: 181023C11 Page No. 64 / 84 Report Format Version:6.1.2 802.11a Spectrum Plot of Worst Value 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) Report No.: RF181023C12A Reference No.: 181023C11 Page No. 65 / 84 Report Format Version:6.1.2 EUT Maximum Conducted Power CDD Mode 802.11a Frequency Band (MHz) 5250~5350 5470~5725 802.11ac (VHT20) Frequency Band (MHz) 5250~5350 5470~5725 802.11ac (VHT40) Frequency Band (MHz) 5250~5350 5470~5725 802.11ac (VHT80) Frequency Band (MHz) Max. Power Output Power (mW) Output Power (dBm) 216.915 215.582 23.36 23.34 Max. Power Output Power (mW) Output Power (dBm) 217.576 215.895 23.38 23.34 Max. Power Output Power (mW) Output Power (dBm) 231.217 210.353 23.64 23.23 Max. Power Output Power (mW) Output Power (dBm) 5250~5350 5470~5725 146.038 189.861 21.64 22.78 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 66 / 84 Report Format Version:6.1.2 Beamforming Mode 802.11ac (VHT20) Frequency Band (MHz) 5250~5350 5470~5725 802.11ac (VHT40) Frequency Band (MHz) 5250~5350 5470~5725 802.11ac (VHT80) Frequency Band (MHz) 5250~5350 5470~5725 Max. Power Output Power (mW) Output Power (dBm) 217.576 215.895 23.38 23.34 Max. Power Output Power (mW) Output Power (dBm) 231.217 210.353 23.64 23.23 Max. Power Output Power (mW) Output Power (dBm) 146.038 189.861 21.64 22.78 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 67 / 84 Report Format Version:6.1.2 EUT Attenuator Spectrum Analyzer 4.4 Occupied Bandwidth Measurement 4.4.1 Test Setup 4.4.2 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.4.3 Test Procedure The transmitter output was connected to the spectrum analyzer through an attenuator. The bandwidth of the fundamental frequency was measured by spectrum analyzer with resolution bandwidth in the range of 1% to 5% of the anticipated emission bandwidth, and a video bandwidth at least 3x the resolution bandwidth and set the detector to sampling. The width of a frequency band such that, below the lower and above the upper frequency limits, the mean powers emitted are each equal to a specified percentage 0.5 %of the total mean power of a given emission. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 68 / 84 Report Format Version:6.1.2 4.4.4 Test Result 802.11a Channel Frequency (MHz) 52 60 64 100 116 140 144 144 802.11ac (VHT20) 5260 5300 5320 5500 5580 5700 5720 For U-NII-2C 5720 For U-NII-3 Channel Frequency (MHz) 52 60 64 100 116 140 144 144 802.11ac (VHT40) 5260 5300 5320 5500 5580 5700 5720 For U-NII-2C 5720 For U-NII-3 Channel Frequency (MHz) 54 62 102 110 134 142 142 5270 5310 5510 5550 5670 5710 For U-NII-2C 5710 For U-NII-3 Occupied Bandwidth (MHz) Chain 2 Chain 1 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 13.28 3.16 13.28 3.16 Occupied Bandwidth (MHz) Chain 2 Chain 1 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 17.64 13.88 3.76 13.88 3.76 Occupied Bandwidth (MHz) Chain 2 Chain 1 36.00 36.00 36.00 36.00 36.12 36.00 36.00 36.12 36.12 36.00 33.00 3.00 33.00 3.00 Chain 0 17.64 17.64 17.64 17.64 17.64 17.64 13.28 3.16 Chain 0 17.64 17.64 17.64 17.64 17.64 17.64 13.88 3.76 Chain 0 36.00 36.12 36.00 36.12 36.00 33.00 3.00 Chain 3 17.64 17.64 17.64 17.64 17.64 17.64 13.28 3.16 Chain 3 17.64 17.64 17.64 17.64 17.64 17.64 13.88 3.76 Chain 3 36.00 36.00 36.00 36.00 36.00 33.00 3.00 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 69 / 84 Report Format Version:6.1.2 802.11ac (VHT80) Channel Frequency (MHz) 5290 5530 5610 5690 For U-NII-2C 5690 For U-NII-3 Chain 0 75.84 75.84 75.84 75.84 72.92 Occupied Bandwidth (MHz) Chain 2 Chain 1 75.84 76.08 75.84 75.84 75.84 75.84 75.84 72.92 75.84 72.92 Chain 3 75.84 75.84 75.84 75.84 72.92 58 106 122 138 138 802.11a Spectrum Plot of Worst Value 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) Report No.: RF181023C12A Reference No.: 181023C11 Page No. 70 / 84 Report Format Version:6.1.2 4.5 Peak Power Spectral Density Measurement 4.5.1 Limits of Peak Power Spectral Density Measurement Operation Band U-NII-1 U-NII-2A U-NII-2C U-NII-3 EUT Category Outdoor Access Point Limit Fixed point-to-point Access Point 17dBm/ MHz Indoor Access Point Mobile and Portable client device 11dBm/ MHz 11dBm/ MHz 11dBm/ MHz 30dBm/ 500kHz EUT Attenuator Spectrum Analyzer 4.5.2 Test Setup 4.5.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.5.4 Test Procedures For U-NII-2A and U-NII-2C band:
Using method SA-2 a. Set span to encompass the entire emission bandwidth (EBW) of the signal. b. Set RBW = 1MHz, Set VBW 3 MHz, Detector = RMS c. Set Channel power measure = 1MHz d. Sweep time = auto, trigger set to free run. e. Trace average at least 100 traces in power averaging mode. f. Record the max value and add 10 log (1/duty cycle) For U-NII-3 band:
a. Set span to encompass the entire emission bandwidth (EBW) of the signal. b. Set RBW = 300 kHz, Set VBW 1 MHz, Detector = RMS c. Use the peak marker function to determine the maximum power level in any 300 kHz band segment within the fundamental EBW. d. Scale the observed power level to an equivalent value in 500 kHz by adjusting (reducing) the measured power by a bandwidth correction factor (BWCF) where BWCF = 10log(500 kHz / 300 kHz) Trace average at least 100 traces in power averaging mode. e. Sweep time = auto, trigger set to free run. f. g. Record the max value and add 10 log (1/duty cycle) Report No.: RF181023C12A Reference No.: 181023C11 Page No. 71 / 84 Report Format Version:6.1.2 4.5.5 Deviation from Test Standard No deviation. 4.5.6 EUT Operating Conditions Same as 4.3.6. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 72 / 84 Report Format Version:6.1.2 4.5.7 Test Results For U-NII-2A and U-NII-2C band:
802.11a Chan. Freq.
(MHz) PSD w/o Duty Factor (dBm/MHz) Chain 0 Chain 1 Chain 2 Chain 3 Duty Factor
(dB) Total PSD with Duty Factor
(dBm/MHz) 52 60 64 100 116 140 5260 5300 5320 5500 5580 5700 4.19 4.17 1.43 4.34 4.22 4.23 4.23 4.51 1.89 4.28 3.96 4.45 4.07 4.41 1.84 3.82 4.04 4.43 4.28 4.58 1.97 4.50 4.31 4.42 0.17 0.17 0.17 0.17 0.17 0.17 10.38 10.61 7.98 10.43 10.33 10.57 Pass /
Fail Max. Limit
(dBm/
MHz) 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass 5720 144 Note:
1. Method 1 of power density measurement of KDB 662911 is using for calculating total power density. Total 10.67 4.38 4.49 4.47 4.56 0.17 power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. 5260~5320MHz: Directional gain = 5.48dBi < 6dBi, so the power density limit no need to reduced. 5500~5720MHz: Directional gain = 5.11dBi < 6dBi, so the power density limit no need to reduced. 3. Refer to section 3.3 for duty cycle spectrum plot. 802.11ac (VHT20) Chan. Freq.
(MHz) PSD w/o Duty Factor (dBm/MHz) Chain 0 Chain 1 Chain 2 Chain 3 Total PSD
(dBm/MHz) 52 60 64 100 116 140 5260 5300 5320 5500 5580 5700 3.62 3.63 1.54 3.71 3.26 3.68 3.37 3.56 1.65 3.99 3.66 3.75 3.76 4.00 2.18 3.39 3.66 3.72 4.23 4.65 2.11 3.59 3.58 3.95 9.78 10.00 7.90 9.70 9.56 9.80 Max. Limit
(dBm/
MHz) 11.00 11.00 11.00 11.00 11.00 11.00 Pass /
Fail Pass Pass Pass Pass Pass Pass 5720 144 Note:
1. Method 1 of power density measurement of KDB 662911 is using for calculating total power density. Total 3.81 3.78 3.99 9.87 3.80 11.00 Pass power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. 5260~5320MHz: Directional gain = 5.48dBi < 6dBi, so the power density limit no need to reduced. 5500~5720MHz: Directional gain = 5.11dBi < 6dBi, so the power density limit no need to reduced. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 73 / 84 Report Format Version:6.1.2 802.11ac (VHT40) Chan. Freq.
(MHz) 54 62 102 110 134 5270 5310 5510 5550 5670 PSD w/o Duty Factor (dBm/MHz) Chain 0 Chain 1 Chain 2 Chain 3 Duty Factor
(dB) Total PSD with Duty Factor
(dBm/MHz) 0.97 1.12 0.71 0.90 1.46 0.92 0.92 0.66 0.77 0.89 1.27 1.39 1.11 1.44 1.62 1.36 1.68 1.17 1.00 1.47 0.17 0.17 0.17 0.17 0.17 7.32 7.48 7.11 7.23 7.56 5710 142 Note:
1. Method 1 of power density measurement of KDB 662911 is using for calculating total power density. Total 1.39 1.20 1.60 1.37 7.58 0.17 power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. 5260~5320MHz: Directional gain = 5.48dBi < 6dBi, so the power density limit no need to reduced. 5500~5720MHz: Directional gain = 5.11dBi < 6dBi, so the power density limit no need to reduced. 3. Refer to section 3.3 for duty cycle spectrum plot. 802.11ac (VHT80) Chan. 58 106 122 Freq.
(MHz) 5290 5530 5610 PSD w/o Duty Factor (dBm/MHz) Chain 0 Chain 1 Chain 2 Chain 3 Duty Factor
(dB) Total PSD with Duty Factor
(dBm/MHz)
-4.53
-3.43
-2.75
-4.24
-3.58
-3.34
-4.14
-3.21
-2.33
-4.37
-3.43
-2.59 0.24 0.24 0.24 1.94 2.85 3.52 5690 138 Note:
1. Method 1 of power density measurement of KDB 662911 is using for calculating total power density. Total
-2.28
-1.93
-2.07
-1.87 4.23 0.24 power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. 5260~5320MHz: Directional gain = 5.48dBi < 6dBi, so the power density limit no need to reduced. 5500~5720MHz: Directional gain = 5.11dBi < 6dBi, so the power density limit no need to reduced. 3. Refer to section 3.3 for duty cycle spectrum plot. Pass /
Fail Max. Limit
(dBm/
MHz) 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass Pass /
Fail Max. Limit
(dBm/
MHz) 11.00 Pass 11.00 Pass 11.00 Pass 11.00 Pass Report No.: RF181023C12A Reference No.: 181023C11 Page No. 74 / 84 Report Format Version:6.1.2 802.11a / Chain 3 / CH 60 802.11ac (VHT20) / Chain 3 / CH 60 Spectrum Plot of Worst Value 802.11ac (VHT40) / Chain 3 / CH 62 802.11ac (VHT80) / Chain 0 / 138 Report No.: RF181023C12A Reference No.: 181023C11 Page No. 75 / 84 Report Format Version:6.1.2 For U-NII-3 band:
802.11a TX chain Chan. Freq.
(MHz) 5720 0 144 1 2 3 144 144 144 5720 5720 5720 PSD w/o Duty Factor
(dBm/300kHz) (dBm/500kHz)
-3.95
-4.11
-3.91
-3.90
-1.73
-1.89
-1.69
-1.68 10 log
(N=4) dB 6.02 Duty Factor
(dB) 0.17 6.02 6.02 6.02 0.17 0.17 0.17 Total PSD with Duty Factor
(dBm/500kHz) 4.46 4.30 4.50 4.51 Note:
1. Directional gain = 5.14dBi < 6dBi, so the power density limit no need to reduced. 2. Refer to section 3.3 for duty cycle spectrum plot. 802.11ac (VHT20) TX chain Chan. Freq.
(MHz) 5720 0 10 log
(N=4) dB 6.02 PSD w/o Duty Factor
(dBm/300kHz)
(dBm/500kHz) Total PSD
-4.59
-2.37 3.65 144
(dBm/500kHz) Limit
(dBm/500 kHz) 30.00 30.00 30.00 30.00 Limit
(dBm/500k Hz) 30.00 1 2 3 144 144 144 5720 5720 5720
-4.76
-4.22
-4.48
-2.54
-2.00
-2.26 6.02 6.02 6.02 3.48 4.02 3.76 30.00 30.00 30.00 Note:
1. Directional gain = 5.14dBi < 6dBi, so the power density limit no need to reduced. 802.11ac (VHT40) chain Chan. Freq. TX
(MHz) 0 5710
(dBm/300kHz) (dBm/500kHz) Duty Factor
(dB) 0.17 10 log
(N=4) dB 6.02 PSD w/o Duty Factor
-8.80
-6.58 Total PSD with Duty Factor
(dBm/500kHz)
-0.39 142 Limit
(dBm/500 kHz) 30.00 1 2 3 142 142 142 5710 5710 5710
-8.48
-9.14
-9.00
-6.26
-6.92
-6.78 6.02 6.02 6.02 0.17 0.17 0.17
-0.07
-0.73
-0.59 30.00 30.00 30.00 Note:
1. Directional gain = 5.14dBi < 6dBi, so the power density limit no need to reduced. 2. Refer to section 3.3 for duty cycle spectrum plot. Pass
/ Fail Pass Pass Pass Pass Pass /
Fail Pass Pass Pass Pass Pass
/ Fail Pass Pass Pass Pass Report No.: RF181023C12A Reference No.: 181023C11 Page No. 76 / 84 Report Format Version:6.1.2 802.11ac (VHT80) chain Chan. Freq. TX
(MHz) 0 5690 138 1 2 3 138 138 138 5690 5690 5690 PSD w/o Duty Factor
(dBm/300kHz) (dBm/500kHz)
-11.58
-11.87
-12.02
-11.96
-9.36
-9.65
-9.80
-9.74 10 log
(N=4) dB 6.02 Duty Factor
(dB) 0.24 6.02 6.02 6.02 0.24 0.24 0.24 Total PSD with Duty Factor
(dBm/500kHz)
-3.10
-3.39
-3.54
-3.48 Limit
(dBm/500 kHz) 30.00 30.00 30.00 30.00 Pass
/ Fail Pass Pass Pass Pass Note:
1. Directional gain = 5.14dBi < 6dBi, so the power density limit no need to reduced. 2. Refer to section 3.3 for duty cycle spectrum plot. 802.11a 802.11ac (VHT20) Spectrum Plot of Worst Value 802.11ac (VHT40) 802.11ac (VHT80) Report No.: RF181023C12A Reference No.: 181023C11 Page No. 77 / 84 Report Format Version:6.1.2 Spectrum Analyzer 4.6 Frequency Stability 4.6.1 Limits of Frequency Stability Measurement The frequency of the carrier signal shall be maintained within band of operation 4.6.2 Test Setup 4.6.3 Test Instruments Temperature Chamber AC Power Supply FSP40 Cal. Date Serial No. Model No. Description &
Manufacturer Spectrum Analyzer ROHDE & SCHWARZ WIT Standard Temperature And Humidity Chamber Digital Multimeter Fluke AC Power Supply Extech Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are traceable Jun. 29, 2018 Jun. 28, 2019 Jun. 04, 2018 Jun. 03, 2019 Jun. 11, 2018 Jun. 10, 2019 70360742 W981030 CFW-105 E000603 TH-4S-C Cal. Due 100039 87-III NA NA to NML/ROC and NIST/USA. 4.6.4 Test Procedure a. The EUT was placed inside the environmental test chamber and powered by nominal AC voltage. b. Turn the EUT on and couple its output to a spectrum analyzer. c. Turn the EUT off and set the chamber to the highest temperature specified. d. Allow sufficient time (approximately 30 min) for the temperature of the chamber to stabilize, turn the EUT on and measure the operating frequency after 2, 5, and 10 minutes. e. Repeat step 2 and 3 with the temperature chamber set to the lowest temperature. f. The test chamber was allowed to stabilize at +20 degree C for a minimum of 30 minutes. The supply voltage was then adjusted on the EUT from 85% to 115% and the frequency record. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 78 / 84 Report Format Version:6.1.2 4.6.5 Deviation from Test Standard No deviation. 4.6.6 EUT Operating Condition Set the EUT transmit at un-modulation mode to test frequency stability. 4.6.7 Test Results Frequency Stability Versus Temp. Operating Frequency: 5260MHz Temp.
() Power Supply
(Vac) 120 120 120 120 120 120 45 40 30 20 10 0 Temp.
() Power Supply
(Vac) 138 120 102 20 0 Minute 2 Minute 5 Minute 10 Minute Measured Frequency
(MHz) 5259.9798 5259.9933 5259.9749 5260.0096 5259.9818 5259.9804 Result Pass Pass Pass Pass Pass Pass Measured Frequency
(MHz) 5259.9794 5259.9885 5259.9743 5260.0074 5259.9816 5259.9830 Result Pass Pass Pass Pass Pass Pass Measured Frequency
(MHz) 5259.9828 5259.9903 5259.9779 5260.0100 5259.982 5259.9806 Result Pass Pass Pass Pass Pass Pass Measured Frequency
(MHz) 5259.9804 5259.9908 5259.9731 5260.0059 5259.9798 5259.9822 Result Pass Pass Pass Pass Pass Pass Frequency Stability Versus Voltage Operating Frequency: 5260MHz 0 Minute 2 Minute 5 Minute 10 Minute Measured Frequency
(MHz) 5260.0091 5260.0096 5260.0088 Result Pass Pass Pass Measured Frequency
(MHz) 5260.0077 5260.0074 5260.0081 Result Pass Pass Pass Measured Frequency
(MHz) 5260.0095 5260.0100 5260.0101 Result Pass Pass Pass Measured Frequency
(MHz) 5260.0059 5260.0059 5260.0055 Result Pass Pass Pass Report No.: RF181023C12A Reference No.: 181023C11 Page No. 79 / 84 Report Format Version:6.1.2 EUT 6dB Bandwidth Measurement 4.7 4.7.1 Limits of 6dB Bandwidth Measurement The minimum of 6dB Bandwidth Measurement is 0.5MHz. 4.7.2 Test Setup 4.7.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.7.4 Test Procedure a. Set resolution bandwidth (RBW) = 100kHz b. Set the video bandwidth (VBW) 3 x RBW, Detector = Peak. c. Trace mode = max hold. d. Sweep = auto couple. e. Measure the maximum width of the emission that is constrained by the frequencies associated with the Spectrum Analyzer Attenuator two amplitude points (upper and lower) that are attenuated by 6 dB relative to the maximum level measured in the fundamental emission 4.7.5 Deviation from Test Standard No deviation. 4.7.6 EUT Operating Condition The software provided by client to enable the EUT under transmission condition continuously at lowest, middle and highest channel frequencies individually. Report No.: RF181023C12A Reference No.: 181023C11 Page No. 80 / 84 Report Format Version:6.1.2 4.7.7 Test Results 802.11a Channel 144 802.11ac (VHT20) Channel 144 802.11ac (VHT40) Channel 142 802.11ac (VHT80) Channel 138 Frequency
(MHz) 5720
(For U-NII-3) Frequency
(MHz) 5720
(For U-NII-3) Frequency
(MHz) 5710
(For U-NII-2C) Frequency
(MHz) 5690
(For U-NII-2C) 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 Minimum Limit
(MHz) Pass /
Fail 3.15 3.16 3.16 2.89 0.5 Pass 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 Minimum Limit
(MHz) Pass /
Fail 3.50 3.37 3.78 3.76 0.5 Pass 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 Minimum Limit
(MHz) Pass /
Fail 2.57 2.58 2.60 2.55 0.5 Pass 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 Minimum Limit
(MHz) Pass /
Fail 2.97 3.04 3.20 3.20 0.5 Pass Report No.: RF181023C12A Reference No.: 181023C11 Page No. 81 / 84 Report Format Version:6.1.2 802.11a Spectrum Plot of Worst Value 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) Note:
For CH144 (UNII-3 Band): The 6dB bandwidth above 5725MHz = Marker 1 + Delta 2 - 5725MHz For CH142 (UNII-3 Band): The 6dB bandwidth above 5725MHz = Marker 1 + Delta 2 - 5725MHz For CH138 (UNII-3 Band): The 6dB bandwidth above 5725MHz = Marker 1 + Delta 2 - 5725MHz Report No.: RF181023C12A Reference No.: 181023C11 Page No. 82 / 84 Report Format Version:6.1.2 Pictures of Test Arrangements 5 Please refer to the attached file (Test Setup Photo). Report No.: RF181023C12A Reference No.: 181023C11 Page No. 83 / 84 Report Format Version:6.1.2 Appendix Information on the Testing Laboratories We, Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, were founded in 1988 to provide our best service in EMC, Radio, Telecom and Safety consultation. Our laboratories are FCC recognized accredited test firms and accredited and approved according to ISO/IEC 17025. If you have any comments, please feel free to contact us at the following:
Linko EMC/RF Lab Tel: 886-2-26052180 Fax: 886-2-26051924 Hwa Ya EMC/RF/Safety Tel: 886-3-3183232 Fax: 886-3-3270892 Email: service.adt@tw.bureauveritas.com Web Site: www.bureauveritas-adt.com Hsin Chu EMC/RF/Telecom Lab Tel: 886-3-6668565 Fax: 886-3-6668323 The address and road map of all our labs can be found in our web site also.
--- END ---
Report No.: RF181023C12A Reference No.: 181023C11 Page No. 84 / 84 Report Format Version:6.1.2
1 2 3 | Power of Attorney | Cover Letter(s) | 139.52 KiB | / December 02 2019 |
Netgear Incorporated 350 East Plumeria Drive, San Jose, CA 95134, USA Tel:408-890-3657/Fax:408-907-8097 Date: 1/3/2019 FCC ID: PY318300422 AUTHORIZATION LETTER To Whom It May Concern:
We, Netgear Incorporated hereby authorizes Amanda Wu / Senior Specialist of Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch (BV CPS Taoyuan), to act on its behalf in all matters relating to the Federal Communication Commission
(FCC) application for equipment authorization in connection with the FCC ID listed above, including signing of all documents relating to these matters. Any and all acts carried out by Amanda Wu / Senior Specialist of BV CPS Taoyuan on Netgear Incorporateds behalf, within the scope of the powers granted herein, shall have the same effect as acts of its own. If you have any questions regarding the authorization, please dont hesitate to contact us. Thank you!
Sincerely yours,
------------------------------------------------------
David Kay / Regulatory Compliance Director Netgear Incorporated TEL: 4088903657 FAX: 4089078097 E-mail: david.kay@netgear.com
1 2 3 | Project and Product Certification Representative Authorization Letter | Cover Letter(s) | 302.61 KiB | / December 02 2019 |
Tel: 408-526-1188 Fax: 408-526-1088 Email: TCB@siemic.com 775 Montague Expressway Milpitas, CA 95035 Project and Product Certification Representative Authorization Letter Reason for Amendment (current / obsolete) Initial Release (obsolete) Revised wording (obsolete) Updated company template (obsolete) Updated letter information (obsolete) Added FCC ID field (current) Revision History From 1.0 1.0 2.0 3.0 4.0 To 1.0 2.0 3.0 4.0 5.0 Approved Date Nov-14-2006 Sept25-2007 Jan-31-2012 May-23-2014 Sept 16 2014 SCS-F18: Project and Product Certification Representative Authorization Letter Page 1 of 2 Rev 5.0 Netgear Incorporated 350 East Plumeria Drive, San Jose, CA 95134, USA Tel:408-890-3657/Fax:408-907-8097 Date: 1/3/2019 To: SIEMIC, INC. 775 Montague Expressway, Milpitas, CA 95035 USA Dear Sir/Madam, Re: Product Certification Representative Authorization Letter We, ____Netgear Incorporated_____hereby authorize SIEMIC, Inc. to act as a Certification Body for certifying for the following project(s):
(Product description: Nighthawk X4 AC2200 WiFi Mesh Extender / Model name: EX7300v2 Product description: AC1900 WiFi Mesh Extender / Model name: EX6400v2) FCC ID: PY318300422 Sincerely,
-----------------------------------------------------------
David Kay / Regulatory Compliance Director NETGEAR, INC. TEL: 4088903657 FAX: 4089078097 E-mail: david.kay@netgear.com SCS-F18: Project and Product Certification Representative Authorization Letter Page 2 of 2 Rev 5.0
1 2 3 | Test Setup Photo | Test Setup Photos | 261.07 KiB | / November 08 2019 |
PHOTOGRAPHS OF THE TEST CONFIGURATION Radiated Emission Test below 1GHz Z-plane Report No.: 181023C12A Reference No.: 181023C11 Page No. 1 / 4 Radiated Emission Test above 1GHz Z-plane Report No.: 181023C12A Reference No.: 181023C11 Page No. 2 / 4 Conducted Emission Test Report No.: 181023C12A Reference No.: 181023C11 Page No. 3 / 4 Test results demonstrating Master links with Client on a test frequency. For Master DFS Receiver Antenna to S.A. Radar (Radiated) EUT Client For Extender_Client Receiver Antenna to S.A. Radar (Radiated) Master EUT Report No.: 181023C12A Reference No.: 181023C11 Page No. 4 / 4
1 2 3 | LTC/STC Letter | Cover Letter(s) | 307.02 KiB | January 20 2019 |
775 Montague Expressway Milpitas, CA 95035 Tel: 408-526-1188 Fax: 408-526-1088 Email: TCB@siemic.com Confidentiality Request Letter Reason for Amendment (current / obsolete) Initial Release (obsolete) Adding CFR 2.459 (obsolete) Updated company template & Added text box
(obsolete) Added IC confidentiality letter form (obsolete) Corrections to STC form. Added reference to KDB
(current) Revision History From 1.0 1.0 2.0 3.0 4.0 To 1.0 2.0 3.0 4.0 5.0 Approved Date Nov-14-2006 August 11 - 2008 Jan-31-2012 March-26-2015 Nov 19 2015 SCS-F19: Confidentiality Request Letter Page 1 of 3 Rev 5.0 Netgear Incorporated 350 East Plumeria Drive, San Jose, CA 95134, USA Tel:408-890-3657/Fax:408-907-8097 Date: 1/3/2019 To:
Federal Communications Commission Authorization and Evaluation Division 7435 Oakland Mills Road Columbia, MD Subject: Permanent Confidentiality Request for FCC ID: PY318300422 Pursuant to sections 0.457 and 0.459 of CFR 47, we respectfully request permanent confidential treatment of the following Exhibits accompanying this application as:
-
-
-
-
-
e.g. Block Diagram e.g. Schematics e.g. Operational Description e.g. Software Operational Description e.g. Operating Description-Antenna Spec. The above materials contain trade secrets and proprietary information not customarily released to the public. The public disclosure of these materials may be harmful to the applicant and provide unjustified benefits to its competitors. The applicant understands that disclosure of this application and all accompanying documentation will not be made before the date of the Grant for this application. Sincerely,
----------------------------------------------------------------
David Kay / Regulatory Compliance Director Netgear Incorporated TEL: 4088903657 FAX: 4089078097 E-mail: david.kay@netgear.com SCS-F19: Confidentiality Request Letter Page 2 of 3 Rev 5.0 Netgear Incorporated 350 East Plumeria Drive, San Jose, CA 95134, USA Tel:408-890-3657/Fax:408-907-8097 Date: 1/3/2019 To: Federal Communications Commission Office of Engineering and Technology Equipment Authorization Division 7345 Oakland Mills Road Columbia, Maryland 21046 Subject: Short Term Confidentiality Request for FCC ID: PY318300422 To Whom It May Concern:
Pursuant to sections 0.457 and 0.459 of CFR 47, and to avoid premature release of sensitive information prior to marketing or release of the product to the public, the applicant requests the following documents contained in this certification application be temporarily withheld from public disclosure for an initial period of 45 days; or for a specified date of not to exceed 180 days from the Grant Date. See KDB 726920.. or 180
/
/
- e.g. External Photos
- e.g. Internal Photos etc.
- e.g. Test Setup photos
- e.g. User Manual The above materials contain trade secrets and proprietary information not customarily released to the public. The public disclosure of these materials may be harmful to the applicant and provide unjustified benefits to its competitors. Sincerely,
----------------------------------------------------------------
David Kay / Regulatory Compliance Director Netgear Incorporated TEL: 4088903657 FAX: 4089078097 E-mail: david.kay@netgear.com SCS-F19: Confidentiality Request Letter Page 3 of 3 Rev 5.0
1 2 3 | MPE Report | RF Exposure Info | 60.30 KiB | January 20 2019 |
RF Exposure Report Report No.: SA181023C12 FCC ID: PY318300422 Model: EX7300v2 Series Model: EX6400v2 Received Date: Oct. 23, 2018 Test Date: Oct. 31 ~ Dec. 18, 2018 Issued Date: Dec. 18, 2018 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan, R.O.C. Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth our findings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product unless specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies. Report No.: SA181023C12 Page No. 1 / 6 Report Format Version: 6.1.1 Table of Contents Release Control Record .................................................................................................................................. 3 1 Certificate of Conformity ...................................................................................................................... 4 RF Exposure .......................................................................................................................................... 5 2 2.1 Limits for Maximum Permissible Exposure (MPE) .............................................................................. 5 2.2 MPE Calculation Formula ................................................................................................................... 5 2.3 Classification ....................................................................................................................................... 5 Calculation Result of Maximum Conducted Power ........................................................................... 6 3 Report No.: SA181023C12 Page No. 2 / 6 Report Format Version: 6.1.1 Release Control Record Issue No. SA181023C12 Description Original release. Date Issued Dec. 18, 2018 Report No.: SA181023C12 Page No. 3 / 6 Report Format Version: 6.1.1 1 Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender, AC1900 WiFi Mesh Extender Brand: NETGEAR Model: EX7300v2 Series Model: EX6400v2 Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Oct. 31 ~ Dec. 18, 2018 Standards: FCC Part 2 (Section 2.1091) KDB 447498 D01 General RF Exposure Guidance v06 IEEE C95.1-1992 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Dec. 18, 2018 Approved by :
, Date:
Dec. 18, 2018 Bruce Chen / Project Engineer Report No.: SA181023C12 Page No. 4 / 6 Report Format Version: 6.1.1 2 RF Exposure 2.1 Limits for Maximum Permissible Exposure (MPE) Frequency Range
(MHz) Electric Field Strength (V/m) Magnetic Field Strength (A/m)
(mW/cm2) Limits For General Population / Uncontrolled Exposure Power Density Average Time
(minutes) 300-1500 1500-100,000 F/1500 1.0 30 30 F = Frequency in MHz 2.2 MPE Calculation Formula Pd = (Pout*G) / (4*pi*r2) where Pd = power density in mW/cm2 Pout = output power to antenna in mW G = gain of antenna in linear scale pi = 3.1416 r = distance between observation point and center of the radiator in cm 2.3 Classification The antenna of this product, under normal use condition, is at least 21cm away from the body of the user. So, this device is classified as Mobile Device. Report No.: SA181023C12 Page No. 5 / 6 Report Format Version: 6.1.1 3 Calculation Result of Maximum Conducted Power Frequency Band Antenna Gain Max Power
(MHz)
(dBm)
(dBi) Distance
(cm) Power Density
(mW/cm2) Limit
(mW/cm2) 1 1 1 1 1 1 2412-2462 5180-5240 5745-5825 5180-5240 5745-5825 26.19 29.32 29.35 29.05 29.29 Model: EX7300v2 CDD Mode:
7.60 5.49 5.14 21 21 21 Beamforming Mode 5.49 21 5.14 21 Model: EX6400v2 CDD Mode:
0.432 0.546 0.507 0.513 0.500 2412-2462 24.88 6.07 21 0.225 Note:
Model: EX7300v2 CDD Mode:
2412 ~ 2462MHz: 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/4]= 7.60dBi 5180 ~ 5240MHz: Directional gain = 5.49dBi 5745 ~ 5825MHz: Directional gain = 5.14dBi Beamforming Mode:
5180 ~ 5240MHz: Directional gain = 5.49dBi 5745 ~ 5825MHz: Directional gain = 5.14dBi Model: EX6400v2 CDD Mode:
2412 ~ 2462MHz: 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/3]= 6.07dBi Conclusion:
The formula of calculated the MPE is:
CPD1 / LPD1 + CPD2 / LPD2 + etc. < 1 CPD = Calculation power density LPD = Limit of power density 2.4G + 5G = 0.432 / 1 + 0.546 / 1 = 0.978 Therefore the maximum calculations of above situations are less than the 1 limit.
---END---
Report No.: SA181023C12 Page No. 6 / 6 Report Format Version: 6.1.1
1 2 3 | RF Test Report | Test Report | 2.76 MiB | January 20 2019 |
FCC Test Report Report No.: RF181023C12 FCC ID: PY318300422 Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Received Date: Oct. 23, 2018 Test Date: Oct. 31 ~ Dec. 11, 2018 Issued Date: Dec. 18, 2018 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan, R.O.C. Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth our findings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product unless specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies Report No.: RF181023C12 Page No. 1 / 66 Report Format Version: 6.1.1 Table of Contents 4 3 Release Control Record .................................................................................................................................. 4 1 Certificate of Conformity ...................................................................................................................... 5 Summary of Test Results ..................................................................................................................... 6 2 2.1 Measurement Uncertainty ................................................................................................................... 6 2.2 Modification Record ............................................................................................................................ 6 General Information .............................................................................................................................. 7 3.1 General Description of EUT ................................................................................................................ 7 3.2 Description of Test Modes ................................................................................................................... 9 3.2.1 Test Mode Applicability and Tested Channel Detail ........................................................................... 10 3.3 Duty Cycle of Test Signal .................................................................................................................. 12 3.4 Description of Support Units ............................................................................................................. 13 3.4.1 Configuration of System under Test .................................................................................................. 13 3.5 General Description of Applied Standards ........................................................................................ 13 Test Types and Results ...................................................................................................................... 14 4.1 Radiated Emission and Bandedge Measurement ............................................................................. 14 4.1.1 Limits of Radiated Emission and Bandedge Measurement .............................................................. 14 4.1.2 Test Instruments ................................................................................................................................ 15 4.1.3 Test Procedures ................................................................................................................................. 16 4.1.4 Deviation from Test Standard ............................................................................................................ 17 4.1.5 Test Set Up ........................................................................................................................................ 17 4.1.6 EUT Operating Conditions ................................................................................................................. 18 4.1.7 Test Results ....................................................................................................................................... 19 4.2 Conducted Emission Measurement .................................................................................................. 33 4.2.1 Limits of Conducted Emission Measurement .................................................................................... 33 4.2.2 Test Instruments ................................................................................................................................ 33 4.2.3 Test Procedures ................................................................................................................................. 34 4.2.4 Deviation from Test Standard ............................................................................................................ 34 4.2.5 Test Setup .......................................................................................................................................... 34 4.2.6 EUT Operating Conditions ................................................................................................................. 34 4.2.7 Test Results ....................................................................................................................................... 35 4.3 6dB Bandwidth Measurement ........................................................................................................... 37 4.3.1 Limits of 6dB Bandwidth Measurement ............................................................................................. 37 4.3.2 Test Setup .......................................................................................................................................... 37 4.3.3 Test Instruments ................................................................................................................................ 37 4.3.4 Test Procedure .................................................................................................................................. 37 4.3.5 Deviation fromTest Standard ............................................................................................................. 37 4.3.6 EUT Operating Conditions ................................................................................................................. 37 4.3.7 Test Result ......................................................................................................................................... 38 4.4 Conducted Output Power Measurement ........................................................................................... 40 4.4.1 Limits of Conducted Output Power Measurement ............................................................................ 40 4.4.2 Test Setup .......................................................................................................................................... 40 4.4.3 Test Instruments ................................................................................................................................ 40 4.4.4 Test Procedures ................................................................................................................................. 40 4.4.5 Deviation from Test Standard ............................................................................................................ 40 4.4.6 EUT Operating Conditions ................................................................................................................. 40 4.4.7 Test Results ....................................................................................................................................... 41 4.5 Power Spectral Density Measurement .............................................................................................. 43 4.5.1 Limits of Power Spectral Density Measurement ............................................................................... 43 4.5.2 Test Setup .......................................................................................................................................... 43 4.5.3 Test Instruments ................................................................................................................................ 43 4.5.4 Test Procedure .................................................................................................................................. 43 4.5.5 Deviation from Test Standard ............................................................................................................ 43 4.5.6 EUT Operating Condition .................................................................................................................. 43 Report No.: RF181023C12 Page No. 2 / 66 Report Format Version: 6.1.1 4.5.7 Test Results ....................................................................................................................................... 44 4.6 Conducted Out of Band Emission Measurement .............................................................................. 48 4.6.1 Limits of Conducted Out of Band Emission Measurement ............................................................... 48 4.6.2 Test Setup .......................................................................................................................................... 48 4.6.3 Test Instruments ................................................................................................................................ 48 4.6.4 Test Procedure .................................................................................................................................. 48 4.6.5 Deviation from Test Standard ............................................................................................................ 48 4.6.6 EUT Operating Condition .................................................................................................................. 48 4.6.7 Test Results ....................................................................................................................................... 48 5 Pictures of Test Arrangements .......................................................................................................... 65 Appendix Information on the Testing Laboratories ................................................................................ 66 Report No.: RF181023C12 Page No. 3 / 66 Report Format Version: 6.1.1 Release Control Record Issue No. RF181023C12 Description Original release. Date Issued Dec. 18, 2018 Report No.: RF181023C12 Page No. 4 / 66 Report Format Version: 6.1.1 1 Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender (refer to item 3.1 for more details) Brand: NETGEAR Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Oct. 31 ~ Dec. 11, 2018 Standards: 47 CFR FCC Part 15, Subpart C (Section 15.247) ANSI C63.10:2013 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Dec. 18, 2018 Approved by :
, Date:
Dec. 18, 2018 Bruce Chen / Project Engineer Report No.: RF181023C12 Page No. 5 / 66 Report Format Version: 6.1.1 2 Summary of Test Results FCC Clause 47 CFR FCC Part 15, Subpart C (Section 15.247) Test Item Result Remarks 15.207 AC Power Conducted Emission Pass Radiated Emissions and Band Edge Measurement Antenna Port Emission 15.205 /
15.209 /
15.247(d) 15.247(d) 15.247(a)(2) 6dB bandwidth 15.247(b) 15.247(e) 15.203 Conducted power Power Spectral Density Antenna Requirement Pass Pass Pass Pass Pass Pass Meet the requirement of limit. Minimum passing margin is -12.02dB at 0.53672MHz. Meet the requirement of limit. Minimum passing margin is -0.1dB at 2483.50MHz. Meet the requirement of limit. Meet the requirement of limit. Meet the requirement of limit. Meet the requirement of limit. No antenna connector is used. 2.1 Measurement Uncertainty Where relevant, the following measurement uncertainty levels have been estimated for tests performed on the EUT as specified in CISPR 16-4-2:
Measurement Conducted Emissions at mains ports Radiated Emissions up to 1 GHz Radiated Emissions above 1 GHz Frequency 150kHz ~ 30MHz 30MHz ~ 200MHz 200MHz ~1000MHz 1GHz ~ 18GHz 18GHz ~ 40GHz Expanded Uncertainty
(k=2) () 2.94 dB 3.63 dB 3.64 dB 2.29 dB 2.29 dB 2.2 Modification Record There were no modifications required for compliance. Report No.: RF181023C12 Page No. 6 / 66 Report Format Version: 6.1.1 3 General Information 3.1 General Description of EUT Product Brand Test Model Series Model Model Difference Sample Status Power Supply Rating Modulation Type Modulation Technology Transfer Rate Operating Frequency Number of Channel Output Power Antenna Type Antenna Connector Accessory Device Data Cable Supplied Nighthawk X4 AC2200 WiFi Mesh Extender (refer to note for more details) NETGEAR EX7300v2 EX6400v2 Refer to Note Engineering sample 100-240Vac CCK, DQPSK, DBPSK for DSSS 64QAM, 16QAM, QPSK, BPSK for OFDM DSSS, OFDM 802.11b:11/5.5/2/1Mbps 802.11g: 54/48/36/24/18/12/9/6Mbps 802.11n: up to 600Mbps 2412~2462MHz 802.11b, 802.11g, 802.11n (HT20): 13 802.11n (HT40): 9 Model: EX7300v2: 415.816mW Model: EX6400v2: 307.423mW Refer to Note Refer to Note NA NA Note:
1. All models are listed as below. Product Name Brand Model Difference NETGEAR Nighthawk X4 AC2200 WiFi Mesh Extender EX7300v2 AC1900 WiFi Mesh Extender EX6400v2 The listed models are electrically and mechanically identical. The intention of these models is only for RF output transmit antenna (EX7300v2 2.4G: 4T4R;
EX6400v2 2.4G: 3T3R) and different NETGEAR logo
(EX7300v2 has silver coating. EX6400v2 has no silver coating) purpose.
* For above two model are presented in power output test item. For other test items, model EX7300v2 is the worst case for final tests after pretesting. Report No.: RF181023C12 Page No. 7 / 66 Report Format Version: 6.1.1 2. The EUT incorporates a MIMO function. Physically, the EUT provides 4 completed transmitters and 4 receivers. Modulation Mode 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) TX Function 4TX 4TX 4TX 4TX 3TX 3TX 3TX 3TX 3. The EUT uses following antennas. Model: EX6400v2 Ant. Type Connecter Type Ant. 1 1.95 Model: EX7300v2 Ant. Type Connecter Type Ant. 1 1.95 PIFA NA Antenna Gain (dBi) Ant. 2 1.08 Directional Antenna Gain (dBi) 6.07 PIFA NA Antenna Gain (dBi) Ant. 3 Ant. 2 1.08 0.82 Directional Antenna Gain (dBi) 7.60 Model EX7300v2 EX6400v2 Ant. 3 0.82 Ant. 4 2.36 4. The worst case spurious emission of the simultaneous operation mode is listed as below and the test data please refer to BV CPS report no.: RF181023C12-2. No Mode 1 WLAN 2.4GHz: 802.11g CH 6 + WLAN 5GHz: 802.11a CH 165 Report No.: RF181023C12 Page No. 8 / 66 Report Format Version: 6.1.1 3.2 Description of Test Modes 11 channels are provided for 802.11b, 802.11g, 802.11n (HT20):
Channel 1 2 3 4 5 6 Frequency 2412 MHz 2417 MHz 2422 MHz 2427 MHz 2432 MHz 2437 MHz 7 channels are provided for 802.11n (HT40):
Channel 3 4 5 6 Frequency 2422 MHz 2427 MHz 2432 MHz 2437 MHz Channel 7 8 9 10 11 Channel 7 8 9 Frequency 2442 MHz 2447 MHz 2452 MHz 2457 MHz 2462 MHz Frequency 2442 MHz 2447 MHz 2452 MHz Report No.: RF181023C12 Page No. 9 / 66 Report Format Version: 6.1.1 3.2.1 Test Mode Applicability and Tested Channel Detail EUT Configure Applicable to Mode A B Where RE1G RE<1G
-
-
PLC
-
APCM RE1G: Radiated Emission above 1GHz & Bandedge Measurement PLC: Power Line Conducted Emission Description Model: EX7300v2 Model: EX6400v2 RE<1G: Radiated Emission below 1GHz Note:
1. The EUT had been pre-tested on the positioned of each 3 axis. The worst case was found when positioned on X-plane. 2. -: Means no effect. APCM: Antenna Port Conducted Measurement Radiated Emission Test (Above 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Mode A Mode 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) Available Channel Tested Channel Modulation Technology Modulation Type Data Rate
(Mbps) Remark 1 to 11 1 to 11 1 to 11 3 to 9 1, 6, 11 1, 6, 11 1, 6, 11 3, 6, 9 DSSS OFDM OFDM OFDM DBPSK BPSK BPSK BPSK 1.0 6.0 7.2 15.0 4TX 4TX 4TX 4TX Radiated Emission Test (Below 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Mode A Mode 802.11g Available Channel 1 to 11 Tested Channel Modulation Technology 6 OFDM Modulation Type BPSK Data Rate
(Mbps) Remark 6.0 4TX Power Line Conducted Emission Test:
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Mode A Mode 802.11g Available Channel 1 to 11 Tested Channel Modulation Technology 6 OFDM Modulation Type BPSK Data Rate
(Mbps) Remark 6.0 4TX Report No.: RF181023C12 Page No. 10 / 66 Report Format Version: 6.1.1 Antenna Port Conducted Measurement:
This item includes all test value of each mode, but only includes spectrum plot of worst value of each mode. Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. EUT Configure Mode Mode Available Channel Tested Channel Modulation Technology Modulation Type Data Rate
(Mbps) Remark A 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) 1, 6, 11 1, 6, 11 1, 6, 11 3, 6, 9 1, 6, 11 1, 6, 11 1, 6, 11 3, 6, 9
*Mode B is presented in output power test item only. 1 to 11 1 to 11 1 to 11 3 to 9 1 to 11 1 to 11 1 to 11 3 to 9 802.11n (HT20) 802.11n (HT40) 802.11b 802.11g B Test Condition:
Applicable to Environmental Conditions RE1G RE<1G PLC APCM 25deg. C, 69%RH 25deg. C, 70%RH 25deg. C, 71%RH 25deg. C, 71%RH 25deg. C, 75%RH 25deg. C, 60%RH DSSS OFDM OFDM OFDM DSSS OFDM OFDM OFDM DBPSK BPSK BPSK BPSK DBPSK BPSK BPSK BPSK 1.0 6.0 7.2 15.0 1.0 6.0 7.2 15.0 4TX 4TX 4TX 4TX 3TX 3TX 3TX 3TX Input Power 120Vac, 60Hz 120Vac, 60Hz 120Vac, 60Hz 120Vac, 60Hz Tested by Noah Chang Noah Chang Noah Chang Alan Wu Report No.: RF181023C12 Page No. 11 / 66 Report Format Version: 6.1.1 3.3 Duty Cycle of Test Signal Duty cycle of test signal is 98%, duty factor is not required. Duty cycle of test signal is < 98%, duty factor is required. 802.11b: Duty cycle = 12.180/12.240 = 0.995 802.11g: Duty cycle = 2.020/2.072 = 0.975, Duty factor = 10 * log (1/0.975) = 0.11 802.11n (HT20): Duty cycle = 1.882/1.954 = 0.963, Duty factor = 10 * log (1/0.963) = 0.16 802.11n (HT40): Duty cycle = 0.925/0.975 = 0.949, Duty factor = 10 * log (1/0.949) = 0.23 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) Report No.: RF181023C12 Page No. 12 / 66 Report Format Version: 6.1.1 3.4 Description of Support Units The EUT has been tested as an independent unit together with other necessary accessories or support units. The following support units or accessories were used to form a representative test configuration during the tests. ID A. Product Notebook Brand DELL Model No. E5410 Serial No. 1HC2XM1 FCC ID Remarks FCC DoC Approved -
Note:
1. All power cords of the above support units are non-shielded (1.8m). 2. Item A acted as a communication partner to transfer data. ID Descriptions Qty. Length (m) Shielding
(Yes/No) Cores (Qty.) Remarks 1. RJ45, Cat5e 1 6 N 0
-
(1) EUT 3.4.1 Configuration of System under Test 3.5 General Description of Applied Standards The EUT is a RF Product. According to the specifications of the manufacturer, it must comply with the requirements of the following standards:
FCC Part 15, Subpart C (15.247) KDB 558074 D01 15.247 Meas Guidance v05 KDB 662911 D01 Multiple Transmitter Output v02r01 ANSI C63.10-2013 All test items have been performed and recorded as per the above standards. Notebook (A) Remote site Report No.: RF181023C12 Page No. 13 / 66 Report Format Version: 6.1.1 Test Types and Results 4 4.1 Radiated Emission and Bandedge Measurement 4.1.1 Limits of Radiated Emission and Bandedge Measurement Radiated emissions which fall in the restricted bands must comply with the radiated emission limits specified as below table. Other emissions shall be at least 30dB below the highest level of the desired power:
Frequencies
(MHz) 0.009 ~ 0.490 0.490 ~ 1.705 1.705 ~ 30.0 30 ~ 88 88 ~ 216 216 ~ 960 Above 960 Field Strength
(microvolts/meter) 2400/F(kHz) 24000/F(kHz) 30 100 150 200 500 Measurement Distance (meters) 300 30 30 3 3 3 3 Note:
1. 2. 3. The lower limit shall apply at the transition frequencies. Emission level (dBuV/m) = 20 log Emission level (uV/m). For frequencies above 1000MHz, the field strength limits are based on average detector, however, the peak field strength of any emission shall not exceed the maximum permitted average limits, specified above by more than 20dB under any condition of modulation. Report No.: RF181023C12 Page No. 14 / 66 Report Format Version: 6.1.1 4.1.2 Test Instruments Cal. Due May 29, 2018 May 28, 2019 Sep. 25, 2018 Sep. 24, 2019 Nov. 21, 2018 Dec. 20, 2019 Dec. 13, 2017 Dec. 12, 2018 Nov. 25, 2018 Nov. 24, 2019 Dec. 01, 2017 Nov. 30, 2018 Nov. 25, 2018 Nov. 24, 2019 Jun. 14, 2018 Jun. 13, 2019 45745 ESIB7 8447D FSP40 100040 Cal. Date 9168-155 HLA 6121 Model No. VULB9168 BBHA 9170 9120D-1170 2944A10631 BBHA 9120D BBHA9170241 Serial No. 100187 Description & Manufacturer Test Receiver ROHDE & SCHWARZ Spectrum Analyzer ROHDE & SCHWARZ BILOG Antenna SCHWARZBECK HORN Antenna SCHWARZBECK HORN Antenna SCHWARZBECK Loop Antenna TESEQ Preamplifier Agilent
(Below 1GHz) Preamplifier KEYSIGHT
(Above 1GHz) RF signal cable HUBER+SUHNER RF signal cable HUBER+SUHNER Software BV ADT Antenna Tower inn-co GmbH Antenna Tower Controller BV ADT Turn Table BV ADT Turn Table Controller BV ADT Boresight Antenna Fixture USB Wideband Power Sensor KEYSIGHT Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are MY55050005/MY5519000 4/MY55190007/MY55210 SC93021703 FBA-SIP01 V7.6.15.9.5 MA 4000 SC100 FBA-01 MY53270295 Jul. 02, 2018 Jul. 17, 2018 TT93021703 AT93021703 U2021XA NA NA 83017A 010303 TT100 AT100 005 NA NA NA NA NA SUCOFLEX 104 Cable-CH4-03 (250724) Aug. 08, 2018 Aug. 07, 2019 ADT_Radiated_ SUCOFLEX 104 MY 13380+295012/04 Aug. 08, 2018 Aug. 07, 2019 NA NA NA NA NA NA Aug. 08, 2018 Aug. 07, 2019 Jul. 01, 2019 Jul. 16, 2019 traceable to NML/ROC and NIST/USA. 2. The test was performed in HwaYa Chamber 4. 3. The FCC Designation Number is TW0003. The number will be varied with the Lab location and scope as attached. 4. The IC Site Registration No. is 7450F-4. Report No.: RF181023C12 Page No. 15 / 66 Report Format Version: 6.1.1 4.1.3 Test Procedures For Radiated emission below 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters above the ground at a 3 meter chamber room. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. Parallel, perpendicular, and ground-parallel orientations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to Quasi-Peak Detect Function and Specified Bandwidth with Maximum Hold Mode. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 9kHz at frequency below 30MHz. For Radiated emission above 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters (for 30MHz ~ 1GHz) / 1.5 meters (for above 1GHz) above the ground at 3 meter chamber room for test. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. The height of antenna is varied from one meter to four meters above the ground to determine the maximum value of the field strength. Both horizontal and vertical polarizations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and then the antenna was tuned to heights from 1 meter to 4 meters and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to quasi-peak detect function and specified bandwidth with maximum f. hold mode when the test frequency is below 1 GHz. The test-receiver system was set to peak and average detect function and specified bandwidth with maximum hold mode when the test frequency is above 1 GHz. If the peak reading value also meets average limit, measurement with the average detector is unnecessary. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 120kHz for Quasi-
peak detection (QP) at frequency below 1GHz. 2. The resolution bandwidth of test receiver/spectrum analyzer is 1 MHz and the video bandwidth is 3 MHz for Peak detection (PK) at frequency above 1GHz. 3. The resolution bandwidth of test receiver/spectrum analyzer is 1 MHz and the video bandwidth is 1/T
(Duty cycle < 98%) or 10 Hz (Duty cycle 98%) for Peak detection at frequency above 1GHz. 4. All modes of operation were investigated and the worst-case emissions are reported. Report No.: RF181023C12 Page No. 16 / 66 Report Format Version: 6.1.1 4.1.4 Deviation from Test Standard No deviation. 4.1.5 Test Set Up For Radiated emission below 30MHz 1 m EUT&
Support Units 80cm 3m Turn Table Ground Plane Test Receiver For Radiated emission 30MHz to 1GHz EUT&
Support Units 80cm 3m 10m Turn Table Ant. Tower 1-4m Variable Ground Plane Test Receiver Report No.: RF181023C12 Page No. 17 / 66 Report Format Version: 6.1.1 For Radiated emission above 1GHz EUT&
Support Units 3m Ant. Tower 1-4m Variable Turn Table Absorber 150cm Ground Plane Test Receiver For the actual test configuration, please refer to the attached file (Test Setup Photo). 4.1.6 EUT Operating Conditions a. Placed the EUT on the testing table. b. Prepared a notebook to act as a communication partner and placed it outside of testing area. c. The communication partner connected with EUT via a RJ45 cable and ran a test program (provided by manufacturer) to enable EUT under transmission condition continuously at specific channel frequency. d. The communication partner sent data to EUT by command "PING". e. The necessary accessories enable the system in full functions. Report No.: RF181023C12 Page No. 18 / 66 Report Format Version: 6.1.1 4.1.7 Test Results Above 1GHz worst-case data:
802.11b CHANNEL TX Channel 1 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. 1 2 3 4 5 6 NO. 1 2 3 4 5 6 FREQ.
(MHz) 2390.00 2390.00
*2412.00
*2412.00 4824.00 4824.00 FREQ.
(MHz) 2390.00 2390.00
*2412.00
*2412.00 4824.00 4824.00 Remarks:
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW LEVEL VALUE
(dBuV/m)
(dBuV) 58.7 PK 25.4 48.0 AV 14.7 107.1 PK 73.7 103.4 AV 70.0 55.3 PK 42.7 50.8 AV 38.2 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.09 H 1.09 H 1.09 H 1.09 H 2.15 H 2.15 H 9 9 9 9 18 18
-18.7
-3.2
-15.3
-6.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 57.9 PK 48.1 AV 110.8 PK 106.9 AV 57.5 PK 53.8 AV LIMIT MARGIN
(dBuV/m) 74.0 54.0 74.0 54.0
(dB)
-16.1
-5.9
-16.5
-0.2
(m) 1.00 V 1.00 V 1.00 V 1.00 V 3.15 V 3.15 V RAW VALUE
(dBuV) 24.6 14.8 77.4 73.5 44.9 41.2 282 282 282 282 316 316 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 12.6 12.6 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 12.6 12.6 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 19 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 6 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 107.7 PK 74.3 104.9 AV 71.5 52.9 PK 40.5 48.4 AV 36.0 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.08 H 1.08 H 3.05 H 3.05 H TABLE ANGLE
(Degree) 11 11 333 333
-21.1
-5.6 74.0 54.0
(m) LEVEL
(dBuV/m) 109.4 PK 105.7 AV 54.9 PK 50.4 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-19.1
-3.6 ANTENNA HEIGHT
(m) 1.00 V 1.00 V 3.06 V 3.06 V TABLE ANGLE
(Degree) 108 108 345 345 RAW VALUE
(dBuV) 76.0 72.3 42.5 38.0 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 NO. 1 2 3 4 NO. 1 2 3 4 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 20 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 11 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 110.2 PK 76.7 106.4 AV 72.9 58.3 PK 24.8 47.0 AV 13.5 52.9 PK 40.5 48.6 AV 36.2 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.08 H 1.08 H 1.08 H 1.08 H 2.56 H 2.56 H 15 15 15 15 245 245
-15.7
-7.0
-21.1
-5.4 74.0 54.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 112.2 PK 108.4 AV 58.4 PK 47.5 AV 54.3 PK 49.9 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0 74.0 54.0
-15.6
-6.5
-19.7
-4.1
(m) 1.00 V 1.00 V 1.00 V 1.00 V 2.62 V 2.62 V RAW VALUE
(dBuV) 78.7 74.9 24.9 14.0 41.9 37.5 76 76 76 76 333 333 CORRECTION FACTOR
(dB/m) 33.5 33.5 33.5 33.5 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.5 33.5 33.5 33.5 12.4 12.4 NO. 1 2 3 4 5 6 NO. 1 2 3 4 5 6 FREQ.
(MHz)
*2462.00
*2462.00 2483.50 2483.50 4924.00 4924.00 FREQ.
(MHz)
*2462.00
*2462.00 2483.50 2483.50 4924.00 4924.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 21 / 66 Report Format Version: 6.1.1 802.11g CHANNEL TX Channel 1 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. 1 2 3 4 5 6 NO. 1 2 3 4 5 6 FREQ.
(MHz) 2390.00 2390.00
*2412.00
*2412.00 4824.00 4824.00 FREQ.
(MHz) 2390.00 2390.00
*2412.00
*2412.00 4824.00 4824.00 Remarks:
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 66.0 PK 32.7 51.7 AV 18.4 109.8 PK 76.4 100.7 AV 67.3 53.1 PK 40.5 40.1 AV 27.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.00 H 1.00 H 1.00 H 1.00 H 1.75 H 1.75 H 238 238 238 238 124 124
-20.9
-13.9 74.0 54.0
-8.0
-2.3 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 70.8 PK 53.5 AV 110.4 PK 100.9 AV 53.8 PK 40.8 AV LIMIT MARGIN
(dBuV/m) 74.0 54.0 74.0 54.0
(dB)
-3.2
-0.5
-20.2
-13.2
(m) 1.00 V 1.00 V 1.00 V 1.00 V 1.88 V 1.88 V RAW VALUE
(dBuV) 37.5 20.2 77.0 67.5 41.2 28.2 183 183 183 183 355 355 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 12.6 12.6 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 12.6 12.6 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 22 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 6 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 110.9 PK 77.5 100.9 AV 67.5 52.9 PK 40.5 39.5 AV 27.1 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.21 H 1.21 H 2.14 H 2.14 H TABLE ANGLE
(Degree) 233 233 239 239
-21.1
-14.5 74.0 54.0
(m) LEVEL
(dBuV/m) 116.9 PK 106.8 AV 53.5 PK 40.5 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-20.5
-13.5 ANTENNA HEIGHT
(m) 1.67 V 1.67 V 2.61 V 2.61 V TABLE ANGLE
(Degree) 278 278 322 322 RAW VALUE
(dBuV) 83.5 73.4 41.1 28.1 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 NO. 1 2 3 4 NO. 1 2 3 4 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 23 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 11 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 108.5 PK 75.0 98.6 AV 65.1 68.4 PK 34.9 52.6 AV 19.1 52.9 PK 40.5 39.5 AV 27.1 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 3.49 H 3.49 H 3.49 H 3.49 H 1.58 H 1.58 H 5 5 5 5 153 153
-5.6
-1.4
-21.1
-14.5 74.0 54.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 109.9 PK 101.0 AV 71.3 PK 53.6 AV 53.6 PK 39.9 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0 74.0 54.0
-2.7
-0.4
-20.4
-14.1
(m) 1.00 V 1.00 V 1.00 V 1.00 V 2.11 V 2.11 V RAW VALUE
(dBuV) 76.4 67.5 37.8 20.1 41.2 27.5 195 195 195 195 322 322 CORRECTION FACTOR
(dB/m) 33.5 33.5 33.5 33.5 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.5 33.5 33.5 33.5 12.4 12.4 NO. 1 2 3 4 5 6 NO. 1 2 3 4 5 6 FREQ.
(MHz)
*2462.00
*2462.00 2483.50 2483.50 4924.00 4924.00 FREQ.
(MHz)
*2462.00
*2462.00 2483.50 2483.50 4924.00 4924.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 24 / 66 Report Format Version: 6.1.1 802.11n (HT20) CHANNEL TX Channel 1 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. 1 2 3 4 5 6 NO. 1 2 3 4 5 6 FREQ.
(MHz) 2390.00 2390.00
*2412.00
*2412.00 4824.00 4824.00 FREQ.
(MHz) 2390.00 2390.00
*2412.00
*2412.00 4824.00 4824.00 Remarks:
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 66.0 PK 32.7 52.1 AV 18.8 107.3 PK 73.9 98.7 AV 65.3 51.6 PK 39.0 40.1 AV 27.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.00 H 1.00 H 1.00 H 1.00 H 1.99 H 1.99 H 2 2 2 2 245 245
-22.4
-13.9 74.0 54.0
-8.0
-1.9 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 67.1 PK 53.7 AV 111.1 PK 101.5 AV 51.9 PK 40.7 AV LIMIT MARGIN
(dBuV/m) 74.0 54.0 74.0 54.0
(dB)
-6.9
-0.3
-22.1
-13.3
(m) 1.02 V 1.02 V 1.02 V 1.02 V 1.94 V 1.94 V RAW VALUE
(dBuV) 33.8 20.4 77.7 68.1 39.3 28.1 282 282 282 282 355 355 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 12.6 12.6 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 12.6 12.6 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 25 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 6 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 109.9 PK 76.5 99.8 AV 66.4 52.2 PK 39.8 39.2 AV 26.8 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.22 H 1.22 H 2.55 H 2.55 H TABLE ANGLE
(Degree) 15 15 278 278
-21.8
-14.8 74.0 54.0
(m) LEVEL
(dBuV/m) 113.9 PK 103.8 AV 52.6 PK 40.0 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0
-21.4
-14.0 ANTENNA HEIGHT
(m) 1.30 V 1.30 V 2.66 V 2.66 V TABLE ANGLE
(Degree) 281 281 321 321 RAW VALUE
(dBuV) 80.5 70.4 40.2 27.6 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 NO. 1 2 3 4 NO. 1 2 3 4 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 26 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 11 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 109.3 PK 75.8 100.0 AV 66.5 65.0 PK 31.5 52.0 AV 18.5 52.5 PK 40.1 38.9 AV 26.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.21 H 1.21 H 1.21 H 1.21 H 2.11 H 2.11 H 101 101 101 101 269 269
-9.0
-2.0
-21.5
-15.1 74.0 54.0 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 113.3 PK 104.0 AV 68.0 PK 53.9 AV 53.2 PK 39.2 AV LIMIT MARGIN
(dBuV/m)
(dB) 74.0 54.0 74.0 54.0
-6.0
-0.1
-20.8
-14.8
(m) 1.00 V 1.00 V 1.00 V 1.00 V 2.51 V 2.51 V RAW VALUE
(dBuV) 79.8 70.5 34.5 20.4 40.8 26.8 182 182 182 182 322 322 CORRECTION FACTOR
(dB/m) 33.5 33.5 33.5 33.5 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.5 33.5 33.5 33.5 12.4 12.4 NO. 1 2 3 4 5 6 NO. 1 2 3 4 5 6 FREQ.
(MHz)
*2462.00
*2462.00 2483.50 2483.50 4924.00 4924.00 FREQ.
(MHz)
*2462.00
*2462.00 2483.50 2483.50 4924.00 4924.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 27 / 66 Report Format Version: 6.1.1 802.11n (HT40) CHANNEL TX Channel 3 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. 1 2 3 4 5 6 7 8 NO. 1 2 3 4 5 6 7 8 FREQ.
(MHz) 2390.00 2390.00
*2422.00
*2422.00 2483.50 2483.50 4844.00 4844.00 FREQ.
(MHz) 2390.00 2390.00
*2422.00
*2422.00 2483.50 2483.50 4844.00 4844.00 Remarks:
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0
-11.3
-4.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 62.7 PK 29.4 50.0 AV 16.7 102.5 PK 69.1 93.2 AV 59.8 57.8 PK 24.3 45.2 AV 11.7 51.1 PK 38.6 37.0 AV 24.5 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 2.72 H 2.72 H 2.72 H 2.72 H 2.72 H 2.72 H 1.55 H 1.55 H 2 2 2 2 2 2 242 242
-16.2
-8.8
-22.9
-17.0 74.0 54.0 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 66.3 PK 53.6 AV 103.0 PK 93.5 AV 57.9 PK 45.2 AV 50.5 PK 37.4 AV
(dBuV/m) 74.0 54.0 74.0 54.0 74.0 54.0
(dB)
-7.7
-0.4
-16.1
-8.8
-23.5
-16.6 TABLE ANGLE
(Degree) 5 5 5 5 5 5 188 188 RAW VALUE
(dBuV) 33.0 20.3 69.6 60.1 24.4 11.7 38.0 24.9
(m) 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 1.56 V 1.56 V CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 33.5 33.5 12.5 12.5 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 33.5 33.5 12.5 12.5 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 28 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 6 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT
-8.8
-3.5 MARGIN
(dBuV/m) 74.0 54.0 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 65.2 PK 31.9 50.5 AV 17.2 108.2 PK 74.8 97.9 AV 64.5 64.8 PK 31.3 49.9 AV 16.4 49.5 PK 37.1 37.4 AV 25.0 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 2.42 H 2.42 H 2.42 H 2.42 H 2.42 H 2.42 H 1.44 H 1.44 H 1 1 1 1 1 1 212 212
-9.2
-4.1
-24.5
-16.6 74.0 54.0 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 67.0 PK 53.6 AV 107.8 PK 98.3 AV 65.4 PK 51.0 AV 49.7 PK 37.5 AV
(dBuV/m) 74.0 54.0 74.0 54.0 74.0 54.0
(dB)
-7.0
-0.4
-8.6
-3.0
-24.3
-16.5 TABLE ANGLE
(Degree) 104 104 104 104 104 104 233 233 RAW VALUE
(dBuV) 33.7 20.3 74.4 64.9 31.9 17.5 37.3 25.1
(m) 1.19 V 1.19 V 1.19 V 1.19 V 1.19 V 1.19 V 2.56 V 2.56 V CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 33.5 33.5 12.4 12.4 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 33.5 33.5 12.4 12.4 NO. 1 2 3 4 5 6 7 8 NO. 1 2 3 4 5 6 7 8 FREQ.
(MHz) 2390.00 2390.00
*2437.00
*2437.00 2483.50 2483.50 4874.00 4874.00 FREQ.
(MHz) 2390.00 2390.00
*2437.00
*2437.00 2483.50 2483.50 4874.00 4874.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 29 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 9 FREQUENCY RANGE 1GHz ~ 25GHz DETECTOR FUNCTION Peak (PK) Average (AV)
(m)
(dB) LIMIT MARGIN
(dBuV/m) 74.0 54.0
-16.6
-8.8 ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION LEVEL VALUE
(dBuV/m)
(dBuV) 57.4 PK 24.1 45.2 AV 11.9 103.5 PK 70.1 94.6 AV 61.2 65.0 PK 31.5 51.5 AV 18.0 52.6 PK 40.1 37.7 AV 25.2 ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.82 H 1.82 H 1.82 H 1.82 H 1.82 H 1.82 H 2.44 H 2.44 H 239 239 239 239 239 239 15 15
-9.0
-2.5
-21.4
-16.3 74.0 54.0 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT LEVEL
(dBuV/m) 57.1 PK 45.3 AV 106.7 PK 97.4 AV 66.6 PK 53.7 AV 53.0 PK 38.1 AV
(dBuV/m) 74.0 54.0 74.0 54.0 74.0 54.0
(dB)
-16.9
-8.7
-7.4
-0.3
-21.0
-15.9 TABLE ANGLE
(Degree) 187 187 187 187 187 187 311 311 RAW VALUE
(dBuV) 23.8 12.0 73.3 64.0 33.1 20.2 40.5 25.6
(m) 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 2.55 V 2.55 V CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 33.5 33.5 12.5 12.5 CORRECTION FACTOR
(dB/m) 33.3 33.3 33.4 33.4 33.5 33.5 12.5 12.5 NO. 1 2 3 4 5 6 7 8 NO. 1 2 3 4 5 6 7 8 FREQ.
(MHz) 2390.00 2390.00
*2452.00
*2452.00 2483.50 2483.50 4904.00 4904.00 FREQ.
(MHz) 2390.00 2390.00
*2452.00
*2452.00 2483.50 2483.50 4904.00 4904.00 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. Report No.: RF181023C12 Page No. 30 / 66 Report Format Version: 6.1.1 Below 1GHz worst-case data:
802.11g CHANNEL TX Channel 6 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE NO. FREQ. (MHz) 1 2 3 4 5 6 47.36 117.22 336.48 747.85 872.03 939.95 Remarks:
LEVEL
(dBuV/m) 35.4 QP 31.0 QP 30.8 QP 32.2 QP 30.4 QP 36.2 QP LIMIT
(dBuV/m) 40.0 43.5 46.0 46.0 46.0 46.0
-4.6
-12.5
-15.2
-13.8
-15.6
-9.8 1.50 H 1.00 H 1.00 H 2.00 H 1.00 H 1.00 H 114 293 51 279 18 200 CORRECTION FACTOR
(dB/m)
-8.7
-11.3
-7.3 1.0 3.1 4.2
(dBuV) 44.1 42.3 38.1 31.2 27.3 32.0 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit of frequency range 30MHz ~
1000MHz 4. Margin value = Emission Level Limit value 5. The emission levels were very low against the limit of frequency range 9kHz ~ 30MHz: the amplitude of spurious emissions attenuated more than 20 dB below the permissible value to be report Report No.: RF181023C12 Page No. 31 / 66 Report Format Version: 6.1.1 CHANNEL TX Channel 6 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION MARGIN (dB) ANTENNA HEIGHT (m) TABLE ANGLE
(Degree) RAW VALUE
-10.1
-16.8
-22.8
-22.7
-6.8
-9.9 1.50 V 1.00 V 1.00 V 1.00 V 1.00 V 1.00 V 315 9 344 5 155 209 CORRECTION FACTOR
(dB/m)
-10.6
-9.9
-6.5
-3.7 0.7 4.1
(dBuV) 44.0 39.2 29.7 27.1 38.6 32.0 NO. FREQ. (MHz) 1 2 3 4 5 6 124.98 243.34 400.52 563.51 734.27 932.19 Remarks:
LEVEL
(dBuV/m) 33.4 QP 29.3 QP 23.2 QP 23.3 QP 39.2 QP 36.1 QP LIMIT
(dBuV/m) 43.5 46.0 46.0 46.0 46.0 46.0 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit of frequency range 30MHz ~
1000MHz 4. Margin value = Emission Level Limit value 5. The emission levels were very low against the limit of frequency range 9kHz ~ 30MHz: the amplitude of spurious emissions attenuated more than 20 dB below the permissible value to be report Report No.: RF181023C12 Page No. 32 / 66 Report Format Version: 6.1.1 4.2 Conducted Emission Measurement 4.2.1 Limits of Conducted Emission Measurement Conducted Limit (dBuV) Quasi-peak 66 - 56 56 60 Average 56 - 46 46 50 Note: 1. The lower limit shall apply at the transition frequencies. 2. The limit decreases in line with the logarithm of the frequency in the range of 0.15 to 0.50MHz. Frequency (MHz) 0.15 - 0.5 0.50 - 5.0 5.0 - 30.0 4.2.2 Test Instruments Description & Manufacturer Model No. Serial No. Cal. Date Cal. Due Sep. 03, 2018 Sep. 02, 2019 Cable-cond1-01 Sep. 05, 2018 Sep. 04, 2019 5D-FB 100291 ESCS30 Test Receiver ROHDE & SCHWARZ RF signal cable Woken LISN ROHDE & SCHWARZ
(EUT) LISN ROHDE & SCHWARZ
(Peripheral) Software ADT Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are BV ADT_Cond_ ESH3-Z5 V7.3.7.4 ENV216 101826 100311 NA NA NA Aug. 19, 2018 Aug. 18, 2019 Feb. 26, 2018 Feb. 25, 2019 traceable to NML/ROC and NIST/USA. 2. The test was performed in HwaYa Shielded Room 1. 3. The VCCI Site Registration No. is C-2040. Report No.: RF181023C12 Page No. 33 / 66 Report Format Version: 6.1.1 4.2.3 Test Procedures a. The EUT was placed 0.4 meters from the conducting wall of the shielded room with EUT being connected to the power mains through a line impedance stabilization network (LISN). Other support units were connected to the power mains through another LISN. The two LISNs provide 50 ohm/ 50uH of coupling impedance for the measuring instrument. b. Both lines of the power mains connected to the EUT were checked for maximum conducted interference. c. The frequency range from 150kHz to 30MHz was searched. Emission levels under (Limit - 20dB) was not recorded. Note: The resolution bandwidth and video bandwidth of test receiver is 9kHz for quasi-peak detection (QP) and average detection (AV) at frequency 0.15MHz-30MHz. 4.2.4 Deviation from Test Standard No deviation. 4.2.5 Test Setup Vertical Ground Reference Plane 40cm EUT LISN 80cm Test Receiver Note: 1.Support units were connected to second LISN. Horizontal Ground Reference Plane For the actual test configuration, please refer to the attached file (Test Setup Photo). 4.2.6 EUT Operating Conditions Same as item 4.3.6. Report No.: RF181023C12 Page No. 34 / 66 Report Format Version: 6.1.1 4.2.7 Test Results Worst-case data:
802.11g Phase No 1 2 3 4 5 6 Line (L) Detector Function Quasi-Peak (QP) /
Average (AV) Freq.
[MHz]
0.15000 0.16953 0.45859 0.53672 0.96641 17.02344 Corr. Factor
(dB) 9.67 9.67 9.66 9.66 9.65 9.90 Reading Value Emission Level
[dB (uV)]
[dB (uV)]
Limit
[dB (uV)]
Q.P. 41.76 40.23 22.30 24.78 11.95 10.96 AV. 25.62 25.00 9.39 24.32 0.75 4.59 Q.P. 51.43 49.90 31.96 34.44 21.60 20.86 AV. 35.29 34.67 19.05 33.98 10.40 14.49 Q.P. 66.00 64.98 56.72 56.00 56.00 60.00 AV. 56.00 54.98 46.72 46.00 46.00 50.00 Margin
(dB) Q.P.
-14.57
-15.08
-24.76
-21.56
-34.40
-39.14 AV.
-20.71
-20.31
-27.67
-12.02
-35.60
-35.51 Remarks:
1. Q.P. and AV. are abbreviations of quasi-peak and average individually. 2. The emission levels of other frequencies were very low against the limit. 3. Margin value = Emission level - Limit value 4. Correction factor = Insertion loss + Cable loss 5. Emission Level = Correction Factor + Reading Value. Report No.: RF181023C12 Page No. 35 / 66 Report Format Version: 6.1.1 Phase Neutral (N) Detector Function Quasi-Peak (QP) /
Average (AV) No 1 2 3 4 5 6 Freq.
[MHz]
0.15000 0.15781 0.23594 0.53672 0.97031 17.83984 Corr. Factor
(dB) 9.68 9.68 9.67 9.67 9.65 9.98 Reading Value Emission Level
[dB (uV)]
[dB (uV)]
Limit
[dB (uV)]
Q.P. 40.99 41.00 32.85 23.29 12.24 11.40 AV. 25.42 25.53 18.55 14.83 1.25 6.36 Q.P. 50.67 50.68 42.52 32.96 21.89 21.38 AV. 35.10 35.21 28.22 24.50 10.90 16.34 Q.P. 66.00 65.58 62.24 56.00 56.00 60.00 AV. 56.00 55.58 52.24 46.00 46.00 50.00 Margin
(dB) Q.P.
-15.33
-14.90
-19.72
-23.04
-34.11
-38.62 AV.
-20.90
-20.37
-24.02
-21.50
-35.10
-33.66 Remarks:
1. Q.P. and AV. are abbreviations of quasi-peak and average individually. 2. The emission levels of other frequencies were very low against the limit. 3. Margin value = Emission level - Limit value 4. Correction factor = Insertion loss + Cable loss 5. Emission Level = Correction Factor + Reading Value. Report No.: RF181023C12 Page No. 36 / 66 Report Format Version: 6.1.1 EUT 6dB Bandwidth Measurement 4.3 4.3.1 Limits of 6dB Bandwidth Measurement The minimum of 6dB Bandwidth Measurement is 0.5 MHz. 4.3.2 Test Setup 4.3.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.3.4 Test Procedure a. Set resolution bandwidth (RBW) = 100kHz b. Set the video bandwidth (VBW) 3 x RBW, Detector = Peak. c. Trace mode = max hold. d. Sweep = auto couple. e. Measure the maximum width of the emission that is constrained by the frequencies associated with the Spectrum Analyzer Attenuator two amplitude points (upper and lower) that are attenuated by 6 dB relative to the maximum level measured in the fundamental emission 4.3.5 Deviation from Test Standard No deviation. 4.3.6 EUT Operating Conditions The software provided by client to enable the EUT under transmission condition continuously at lowest, middle and highest channel frequencies individually. Report No.: RF181023C12 Page No. 37 / 66 Report Format Version: 6.1.1 4.3.7 Test Result 802.11b Channel Frequency
(MHz) 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 Minimum Limit
(MHz) Pass / Fail 1 6 11 802.11g 2412 2437 2462 7.12 7.14 7.11 7.07 6.62 7.07 7.09 7.10 7.13 7.07 7.10 7.09 0.5 0.5 0.5 Pass Pass Pass Channel Frequency
(MHz) 1 6 11 2412 2437 2462 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 15.14 15.13 15.14 15.08 15.12 15.14 15.14 15.14 15.16 15.14 15.13 15.13 Minimum Limit
(MHz) Pass / Fail 0.5 0.5 0.5 Pass Pass Pass 802.11n (HT20) Channel Frequency
(MHz) 1 6 11 2412 2437 2462 802.11n (HT40) Channel Frequency
(MHz) 3 6 9 2422 2437 2452 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 15.15 15.16 15.16 15.11 15.18 15.13 15.15 15.16 15.16 15.14 15.14 15.14 Minimum Limit
(MHz) Pass / Fail 0.5 0.5 0.5 Pass Pass Pass 6dB Bandwidth (MHz) Chain 0 Chain 1 Chain 2 Chain 3 30.12 30.11 31.34 33.81 32.62 33.91 32.61 30.07 31.32 31.37 28.88 30.12 Minimum Limit
(MHz) Pass / Fail 0.5 0.5 0.5 Pass Pass Pass Report No.: RF181023C12 Page No. 38 / 66 Report Format Version: 6.1.1 802.11b Spectrum Plot of Worst Value 802.11g 802.11n (HT20) 802.11n (HT40) Report No.: RF181023C12 Page No. 39 / 66 Report Format Version: 6.1.1 4.4 Conducted Output Power Measurement 4.4.1 Limits of Conducted Output Power Measurement For systems using digital modulation in the 24002483.5 MHz bands: 1 Watt (30dBm) Per KDB 662911 D01 Multiple Transmitter Output Method of conducted output power measurement on IEEE 802.11 devices, Array Gain = 0 dB (i.e., no array gain) for NANT 4;
Array Gain = 0 dB (i.e., no array gain) for channel widths 40 MHz for any NANT;
Array Gain = 5 log(NANT/NSS) dB or 3 dB, whichever is less for 20-MHz channel widths with NANT 5. EUT Attenuator Power Sensor For power measurements on all other devices: Array Gain = 10 log(NANT/NSS) dB. 4.4.2 Test Setup 4.4.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.4.4 Test Procedures Average power sensor was used to perform output power measurement, trigger and gating function of wide band power meter is enabled to measure max output power of TX on burst. Duty factor is not added to measured value. 4.4.5 Deviation from Test Standard No deviation. 4.4.6 EUT Operating Conditions Same as item 4.3.6. Report No.: RF181023C12 Page No. 40 / 66 Report Format Version: 6.1.1 4.4.7 Test Results Mode A: EX7300v2 802.11b Chan. 1 6 11 802.11g Chan. 1 6 11 Chan. Freq.
(MHz) 2412 2437 2462 Chan. Freq.
(MHz) 2412 2437 2462 802.11n (HT20) Average Power (dBm) Chain 1 19.70 19.65 19.21 Chain 2 20.38 20.08 19.78 Chain 3 20.35 20.21 20.47 Chain 0 20.21 20.19 20.39 Average Power (dBm) Chain 1 17.01 19.67 17.05 Chain 2 17.16 19.90 17.16 Chain 3 17.55 20.22 17.23 Chain 0 17.78 20.22 17.13 Chan. 1 6 11 Chan. Freq.
(MHz) 2412 2437 2462 Average Power (dBm) Chain 1 16.01 19.17 16.96 Chain 2 16.18 19.87 17.16 Chain 3 16.82 20.50 17.30 Chain 0 16.95 20.46 17.34 802.11n (HT40) Chan. Freq.
(MHz) 2422 2437 2452 Chan. 3 6 9 Chain 0 14.11 17.42 14.40 Average Power (dBm) Chain 1 14.06 16.63 13.02 Chain 2 14.09 16.91 13.38 Chain 3 14.12 17.52 14.46 Total Power
(mW) 415.816 403.542 399.253 Total Power
(mW) 219.098 400.799 207.186 Total Power
(mW) 179.026 403.030 209.562 Total Power
(mW) 102.699 206.819 97.289 Total Power
(dBm) 26.19 26.06 26.01 Total Power
(dBm) 23.41 26.03 23.16 Total Power
(dBm) 22.53 26.05 23.21 Total Power
(dBm) 20.12 23.16 19.88 Limit
(dBm) Pass /
Fail 30 30 30 Pass Pass Pass Limit
(dBm) Pass /
Fail 30 30 30 Pass Pass Pass Limit
(dBm) Pass /
Fail 30 30 30 Pass Pass Pass Limit
(dBm) Pass /
Fail 30 30 30 Pass Pass Pass Report No.: RF181023C12 Page No. 41 / 66 Report Format Version: 6.1.1 Mode B: EX6400v2 802.11b Channel Frequency
(MHz) 1 6 11 802.11g 2412 2437 2462 Average Power (dBm) Chain 0 20.21 20.19 20.39 Chain 1 19.70 19.65 19.21 Chain 2 20.38 20.08 19.78 Channel Frequency
(MHz) 1 6 11 2412 2437 2462 Average Power (dBm) Chain 0 17.78 20.22 17.13 Chain 1 17.01 19.67 17.05 Chain 2 17.16 19.90 17.16 802.11n (HT20) Channel Frequency
(MHz) 1 6 11 2412 2437 2462 802.11n (HT40) Channel Frequency
(MHz) 3 6 9 2422 2437 2452 Average Power (dBm) Chain 0 16.95 20.46 17.34 Chain 1 16.01 19.17 16.96 Chain 2 16.18 19.87 17.16 Average Power (dBm) Chain 0 14.11 17.42 14.40 Chain 1 14.06 16.63 13.02 Chain 2 14.09 16.91 13.38 Total Power
(mW) 307.423 298.588 287.824 Total Power
(mW) 162.213 295.603 154.341 Total Power
(mW) 130.942 290.828 155.859 Total Power
(mW) 76.876 150.325 69.364 Total Power
(dBm) 24.88 24.75 24.59 Total Power
(dBm) 22.10 24.71 21.88 Total Power
(dBm) 21.17 24.64 21.93 Total Power
(dBm) 18.86 21.77 18.41 Limit
(dBm) 30.00 30.00 30.00 Pass /
Fail Pass Pass Pass Limit
(dBm) Pass /
Fail 30.00 30.00 30.00 Pass Pass Pass Limit
(dBm) Pass /
Fail 30.00 30.00 30.00 Pass Pass Pass Limit
(dBm) Pass /
Fail 30.00 30.00 30.00 Pass Pass Pass Report No.: RF181023C12 Page No. 42 / 66 Report Format Version: 6.1.1 EUT Attenuator Spectrum Analyzer 4.5 Power Spectral Density Measurement 4.5.1 Limits of Power Spectral Density Measurement The Maximum of Power Spectral Density Measurement is 8dBm. 4.5.2 Test Setup 4.5.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.5.4 Test Procedure For AVG. power (duty cycle 98%) a) Set instrument center frequency to DTS channel center frequency. b) Set span to at least 1.5 times the OBW. c) Set RBW to: 3 kHz RBW 100 kHz. d) Set VBW 3 x RBW. e) Detector = power averaging (RMS) or sample detector (when RMS not available). f) Ensure that the number of measurement points in the sweep 2 x span/RBW. g) Sweep time = auto couple. h) Employ trace averaging (RMS) mode over a minimum of 100 traces. i) Use the peak marker function to determine the maximum amplitude level. For AVG. power (duty cycle < 98%) a) Measure the duty cycle (x). b) Set instrument center frequency to DTS channel center frequency. c) Set span to at least 1.5 times the OBW. d) Set RBW to: 3 kHz RBW 100 kHz. e) Set VBW 3 x RBW. f) Detector = power averaging (RMS) or sample detector (when RMS not available). g) Ensure that the number of measurement points in the sweep 2 x span/RBW. h) Sweep time = auto couple. i) Do not use sweep triggering. Allow sweep to free run. j) Employ trace averaging (RMS) mode over a minimum of 100 traces. k) Use the peak marker function to determine the maximum amplitude level. l) Add 10 log (1/x), where x is the duty cycle measured in step (a, to the measured PSD to compute the average PSD during the actual transmission time. 4.5.5 Deviation from Test Standard No deviation. 4.5.6 EUT Operating Condition Same as item 4.3.6. Report No.: RF181023C12 Page No. 43 / 66 Report Format Version: 6.1.1 4.5.7 Test Results 802.11b TX chain Channel Freq.
(MHz) PSD
(dBm/10kHz) 10 log
(N=4) dB Total PSD With Duty Factor
(dBm/10kHz) 0 1 2 3 1 6 11 1 6 11 1 6 11 1 6 11 2412 2437 2462 2412 2437 2462 2412 2437 2462 2412 2437 2462
-7.90
-7.42
-6.73
-8.54
-8.78
-8.47
-7.58
-7.17
-7.70
-7.38
-7.36
-7.19 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02
-1.88
-1.40
-0.71
-2.52
-2.76
-2.45
-1.56
-1.15
-1.68
-1.36
-1.34
-1.17 Limit
(dBm/3kHz) Pass /
Fail 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Note:
1. Method a) of power density measurement of KDB 662911 is using for calculating total power density. Total power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. Directional gain = 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/4]= 7.60dBi > 6dBi , so the power density limit shall be reduced to 8-(7.60-6) = 6.40dBm. Report No.: RF181023C12 Page No. 44 / 66 Report Format Version: 6.1.1 802.11g TX chain Channel Freq.
(MHz) PSD
(dBm/10kHz) 10 log
(N=4) dB Duty factor
(dB) Total PSD With Duty Factor
(dBm/10kHz) 0 1 2 3 1 6 11 1 6 11 1 6 11 1 6 11 2412 2437 2462 2412 2437 2462 2412 2437 2462 2412 2437 2462
-11.23
-9.65
-10.94
-12.81
-11.01
-11.66
-11.54
-9.75
-11.82
-11.23
-9.65
-10.94 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 0.11 0.11 0.11 0.11 0.11 0.11 0.11 0.11 0.11 0.11 0.11 0.11
-5.10
-3.52
-4.81
-6.68
-4.88
-5.53
-5.41
-3.62
-5.69
-5.10
-3.52
-4.81 Limit
(dBm/3kHz) Pass /
Fail 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Note:
1. Method a) of power density measurement of KDB 662911 is using for calculating total power density. Total power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. Directional gain = 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/4]= 7.60dBi > 6dBi , so the power density limit shall be reduced to 8-(7.60-6) = 6.40dBm. 3. Refer to section 3.3 for duty cycle spectrum plot. 802.11n (HT20) TX chain Channel Freq.
(MHz) PSD
(dBm/10kHz) 10 log
(N=4) dB Duty factor
(dB) Total PSD With Duty Factor
(dBm/10kHz) 0 1 2 3 1 6 11 1 6 11 1 6 11 1 6 11 2412 2437 2462 2412 2437 2462 2412 2437 2462 2412 2437 2462
-11.84
-10.11
-11.60
-12.85
-10.72
-12.28
-11.34
-9.65
-11.81
-11.83
-9.76
-11.32 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 0.16 0.16 0.16 0.16 0.16 0.16 0.16 0.16 0.16 0.16 0.16 0.16
-5.66
-3.93
-5.42
-6.67
-4.54
-6.10
-5.16
-3.47
-5.63
-5.65
-3.58
-5.14 Limit
(dBm/3kHz) Pass /
Fail 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Note:
1. Method a) of power density measurement of KDB 662911 is using for calculating total power density. Total power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. Directional gain = 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/4]= 7.60dBi > 6dBi , so the power density limit shall be reduced to 8-(7.60-6) = 6.40dBm. 3. Refer to section 3.3 for duty cycle spectrum plot. Report No.: RF181023C12 Page No. 45 / 66 Report Format Version: 6.1.1 802.11n (HT40) TX chain Channel Freq.
(MHz) PSD
(dBm/10kHz) 10 log
(N=4) dB Duty factor
(dB) Total PSD With Duty Factor
(dBm/10kHz) 0 1 2 3 3 6 9 3 6 9 3 6 9 3 6 9 2422 2437 2452 2422 2437 2452 2422 2437 2452 2422 2437 2452
-16.46
-13.49
-16.50
-17.39
-14.33
-17.81
-16.79
-13.33
-17.80
-16.65
-13.60
-16.36 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 6.02 0.23 0.23 0.23 0.23 0.23 0.23 0.23 0.23 0.23 0.23 0.23 0.23
-10.21
-7.24
-10.25
-11.14
-8.08
-11.56
-10.54
-7.08
-11.55
-10.40
-7.35
-10.11 Limit
(dBm/3kHz) Pass /
Fail 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 6.40 Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass Pass 1. Method a) of power density measurement of KDB 662911 is using for calculating total power density. Total power density is summing entire spectra across corresponding frequency bins on the various outputs by computer. 2. Directional gain = 10 log[(10G1 /20 + 10G2 /20 + ... + 10GN /20)2/4]= 7.60dBi > 6dBi , so the power density limit shall be reduced to 8-(7.60-6) = 6.40dBm. 3. Refer to section 3.3 for duty cycle spectrum plot. Report No.: RF181023C12 Page No. 46 / 66 Report Format Version: 6.1.1 802.11b Spectrum Plot of Worst Value 802.11g 802.11n (HT20) 802.11n (HT40) Report No.: RF181023C12 Page No. 47 / 66 Report Format Version: 6.1.1 EUT 4.6 Conducted Out of Band Emission Measurement 4.6.1 Limits of Conducted Out of Band Emission Measurement Below -30dB of the highest emission level of operating band (in 100kHz Resolution Bandwidth). 4.6.2 Test Setup 4.6.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.6.4 Test Procedure MEASUREMENT PROCEDURE REF 1. Set the RBW = 100 kHz. 2. Set the VBW 300 kHz. 3. Detector = average. 4. Sweep time = auto couple. 5. Trace mode = max hold. 6. Allow trace to fully stabilize. 7. Use the peak marker function to determine the maximum power level in any 100 kHz band segment within SPECTRUM ANALYZER Attenuator the fundamental EBW. MEASUREMENT PROCEDURE OOBE 1. Set RBW = 100 kHz. 2. Set VBW 300 kHz. 3. Detector = peak. 4. Sweep = auto couple. 5. Trace Mode = max hold. 6. Allow trace to fully stabilize. 7. Use the peak marker function to determine the maximum amplitude level. 4.6.5 Deviation from Test Standard No deviation. 4.6.6 EUT Operating Condition Same as item 4.3.6. 4.6.7 Test Results The conducted emission test is performed on each TX port of operating mode without summing or adding 10log (N) since the limit is relative emission limit. The spectrum plots are attached on the following pages. D1 line indicates the highest level, and D2 line indicates the 30dB offset below D1. It shows compliance with the requirement. Report No.: RF181023C12 Page No. 48 / 66 Report Format Version: 6.1.1 802.11b_Chain 0 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 49 / 66 Report Format Version: 6.1.1 802.11b_Chain 1 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 50 / 66 Report Format Version: 6.1.1 802.11b_Chain 2 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 51 / 66 Report Format Version: 6.1.1 802.11b_Chain 3 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 52 / 66 Report Format Version: 6.1.1 802.11g_Chain 0 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 53 / 66 Report Format Version: 6.1.1 802.11g_Chain 1 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 54 / 66 Report Format Version: 6.1.1 802.11g_Chain 2 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 55 / 66 Report Format Version: 6.1.1 802.11g_Chain 3 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 56 / 66 Report Format Version: 6.1.1 802.11n (HT20)_Chain 0 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 57 / 66 Report Format Version: 6.1.1 802.11n (HT20)_Chain 1 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 58 / 66 Report Format Version: 6.1.1 802.11n (HT20)_Chain 2 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 59 / 66 Report Format Version: 6.1.1 802.11n (HT20)_Chain 3 CH 1 CH 6 CH 11 CH 1 Band edge CH 11 Band edge Report No.: RF181023C12 Page No. 60 / 66 Report Format Version: 6.1.1 802.11n (HT40)_Chain 0 CH 3 CH 6 CH 9 CH 3 Band edge CH 9 Band edge Report No.: RF181023C12 Page No. 61 / 66 Report Format Version: 6.1.1 802.11n (HT40)_Chain 1 CH 3 CH 6 CH 9 CH 3 Band edge CH 9 Band edge Report No.: RF181023C12 Page No. 62 / 66 Report Format Version: 6.1.1 802.11n (HT40)_Chain 2 CH 3 CH 6 CH 9 CH 3 Band edge CH 9 Band edge Report No.: RF181023C12 Page No. 63 / 66 Report Format Version: 6.1.1 802.11n (HT40)_Chain 3 CH 3 CH 6 CH 9 CH 3 Band edge CH 9 Band edge Report No.: RF181023C12 Page No. 64 / 66 Report Format Version: 6.1.1 5 Pictures of Test Arrangements Please refer to the attached file (Test Setup Photo). Report No.: RF181023C12 Page No. 65 / 66 Report Format Version: 6.1.1 Appendix Information on the Testing Laboratories We, Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, were founded in 1988 to provide our best service in EMC, Radio, Telecom and Safety consultation. Our laboratories are FCC recognized accredited test firms and accredited and approved according to ISO/IEC 17025. If you have any comments, please feel free to contact us at the following:
Linko EMC/RF Lab Tel: 886-2-26052180 Fax: 886-2-26051924 Hwa Ya EMC/RF/Safety Lab Tel: 886-3-3183232 Fax: 886-3-3270892 Email: service.adt@tw.bureauveritas.com Web Site: www.bureauveritas-adt.com Hsin Chu EMC/RF/Telecom Lab Tel: 886-3-6668565 Fax: 886-3-6668323 The address and road map of all our labs can be found in our web site also.
--- END ---
Report No.: RF181023C12 Page No. 66 / 66 Report Format Version: 6.1.1
1 2 3 | RF Test Report-Co-located | Test Report | 286.86 KiB | January 20 2019 |
FCC Test Report
(Co-Located) Report No.: RF181023C12-2 FCC ID: PY318300422 Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Received Date: Oct. 23, 2018 Test Date: Dec. 07 ~ Dec. 13, 2018 Issued Date: Dec. 18, 2018 Applicant: NETGEAR, INC. Address: 350 East Plumeria Drive San Jose, CA 95134 Issued By: Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch Lab Address: No. 47-2, 14th Ling, Chia Pau Vil., Lin Kou Dist., New Taipei City, Taiwan, R.O.C. Test Location: No. 19, Hwa Ya 2nd Rd., Wen Hwa Vil., Kwei Shan Dist., Taoyuan City FCC Registration /
Designation Number:
33383, TAIWAN (R.O.C.) 788550 / TW0003 This report is for your exclusive use. Any copying or replication of this report to or for any other person or entity, or use of our name or trademark, is permitted only with our prior written permission. This report sets forth our findings solely with respect to the test samples identified herein. The results set forth in this report are not indicative or representative of the quality or characteristics of the lot from which a test sample was taken or any similar or identical product specifically and expressly noted. Our report includes all of the tests requested by you and the results thereof based upon the information that you provided to us. You have 60 days from date of issuance of this report to notify us of any material error or omission caused by our negligence, provided, however, that such notice shall be in writing and shall specifically address the issue you wish to raise. A failure to raise such issue within the prescribed time shall constitute your unqualified acceptance of the completeness of this report, the tests conducted and the correctness of the report contents. Unless specific mention, the uncertainty of measurement has been explicitly taken into account to declare the compliance or non-compliance to the specification. The report must not be used by the client to claim product certification, approval, or endorsement by TAF or any government agencies. Report No.: RF181023C12-2 Page No. 1 / 24 Report Format Version: 6.1.1 Table of Contents 4 3 Release Control Record .................................................................................................................................. 3 Certificate of Conformity ...................................................................................................................... 4 1 Summary of Test Results ..................................................................................................................... 5 2 2.1 Measurement Uncertainty ................................................................................................................... 5 2.2 Modification Record ............................................................................................................................ 5 General Information .............................................................................................................................. 6 3.1 General Description of EUT ................................................................................................................ 6 3.2 Description of Test Modes ................................................................................................................... 8 3.2.1 Test Mode Applicability and Tested Channel Detail ........................................................................... 10 3.3 Description of Support Units .............................................................................................................. 11 3.3.1 Configuration of System under Test ................................................................................................... 11 3.4 General Description of Applied Standards ......................................................................................... 11 Test Types and Results ...................................................................................................................... 12 4.1 Radiated Emission and Bandedge Measurement ............................................................................. 12 4.1.1 Limits of Radiated Emission and Bandedge Measurement .............................................................. 12 4.1.2 Test Instruments ................................................................................................................................ 13 4.1.3 Test Procedures ................................................................................................................................. 14 4.1.4 Deviation from Test Standard ............................................................................................................ 14 4.1.5 Test Setup .......................................................................................................................................... 15 4.1.6 EUT Operating Conditions ................................................................................................................. 16 4.1.7 Test Results ....................................................................................................................................... 17 4.2 Conducted Out of Band Emission Measurement .............................................................................. 20 4.2.1 Limits of Conducted Out of Band Emission Measurement ................................................................ 20 4.2.2 Test Setup .......................................................................................................................................... 20 4.2.3 Test Instruments ................................................................................................................................ 20 4.2.4 Test Procedure .................................................................................................................................. 20 4.2.5 Deviation from Test Standard ............................................................................................................ 20 4.2.6 EUT Operating Condition .................................................................................................................. 20 4.2.7 Test Results ....................................................................................................................................... 20 5 Pictures of Test Arrangements .......................................................................................................... 22 Annex A- Radiated Out of Band Emission (OOBE) Measurement (For U-NII-3 band) ............................ 23 Appendix Information on the Testing Laboratories ................................................................................ 24 Report No.: RF181023C12-2 Page No. 2 / 24 Report Format Version: 6.1.1 Release Control Record Issue No. RF181023C12-2 Description Original release. Date Issued Dec. 18, 2018 Report No.: RF181023C12-2 Page No. 3 / 24 Report Format Version: 6.1.1 1 Certificate of Conformity Product: Nighthawk X4 AC2200 WiFi Mesh Extender (refer to item 3.1 for more details) Brand: NETGEAR Test Model: EX7300v2 Series Model: EX6400v2 (refer to item 3.1 for more details) Sample Status: Engineering sample Applicant: NETGEAR, INC. Test Date: Dec. 07 ~ Dec. 13, 2018 Standards: 47 CFR FCC Part 15, Subpart C (Section 15.247) 47 CFR FCC Part 15, Subpart E (Section 15.407) ANSI C63.10-2013 The above equipment has been tested by Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, and found compliance with the requirement of the above standards. The test record, data evaluation & Equipment Under Test (EUT) configurations represented herein are true and accurate accounts of the measurements of the samples RF characteristics under the conditions specified in this report. Prepared by :
Polly Chien / Specialist
, Date:
Dec. 18, 2018 Approved by :
, Date:
Dec. 18, 2018 Bruce Chen / Project Engineer Report No.: RF181023C12-2 Page No. 4 / 24 Report Format Version: 6.1.1 2 Summary of Test Results Applied Standard 47 CFR FCC Part 15, Subpart C (Section 15.247) 47 CFR FCC Part 15, Subpart E (Section 15.407) FCC Clause 15.205 / 15.209 /
15.247(d) 15.407(b)
(1/2/3/4(i/ii)/6) Test Item Radiated Emissions Result Pass Remarks Meet the requirement of limit. Minimum passing margin is -1.2dB at 5927.20MHz.
*For U-NII-3 band compliance with rule part 15.407(b)(4)(i), the OOBE test plots were recorded in Annex A. 2.1 Measurement Uncertainty Where relevant, the following measurement uncertainty levels have been estimated for tests performed on the EUT as specified in CISPR 16-4-2:
Measurement Radiated Emissions up to 1 GHz Radiated Emissions above 1 GHz Frequency 30MHz ~ 200MHz 200MHz ~1000MHz 1GHz ~ 18GHz 18GHz ~ 40GHz Expanded Uncertainty
(k=2) () 3.63 dB 3.64 dB 2.29 dB 2.29 dB 2.2 Modification Record There were no modifications required for compliance. Report No.: RF181023C12-2 Page No. 5 / 24 Report Format Version: 6.1.1 3 General Information 3.1 General Description of EUT Product Brand Test Model Series Model Model Difference Sample Status Power Supply Rating Modulation Type Modulation Technology Transfer Rate Operating Frequency Number of Channel Output Power Antenna Type Antenna Connector Accessory Device Cable Supplied Report No.: RF181023C12-2 Nighthawk X4 AC2200 WiFi Mesh Extender (refer to note for more details) NETGEAR EX7300v2 EX6400v2 Refer to Note Engineering sample 100-240Vac CCK, DQPSK, DBPSK for DSSS 64QAM, 16QAM, QPSK, BPSK for OFDM 256QAM, 64QAM, 16QAM, QPSK, BPSK for OFDM DSSS, OFDM 802.11b:11/5.5/2/1Mbps 802.11a/g: 54/48/36/24/18/12/9/6Mbps 802.11n: up to 600Mbps 802.11ac: up to 1733.3Mbps 2.4GHz: 2412~2462MHz 5.0GHz: 5180~5240MHz, 5745~5825MHz 2412~2462MHz:
802.11b, 802.11g, 802.11n (HT20): 11 802.11n (HT40): 7 5180~5240MHz:
802.11a, 802.11n (HT20), 802.11ac (VHT20): 4 802.11n (HT40), 802.11ac (VHT40): 2 802.11ac (VHT80): 1 5745~5825MHz:
802.11a, 802.11n (HT20), 802.11ac (VHT20): 5 802.11n (HT40), 802.11ac (VHT40): 2 802.11ac (VHT80): 1 Model: EX7300v2:
CDD Mode:
2412 ~ 2462MHz: 415.816mW 5180~5240MHz: 854.155mW 5745~5825MHz: 860.770mW Beamforming Mode:
5180~5240MHz: 803.297mW 5745~5825MHz: 848.822mW Model: EX6400v2:
CDD Mode:
2412 ~ 2462MHz: 307.423mW Refer to Note Refer to Note NA NA Page No. 6 / 24 Report Format Version: 6.1.1 Note:
1. All models are listed as below. Product Name Brand Model Difference NETGEAR Nighthawk X4 AC2200 WiFi Mesh Extender EX7300v2 AC1900 WiFi Mesh Extender EX6400v2 The listed models are electrically and mechanically identical. The intention of these models is only for RF output transmit antenna (EX7300v2 2.4G: 4T4R;
EX6400v2 2.4G: 3T3R) and different NETGEAR logo
(EX7300v2 has silver coating. EX6400v2 has no silver coating) purpose.
* For model EX7300v2 is the worst case for final tests after pretesting. 2. The EUT incorporates a MIMO function. Physically, the EUT provides 4 completed transmitters and 4 Modulation Mode TX Function receivers. Band 2.4GHz 5GHz 802.11b 802.11g 802.11n (HT20) 802.11n (HT40) 802.11a 802.11n (HT20) 802.11n (HT40) 802.11ac (VHT20) 802.11ac (VHT40) 802.11ac (VHT80) 802.11b 802.11g 2.4GHz 802.11n (HT20) 802.11n (HT40) 3. The EUT uses following antennas. For 2.4GHz Band Model: EX6400v2 4TX 4TX 4TX 4TX 4TX 4TX 4TX 4TX 4TX 4TX 3TX 3TX 3TX 3TX Beamforming Not Support Not Support Not Support Not Support Not Support Support Support Support Support Support Not Support Not Support Not Support Not Support Model EX7300v2 EX6400v2 Ant. Type Connecter Type Ant. 1 1.95 Model: EX7300v2 Ant. Type Connecter Type Ant. 1 1.95 Report No.: RF181023C12-2 PIFA NA Antenna Gain (dBi) Ant. 2 1.08 Directional Antenna Gain (dBi) 6.07 PIFA NA Antenna Gain (dBi) Ant. 3 Ant. 2 1.08 0.82 Directional Antenna Gain (dBi) 7.60 Ant. 3 0.82 Ant. 4 2.36 Page No. 7 / 24 Report Format Version: 6.1.1 For 5GHz Band Model: EX6400v2 & EX7300v2 Ant. Type Connecter Type Frequency PIFA NA Directional Gain (dBi) 5150~5250MHz 5250~5350MHz 5470~5725MHz 5725~5850MHz 5.49 5.48 5.11 5.14 3.2 Description of Test Modes 2412~2462MHz:
11 channels are provided for 802.11b, 802.11g, 802.11n (HT20):
Channel 1 2 3 4 5 6 Frequency 2412 MHz 2417 MHz 2422 MHz 2427 MHz 2432 MHz 2437 MHz 7 channels are provided for 802.11n (HT40):
Channel 3 4 5 6 Frequency 2422 MHz 2427 MHz 2432 MHz 2437 MHz Channel 7 8 9 10 11 Channel 7 8 9 Frequency 2442 MHz 2447 MHz 2452 MHz 2457 MHz 2462 MHz Frequency 2442 MHz 2447 MHz 2452 MHz Report No.: RF181023C12-2 Page No. 8 / 24 Report Format Version: 6.1.1 5180~5240MHz:
4 channels are provided for 802.11a, 802.11n (HT20), 802.11ac (VHT20):
Channel Channel 2 channels are provided for 802.11n (HT40), 802.11ac (VHT40):
Channel 38 Frequency 5190MHz Channel 46 1 channel is provided for 802.11ac (VHT80):
Channel 42 Frequency 5210MHz 5745~5825MHz:
5 channels are provided for 802.11a, 802.11n (HT20), 802.11ac (VHT20):
Channel Channel Frequency 5180MHz 5200MHz Frequency 5745MHz 5765MHz 5785MHz 44 48 161 165 36 40 149 153 157 2 channels are provided for 802.11n (HT40), 802.11ac (VHT40):
Channel 151 Frequency 5755MHz Channel 159 1 channel is provided for 802.11ac (VHT80):
Channel 155 Frequency 5775MHz Frequency 5220MHz 5240MHz Frequency 5230MHz Frequency 5805MHz 5825MHz Frequency 5795MHz Report No.: RF181023C12-2 Page No. 9 / 24 Report Format Version: 6.1.1 3.2.1 Test Mode Applicability and Tested Channel Detail EUT Configure Mode
-
Where RE1G Applicable to RE<1G OB
-
Description RE<1G: Radiated Emission below 1GHz RE1G: Radiated Emission above 1GHz & Bandedge Measurement OB: Conducted Out of Band Emission Note: The EUT had been pre-tested on the positioned of each 3 axis. The worst case was found when positioned on Z-plane. Radiated Emission Test (Above 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. Mode Freq. Range (MHz) Available Channel Tested Channel EUT Configure Mode EUT Configure Mode EUT Configure Mode
-
802.11g +
802.11a 2412 ~ 2462 5745 ~ 5825 1 to 11 149 to 165 6 + 165 Radiated Emission Test (Below 1GHz):
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. Mode Freq. Range (MHz) Available Channel Tested Channel
-
802.11g +
802.11a 2412 ~ 2462 5745 ~ 5825 1 to 11 149 to 165 6 + 165 Conducted Out of Band Emission Measurement:
Pre-Scan has been conducted to determine the worst-case mode from all possible combinations between available modulations, data rates and antenna ports (if EUT with antenna diversity architecture). Following channel(s) was (were) selected for the final test as listed below. Mode Freq. Range (MHz) Available Channel Tested Channel
-
802.11g +
802.11a 2412 ~ 2462 5745 ~ 5825 1 to 11 149 to 165 6 + 165 Modulation Technology OFDM OFDM Modulation Technology OFDM OFDM Modulation Technology OFDM OFDM Test Condition:
Applicable to Environmental Conditions RE1G RE<1G OB 25deg. C, 70%RH 25deg. C, 70%RH 25deg. C, 75%RH Input Power 120Vac, 60Hz 120Vac, 60Hz 120Vac, 60Hz Tested by Luis Lee Luis Lee Noah Chang Report No.: RF181023C12-2 Page No. 10 / 24 Report Format Version: 6.1.1 3.3 Description of Support Units The EUT has been tested as an independent unit together with other necessary accessories or support units. The following support units or accessories were used to form a representative test configuration during the tests. ID A. Product Notebook Brand DELL Model No. E5410 Serial No. 1HC2XM1 FCC ID Remarks FCC DoC Approved -
Note:
1. All power cords of the above support units are non-shielded (1.8m). 2. Item A acted as a communication partner to transfer data. ID Descriptions Qty. Length (m) Shielding
(Yes/No) Cores (Qty.) Remarks 1. RJ45, Cat5e 1 6 N 0
-
(1) EUT 3.3.1 Configuration of System under Test 3.4 General Description of Applied Standards The EUT is a RF Product. According to the specification of the EUT declared by the manufacturer, it must comply with the requirements of the following standards:
FCC Part 15, Subpart C (15.247) FCC Part 15, Subpart E (15.407) ANSI C63.10-2013 All test items have been performed and recorded as per the above standards. Notebook (A) Remote site Report No.: RF181023C12-2 Page No. 11 / 24 Report Format Version: 6.1.1 Test Types and Results 4 4.1 Radiated Emission and Bandedge Measurement 4.1.1 Limits of Radiated Emission and Bandedge Measurement Radiated emissions which fall in the restricted bands must comply with the radiated emission limits specified as below table. Frequencies (MHz) Field Strength (microvolts/meter) Measurement Distance (meters) 0.009 ~ 0.490 0.490 ~ 1.705 1.705 ~ 30.0 30 ~ 88 88 ~ 216 216 ~ 960 Above 960 2400/F(kHz) 24000/F(kHz) 30 100 150 200 500 300 30 30 3 3 3 3 NOTE:
1. 2. 3. The lower limit shall apply at the transition frequencies. Emission level (dBuV/m) = 20 log Emission level (uV/m). For frequencies above 1000MHz, the field strength limits are based on average detector, however, the peak field strength of any emission shall not exceed the maximum permitted average limits, specified above by more than 20dB under any condition of modulation. Limits of unwanted emission out of the restricted bands Applicable To 789033 D02 General UNII Test Procedure New Rules v02r01 Limit Field Strength at 3m PK: 74 (dBV/m) AV: 54 (dBV/m) Frequency Band Applicable To EIRP Limit Equivalent Field Strength at 3m 5150~5250 MHz 5250~5350 MHz 5470~5725 MHz 15.407(b)(1) 15.407(b)(2) 15.407(b)(3) PK: -27 (dBm/MHz) PK: 68.2(dBV/m) 5725~5850 MHz 15.407(b)(4)(i) PK: -27 (dBm/MHz) *1 PK: 10 (dBm/MHz) *2 PK: 15.6 (dBm/MHz) *3 PK: 27 (dBm/MHz) *4 PK: 68.2(dBV/m) *1 PK: 105.2 (dBV/m) *2 PK: 110.8(dBV/m) *3 PK: 122.2 (dBV/m) *4 15.407(b)(4)(ii) Emission limits in section 15.247(d)
*1 beyond 75 MHz or more above of the band edge.
*3 below the band edge increasing linearly to a level of 15.6 dBm/MHz at 5 MHz above.
*2 below the band edge increasing linearly to 10 dBm/MHz at 25 MHz above.
*4 from 5 MHz above or below the band edge increasing linearly to a level of 27 dBm/MHz at the band edge. Note: The following formula is used to convert the equipment isotropic radiated power (eirp) to field strength:
P V/m, where P is the eirp (Watts). 1000000 3 E =
30 Report No.: RF181023C12-2 Page No. 12 / 24 Report Format Version: 6.1.1 45745 ESIB7 8447D FSP40 100040 Cal. Due Cal. Date 9168-155 HLA 6121 Model No. VULB9168 BBHA 9170 9120D-1170 BBHA 9120D BBHA9170241 Serial No. 100187 May 29, 2018 May 28, 2019 Jun. 14, 2018 Jun. 13, 2019 Nov. 25, 2018 Nov. 24, 2019 Nov. 25, 2018 Nov. 24, 2019 Nov. 21, 2018 Dec. 20, 2019 Sep. 25, 2018 Sep. 24, 2019 4.1.2 Test Instruments Description & Manufacturer Test Receiver ROHDE & SCHWARZ Spectrum Analyzer ROHDE & SCHWARZ BILOG Antenna SCHWARZBECK HORN Antenna SCHWARZBECK HORN Antenna SCHWARZBECK Loop Antenna TESEQ Preamplifier Agilent
(Below 1GHz) Preamplifier KEYSIGHT
(Above 1GHz) RF signal cable HUBER+SUHNER RF signal cable HUBER+SUHNER Software BV ADT Antenna Tower inn-co GmbH Antenna Tower Controller BV ADT Turn Table BV ADT Turn Table Controller BV ADT Boresight Antenna Fixture Pre-amplifier (18GHz-40GHz) EMC Note: 1. The calibration interval of the above test instruments is 12 months and the calibrations are traceable SUCOFLEX 104 Cable-CH4-03 (250724) Aug. 08, 2018 Aug. 07, 2019 ADT_Radiated_ MY 13380+295012/04 Aug. 08, 2018 Aug. 07, 2019 SC93021703 FBA-SIP01 Aug. 08, 2018 Aug. 07, 2019 Nov. 14, 2018 Nov. 13, 2019 V7.6.15.9.5 MA 4000 SC100 FBA-01 SUCOFLEX 104 EMC184045B MY53270295 Jul. 02, 2018 TT93021703 2944A10631 AT93021703 Jul. 01, 2019 NA NA NA NA 83017A 010303 980175 TT100 AT100 NA NA NA NA NA NA NA NA NA to NML/ROC and NIST/USA. 2. The test was performed in HwaYa Chamber 4. 3. The FCC Designation Number is TW0003. The number will be varied with the Lab location and scope as attached. 4. The IC Site Registration No. is 7450F-4. Report No.: RF181023C12-2 Page No. 13 / 24 Report Format Version: 6.1.1 4.1.3 Test Procedures For Radiated emission below 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters above the ground at a 3 meter chamber room. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. Parallel, perpendicular, and ground-parallel orientations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to Quasi-Peak Detect Function and Specified Bandwidth with Maximum Hold Mode. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 9kHz at frequency below 30MHz. For Radiated emission above 30MHz a. The EUT was placed on the top of a rotating table 0.8 meters (for 30MHz ~ 1GHz) / 1.5 meters (for above 1GHz) above the ground at 3 meter chamber room for test. The table was rotated 360 degrees to determine the position of the highest radiation. b. The EUT was set 3 meters away from the interference-receiving antenna, which was mounted on the top of a variable-height antenna tower. c. The height of antenna is varied from one meter to four meters above the ground to determine the maximum value of the field strength. Both horizontal and vertical polarizations of the antenna are set to make the measurement. d. For each suspected emission, the EUT was arranged to its worst case and then the antenna was tuned to heights from 1 meter to 4 meters and the rotatable table was turned from 0 degrees to 360 degrees to find the maximum reading. e. The test-receiver system was set to quasi-peak detect function and specified bandwidth with maximum f. hold mode when the test frequency is below 1 GHz. The test-receiver system was set to peak and average detect function and specified bandwidth with maximum hold mode when the test frequency is above 1 GHz. If the peak reading value also meets average limit, measurement with the average detector is unnecessary. Note:
1. The resolution bandwidth and video bandwidth of test receiver/spectrum analyzer is 120kHz for Quasi-peak detection (QP) at frequency below 1GHz. 2. The resolution bandwidth of test receiver/spectrum analyzer is 1 MHz and the video bandwidth is 3 MHz for Peak detection (PK) at frequency above 1GHz. 3. The resolution bandwidth of test receiver/spectrum analyzer is 1MHz and the video bandwidth is 1/T
(Duty cycle < 98%) or 10Hz (Duty cycle 98%) for Average detection (AV) at frequency above 1GHz. 4. All modes of operation were investigated and the worst-case emissions are reported. 4.1.4 Deviation from Test Standard No deviation. Report No.: RF181023C12-2 Page No. 14 / 24 Report Format Version: 6.1.1 4.1.5 Test Setup For Radiated emission below 30MHz 1 m EUT&
Support Units 80cm 3m Turn Table Ground Plane Test Receiver For Radiated emission 30MHz to 1GHz EUT&
Support Units 80cm 3m 10m Turn Table Ant. Tower 1-4m Variable Ground Plane Test Receiver Report No.: RF181023C12-2 Page No. 15 / 24 Report Format Version: 6.1.1 For Radiated emission above 1GHz EUT&
Support Units 3m Ant. Tower 1-4m Variable Turn Table Absorber 150cm Ground Plane Test Receiver For the actual test configuration, please refer to the attached file (Test Setup Photo). 4.1.6 EUT Operating Conditions a. Placed the EUT on the testing table. b. Prepared a notebook to act as a communication partner and placed it outside of testing area. c. The communication partner connected with EUT via a RJ45 cable and ran a test program (provided by manufacturer) to enable EUT under transmission condition continuously at specific channel frequency. d. The necessary accessories enable the system in full functions. Report No.: RF181023C12-2 Page No. 16 / 24 Report Format Version: 6.1.1 4.1.7 Test Results Above 1GHz data:
802.11g + 802.11a CHANNEL CH 6 + 165 FREQUENCY RANGE 1GHz ~ 40GHz DETECTOR FUNCTION Peak (PK) Average (AV) NO. 1 2 3 4 5 6 7 8 9 10 FREQ.
(MHz)
*2437.00
*2437.00 4874.00 4874.00
#5640.00
*5825.00
*5825.00
#5938.40 11650.00 11650.00 NO. FREQ.
(MHz) 1 2 3 4 5 6 7 8 9 10
*2437.00
*2437.00 4874.00 4874.00
#5643.20
*5825.00
*5825.00
#5927.20 11650.00 11650.00 Remarks:
(m)
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT TABLE ANGLE
(Degree) ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M EMISSION RAW VALUE
(dBuV) 77.2 67.1 40.2 26.8 50.0 79.8 69.4 52.5 40.1 27.1 LEVEL
(dBuV/m) 110.6 PK 100.5 AV 52.6 PK 39.2 AV 62.5 PK 122.6 PK 112.2 AV 66.1 PK 63.0 PK 50.0 AV ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION 1.38 H 1.38 H 2.25 H 2.25 H 1.25 H 1.25 H 1.25 H 1.25 H 2.16 H 2.16 H 214 214 210 210 241 241 241 241 179 179
-21.4
-14.8
-5.7
-2.1
-11.0
-4.0 74.0 54.0 68.2 68.2 74.0 54.0 LIMIT MARGIN ANTENNA HEIGHT TABLE ANGLE
(Degree) LEVEL
(dBuV/m) 116.5 PK 106.4 AV 53.3 PK 40.2 AV 61.7 PK 124.0 PK 113.6 AV 67.0 PK 62.8 PK 50.2 AV
(dBuV/m)
(dB) 74.0 54.0 68.2 68.2 74.0 54.0
-20.7
-13.8
-6.5
-1.2
-11.2
-3.8
(m) 1.82 V 1.82 V 2.55 V 2.55 V 1.97 V 1.97 V 1.97 V 1.97 V 1.42 V 1.42 V 284 284 314 314 180 180 180 180 230 230 RAW VALUE
(dBuV) 83.1 73.0 40.9 27.8 49.2 81.2 70.8 53.4 39.9 27.3 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 12.5 42.8 42.8 13.6 22.9 22.9 CORRECTION FACTOR
(dB/m) 33.4 33.4 12.4 12.4 12.5 42.8 42.8 13.6 22.9 22.9 1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. The other emission levels were very low against the limit. 4. Margin value = Emission Level Limit value 5. " * ": Fundamental frequency. 6. " # ": The radiated frequency is out of the restricted band. Report No.: RF181023C12-2 Page No. 17 / 24 Report Format Version: 6.1.1 Below 1GHz data:
802.11g + 802.11a CHANNEL CH 6 + 165 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) NO. FREQ.
(MHz) 1 2 3 4 5 6 59.06 189.33 261.27 473.20 576.25 811.50
(dB) LIMIT MARGIN
(dBuV/m) ANTENNA HEIGHT ANTENNA POLARITY & TEST DISTANCE: HORIZONTAL AT 3 M RAW EMISSION VALUE
(dBuV) 40.1 34.1 31.2 28.9 28.6 27.3 LEVEL
(dBuV/m) 30.4 QP 23.0 QP 22.0 QP 23.6 QP 25.2 QP 29.3 QP 1.00 H 1.00 H 1.49 H 1.00 H 1.00 H 1.00 H
-9.6
-20.5
-24.0
-22.4
-20.8
-16.7 40.0 43.5 46.0 46.0 46.0 46.0 TABLE ANGLE
(Degree) 62 305 139 154 103 49
(m) CORRECTION FACTOR
(dB/m)
-9.7
-11.1
-9.2
-5.3
-3.4 2.0 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. Margin value = Emission Level Limit value 4. The emission levels were very low against the limit of frequency range 9kHz~30MHz: the amplitude of spurious emissions attenuated more than 20dB below the permissible value to be report. Report No.: RF181023C12-2 Page No. 18 / 24 Report Format Version: 6.1.1 CHANNEL CH 6 + 165 FREQUENCY RANGE 9kHz ~ 1GHz DETECTOR FUNCTION Quasi-Peak (QP) ANTENNA POLARITY & TEST DISTANCE: VERTICAL AT 3 M EMISSION LIMIT MARGIN
(dBuV/m)
(dB) ANTENNA HEIGHT TABLE ANGLE
(Degree) NO. FREQ.
(MHz) 1 2 3 4 5 6 39.62 59.06 138.78 337.10 552.91 650.13 LEVEL
(dBuV/m) 33.7 QP 30.4 QP 24.8 QP 26.1 QP 23.6 QP 26.3 QP 40.0 40.0 43.5 46.0 46.0 46.0
-6.3
-9.6
-18.7
-19.9
-22.4
-19.7
(m) 1.49 V 1.00 V 1.00 V 1.00 V 1.00 V 1.49 V 52 62 185 47 47 9 RAW VALUE
(dBuV) 43.1 40.1 34.1 33.5 27.8 27.9 CORRECTION FACTOR
(dB/m)
-9.4
-9.7
-9.3
-7.4
-4.2
-1.6 Remarks:
1. Emission Level(dBuV/m) = Raw Value(dBuV) + Correction Factor(dB/m) 2. Correction Factor(dB/m) = Antenna Factor(dB/m) + Cable Factor(dB) Pre-Amplifier Factor(dB) 3. Margin value = Emission Level Limit value 4. The emission levels were very low against the limit of frequency range 9kHz~30MHz: the amplitude of spurious emissions attenuated more than 20dB below the permissible value to be report. Report No.: RF181023C12-2 Page No. 19 / 24 Report Format Version: 6.1.1 EUT 4.2 Conducted Out of Band Emission Measurement 4.2.1 Limits of Conducted Out of Band Emission Measurement Below -30dB of the highest emission level of operating band (in 100kHz Resolution Bandwidth). 4.2.2 Test Setup 4.2.3 Test Instruments Refer to section 4.1.2 to get information of above instrument. 4.2.4 Test Procedure MEASUREMENT PROCEDURE REF 1. Set the RBW = 100 kHz. 2. Set the VBW 300 kHz. 3. Detector = average. 4. Sweep time = auto couple. 5. Trace mode = max hold. 6. Allow trace to fully stabilize. 7. Use the peak marker function to determine the maximum power level in any 100 kHz band segment within SPECTRUM ANALYZER Attenuator the fundamental EBW. MEASUREMENT PROCEDURE OOBE 1. Set RBW = 100 kHz. 2. Set VBW 300 kHz. 3. Detector = peak. 4. Sweep = auto couple. 5. Trace Mode = max hold. 6. Allow trace to fully stabilize. 7. Use the peak marker function to determine the maximum amplitude level. 4.2.5 Deviation from Test Standard No deviation. 4.2.6 EUT Operating Condition The software provided by client to enable the EUT under transmission condition continuously at lowest, middle and highest channel frequencies individually. 4.2.7 Test Results The spectrum plots are attached on the following pages. D1 line indicates the highest level, and D2 line indicates the 30dB offset below D1. It shows compliance with the requirement. Report No.: RF181023C12-2 Page No. 20 / 24 Report Format Version: 6.1.1 Worst case: 802.11g: CH 6 + 802.11a: CH 165 Chain 0 Chain 1 Chain 2 Chain 3 Report No.: RF181023C12-2 Page No. 21 / 24 Report Format Version: 6.1.1 5 Pictures of Test Arrangements Please refer to the attached file (Test Setup Photo). Report No.: RF181023C12-2 Page No. 22 / 24 Report Format Version: 6.1.1 Annex A- Radiated Out of Band Emission (OOBE) Measurement (For U-NII-3 band) 802.11g + 802.11a Horizontal CH 6 + 165 Vertical Report No.: RF181023C12-2 Page No. 23 / 24 Report Format Version: 6.1.1 Appendix Information on the Testing Laboratories We, Bureau Veritas Consumer Products Services (H.K.) Ltd., Taoyuan Branch, were founded in 1988 to provide our best service in EMC, Radio, Telecom and Safety consultation. Our laboratories are FCC recognized accredited test firms and accredited and approved according to ISO/IEC 17025. If you have any comments, please feel free to contact us at the following:
Linko EMC/RF Lab Tel: 886-2-26052180 Fax: 886-2-26051924 Hwa Ya EMC/RF/Safety Lab Tel: 886-3-3183232 Fax: 886-3-3270892 Email: service.adt@tw.bureauveritas.com Web Site: www.bureauveritas-adt.com Hsin Chu EMC/RF/Telecom Lab Tel: 886-3-6668565 Fax: 886-3-6668323 The address and road map of all our labs can be found in our web site also.
--- END ---
Report No.: RF181023C12-2 Page No. 24 / 24 Report Format Version: 6.1.1
1 2 3 | RF Test set-up photo | Test Setup Photos | 316.01 KiB | January 20 2019 / July 20 2019 |
PHOTOGRAPHS OF THE TEST CONFIGURATION Radiated Emission Test below 1GHz X-plane Reference No.: 181023C12 Page No. 1 / 5 Z-plane Reference No.: 181023C12 Page No. 2 / 5 Radiated Emission Test Above 1GHz X-plane Reference No.: 181023C12 Page No. 3 / 5 Z-plane Reference No.: 181023C12 Page No. 4 / 5 Conducted Emission Test Reference No.: 181023C12 Page No. 5 / 5
1 2 3 | WIFI Channel description letter | Cover Letter(s) | 417.33 KiB | January 20 2019 |
Netgear Incorporated 350 East Plumeria Drive, San Jose, CA 95134, USA Tel:408-890-3657/Fax:408-907-8097 Date: 1/3/2019 FCC ID: PY318300422 We, Netgear Incorporated declare that the device does not support channel 12 ~ 13 in 2.4GHz band and any non-US channels in all the operational mode(s) for the following product. If you should have any question(s) regarding this declaration, please dont hesitate to contact us. Thank you!
-----------------------------------------------------
David Kay/ Regulatory Compliance Director Netgear Incorporated TEL: 4088903657 FAX: 4089078097 E-mail: david.kay@netgear.com
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2019-02-12 | 5745 ~ 5825 | NII - Unlicensed National Information Infrastructure TX | Class II permissive change or modification of presently authorized equipment |
2 | 2019-01-20 | 2412 ~ 2462 | DTS - Digital Transmission System | Original Equipment |
3 | 5180 ~ 5240 | NII - Unlicensed National Information Infrastructure TX |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 3 | Effective |
2019-02-12
|
||||
1 2 3 |
2019-01-20
|
|||||
1 2 3 | Applicant's complete, legal business name |
Netgear Incorporated
|
||||
1 2 3 | FCC Registration Number (FRN) |
0022158786
|
||||
1 2 3 | Physical Address |
350 East Plumeria Drive
|
||||
1 2 3 |
San Jose, California 95134
|
|||||
1 2 3 |
United States
|
|||||
app s | TCB Information | |||||
1 2 3 | TCB Application Email Address |
t******@siemic.com
|
||||
1 2 3 | TCB Scope |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
||||
app s | FCC ID | |||||
1 2 3 | Grantee Code |
PY3
|
||||
1 2 3 | Equipment Product Code |
18300422
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 3 | Name |
D**** K******
|
||||
1 2 3 | Telephone Number |
40889********
|
||||
1 2 3 | Fax Number |
40890********
|
||||
1 2 3 |
d******@netgear.com
|
|||||
app s | Technical Contact | |||||
n/a | ||||||
app s | Non Technical Contact | |||||
n/a | ||||||
app s | Confidentiality (long or short term) | |||||
1 2 3 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 | If so, specify the short-term confidentiality release date (MM/DD/YYYY format) | 08/11/2019 | ||||
1 2 3 | 07/20/2019 | |||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 3 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 3 | Equipment Class | NII - Unlicensed National Information Infrastructure TX | ||||
1 2 3 | DTS - Digital Transmission System | |||||
1 2 3 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | Nighthawk X4 AC2200 WiFi Mesh Extender, AC1900 WiFi Mesh Extender | ||||
1 2 3 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | Yes | ||||
1 2 3 | No | |||||
1 2 3 | Modular Equipment Type | Does not apply | ||||
1 2 3 | Purpose / Application is for | Class II permissive change or modification of presently authorized equipment | ||||
1 2 3 | Original Equipment | |||||
1 2 3 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | Yes | ||||
1 2 3 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 3 | Grant Comments | C2PC to add DFS bands via software. Power output listed is conducted. Device contains 20/40/80MHz bandwidth and is 4x4 MIMO. The antenna(s) used for this transmitter must be installed to provide a separation distance of at least 21 cm from all persons. | ||||
1 2 3 | Power output listed is conducted. Device contains 20/40MHz bandwidth and is 4x4 MIMO. The antenna(s) used for this transmitter must be installed to provide a separation distance of at least 21 cm from all persons. | |||||
1 2 3 | Power output listed is conducted. Device contains 20/40/80MHz bandwidth and is 4x4 MIMO. The antenna(s) used for this transmitter must be installed to provide a separation distance of at least 21 cm from all persons. | |||||
1 2 3 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 3 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 2 3 | Firm Name |
Bureau Veritas CPS (H.K.) Ltd., Taoyuan Branch
|
||||
1 2 3 |
Bureau Veritas CPS(H.K.) Ltd., Taoyuan Branch
|
|||||
1 2 3 | Name |
K****** L******
|
||||
1 2 3 |
E**** L********
|
|||||
1 2 3 | Telephone Number |
+886-******** Extension:
|
||||
1 2 3 |
+886-********
|
|||||
1 2 3 | Fax Number |
+886-********
|
||||
1 2 3 |
+886-********
|
|||||
1 2 3 |
k******@tw.bureauveritas.com
|
|||||
1 2 3 |
e******@tw.bureauveritas.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 15E | CC MO | 5180 | 5240 | 0.854 | |||||||||||||||||||||||||||||||||||
1 | 2 | 15E | CC MO | 5745 | 5825 | 0.861 | |||||||||||||||||||||||||||||||||||
1 | 3 | 15E | CC MO ND | 5260 | 5320 | 0.231 | |||||||||||||||||||||||||||||||||||
1 | 4 | 15E | CC MO ND | 5500 | 5720 | 0.216 | |||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 15C | CC MO | 2412.00000000 | 2462.00000000 | 0.4160000 | |||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
3 | 1 | 15E | CC MO | 5180 | 5240 | 0.854 | |||||||||||||||||||||||||||||||||||
3 | 2 | 15E | CC MO | 5745 | 5825 | 0.861 |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC