all | frequencies |
|
exhibits | applications |
---|---|---|---|---|
manual |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 3 4 |
|
Users Manual | Users Manual | 1.27 MiB | ||||
1 2 3 4 | Cover Letter(s) | |||||||
1 2 3 4 | External Photos | |||||||
1 2 3 4 | Cover Letter(s) | |||||||
1 2 3 4 | ID Label/Location Info | |||||||
1 2 3 4 | Internal Photos | |||||||
1 2 3 4 | Test Report | |||||||
1 2 3 4 | Test Setup Photos | |||||||
1 2 3 4 | RF Exposure Info | |||||||
1 2 3 4 | Test Setup Photos |
1 2 3 4 | Users Manual | Users Manual | 1.27 MiB |
To install Kies (PC Sync) 1. Download the latest version of Kies from the Samsung website (www.samsung.com/kies) and install it on your PC. Using a USB cable, connect your device to your PC. Double-click the Samsung Kies icon on your PC to launch Samsung Kies. Refer to the Kies help for more information. 2. 3. www.samsung.com/cn Printed in Korea GH68-xxxxxA English (CHN). 12/2011. Rev. 1.0 GT-B9062 user manual
([FHVVLYHH[SRVXUHWRVRXQGDWKLJKYROXPHVFDQFDXVHKHDULQJGDPDJH
$OZD\VWXUQWKHYROXPHGRZQEHIRUHSOXJJLQJWKHHDUSKRQHVLQWRDQDXGLRVRXUFHDQG
XVHRQO\WKHPLQLPXPYROXPHVHWWLQJQHFHVVDU\WRKHDU\RXUFRQYHUVDWLRQRUPXVLF
Install mobile phones and equipment with caution Ensure that any mobile phones or related equipment installed in your vehicle are securely mounted. Avoid placing your phone and accessories near or in an air bag deployment area. Improperly installed wireless equipment can cause serious injury when air bags inflate rapidly. Handle and dispose of batteries and chargers with care z Use only Samsung-approved batteries and chargers specifically designed for your phone. Incompatible batteries and chargers can cause serious injuries or damage to your phone. z Never dispose of batteries or phones in a fire. Follow all local regulations when disposing used batteries or phones. z Never place batteries or phones on or in heating devices, such as microwave ovens, stoves, or radiators. Batteries may explode when overheated. z Never crush or puncture the battery. Avoid exposing the battery to high external pressure, which can lead to an internal short circuit and overheating. Avoid interference with pacemakers Maintain a minimum of 15 cm (6 inches) between mobile phones and pacemakers to avoid potential interference, as recommended by manufacturers and the independent research group, Wireless Technology Research. If you have any reason to suspect that your phone is interfering with a pacemaker or other medical device, turn off the phone immediately and contact the manufacturer of the pacemaker or medical device for guidance. Turn off the phone in potentially explosive environments Do not use your phone at refuelling points (service stations) or near fuels or chemicals. Turn off your phone whenever directed by warning signs or instructions. Your phone could cause explosions or fire in and around fuel or chemical storage and transfer areas or blasting areas. Do not store or carry flammable liquids, gases, or explosive materials in the same compartment as the phone, its parts, or accessories. Reduce the risk of repetitive motion injuries When sending text messages or playing games on your phone, hold the phone with a relaxed grip, press the keys lightly, use special features that reduce the number of keys you have to press (such as templates and predictive text), and take frequent breaks.
Safety precautions
Drive safely at all times Avoid using your phone while driving and obey all regulations that restrict the use of mobile phones while driving. Use hands-free accessories to increase your safety when possible. Follow all safety warnings and regulations Comply with any regulations that restrict the use of a mobile phone in a certain area. Use only Samsung-approved accessories Using incompatible accessories may damage your phone or cause injury. Turn off the phone near medical equipment Your phone can interfere with medical equipment in hospitals or health care facilities. Follow all regulations, posted warnings, and directions from medical personnel. Turn off the phone or disable the wireless functions when in an aircraft Your phone can cause interference with aircraft equipment. Follow all airline regulations and turn off your phone or switch to a mode that disables the wireless functions when directed by airline personnel. Protect batteries and chargers from damage Avoid exposing batteries to very cold or very hot temperatures (below 0 C/32 F or above 45 C/ 113 F). Extreme temperatures can reduce the charging capacity and life of your batteries. Prevent batteries from contacting metal objects, as this can create a connection between the + and - terminals of your batteries and lead to temporary or permanent battery damage. Never use a damaged charger or battery. Handle your phone carefully and sensibly Do not allow your phone to get wetliquids can cause serious damage. Do not handle your phone with wet hands. Water damage to your phone can void your manufacturers warranty. z Avoid using or storing your phone in dusty, dirty areas to prevent damage to moving parts. z Your phone is a complex electronic device protect it from impacts and rough handling to avoid serious damage. z Do not paint your phone, as paint can clog moving parts and prevent proper operation. z Avoid using the phones camera flash or light close to the eyes of children or animals. z Your phone and memory cards may be damaged by exposure to magnetic fields. Do not use carrying cases or accessories with magnetic closures or allow your phone to come in contact with magnetic fields for extended periods of time. Avoid interference with other electronic devices Your phone emits radio frequency (RF) signals that may interfere with unshielded or improperly shielded electronic equipment, such as pacemakers, hearing aids, medical devices, and other electronic devices in homes or vehicles. Consult the manufacturers of your electronic devices to solve any interference problems you experience.
Important usage information Use your phone in the normal position Avoid contact with your phones internal antenna. Allow only qualified personnel to service your phone Allowing unqualified personnel to service your phone may result in damage to your phone and will void your warranty. Ensure maximum battery and charger life z Avoid charging batteries for more than a week, as overcharging may shorten battery life. z Over time, unused batteries will discharge and must be recharged before use. z Disconnect chargers from power sources when not in use. z Use batteries only for their intended purpose. Handle SIM cards and memory cards with care z Do not remove a card while the phone is transferring or accessing information, as this could result in loss of data and/or damage to the card or phone. z Protect cards from strong shocks, static electricity, and electrical noise from other devices. z Frequent writing and erasing will shorten the life span of memory cards. z Do not touch gold-coloured contacts or terminals with your fingers or metal objects. If dirty, wipe the card with a soft cloth. Ensure access to emergency services Emergency calls from your phone may not be possible in some areas or circumstances. Before travelling in remote or undeveloped areas, plan an alternate method of contacting emergency services personnel. Health and safety information
([SRVXUHWR5DGLR)UHTXHQF\5)6LJQDOV
&HUWLILFDWLRQ,QIRUPDWLRQ6$5
<RXUZLUHOHVVSKRQHLVDUDGLRWUDQVPLWWHUDQGUHFHLYHU,WLVGHVLJQHGDQG
PDQXIDFWXUHGQRWWRH[FHHGWKHH[SRVXUHOLPLWVIRUUDGLRIUHTXHQF\5)
HQHUJ\VHWE\WKH)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&RIWKH86
JRYHUQPHQW7KHVH)&&H[SRVXUHOLPLWVDUHGHULYHGIURPWKH
UHFRPPHQGDWLRQVRIWZRH[SHUWRUJDQL]DWLRQVWKH1DWLRQDO&RXQVHORQ
5DGLDWLRQ3URWHFWLRQDQG0HDVXUHPHQW1&53DQGWKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLFV(QJLQHHUV,(((,QERWKFDVHVWKH
UHFRPPHQGDWLRQVZHUHGHYHORSHGE\VFLHQWLILFDQGHQJLQHHULQJH[SHUWV
GUDZQIURPLQGXVWU\JRYHUQPHQWDQGDFDGHPLDDIWHUH[WHQVLYHUHYLHZV
RIWKHVFLHQWLILFOLWHUDWXUHUHODWHGWRWKHELRORJLFDOHIIHFWVRI5)HQHUJ\
7KHH[SRVXUHOLPLWVHWE\WKH)&&IRUZLUHOHVVPRELOHSKRQHVHPSOR\VD
XQLWRIPHDVXUHPHQWNQRZQDVWKH6SHFLILF$EVRUSWLRQ5DWH6$57KH
6$5LVDPHDVXUHRIWKHUDWHRIDEVRUSWLRQRI5)HQHUJ\E\WKHKXPDQ
ERG\H[SUHVVHGLQXQLWVRIZDWWVSHUNLORJUDP:NJ7KH)&&UHTXLUHV
ZLUHOHVVSKRQHVWRFRPSO\ZLWKDVDIHW\OLPLWRIZDWWVSHUNLORJUDP
:NJ7KH)&&H[SRVXUHOLPLWLQFRUSRUDWHVDVXEVWDQWLDOPDUJLQRI
VDIHW\WRJLYHDGGLWLRQDOSURWHFWLRQWRWKHSXEOLFDQGWRDFFRXQWIRUDQ\
YDULDWLRQVLQPHDVXUHPHQWV
6$5WHVWVDUHFRQGXFWHGXVLQJVWDQGDUGRSHUDWLQJSRVLWLRQVDFFHSWHGE\
WKH)&&ZLWKWKHSKRQHWUDQVPLWWLQJDWLWVKLJKHVWFHUWLILHGSRZHUOHYHOLQ
DOOWHVWHGIUHTXHQF\EDQGV$OWKRXJKWKH6$5LVGHWHUPLQHGDWWKHKLJKHVW
FHUWLILHGSRZHUOHYHOWKHDFWXDO6$5OHYHORIWKHSKRQHZKLOHRSHUDWLQJ
FDQEHZHOOEHORZWKHPD[LPXPYDOXH7KLVLVEHFDXVHWKHSKRQHLV
GHVLJQHGWRRSHUDWHDWPXOWLSOHSRZHUOHYHOVVRDVWRXVHRQO\WKHSRZHU
UHTXLUHGWRUHDFKWKHQHWZRUN,QJHQHUDOWKHFORVHU\RXDUHWRDZLUHOHVV
EDVHVWDWLRQDQWHQQDWKHORZHUWKHSRZHURXWSXW
%HIRUHDQHZPRGHOSKRQHLVDYDLODEOHIRUVDOHWRWKHSXEOLFLWPXVWEH
WHVWHGDQGFHUWLILHGWRWKH)&&WKDWLWGRHVQRWH[FHHGWKHH[SRVXUHOLPLW
HVWDEOLVKHGE\WKH)&&7HVWVIRUHDFKPRGHOSKRQHDUHSHUIRUPHGLQ
SRVLWLRQVDQGORFDWLRQVHJDWWKHHDUDQGZRUQRQWKHERG\DVUHTXLUHG
E\WKH)&&
)RUERG\ZRUQRSHUDWLRQWKLVPRGHOSKRQHKDVEHHQWHVWHGDQGPHHWV
WKH)&&5)H[SRVXUHJXLGHOLQHVZKHQXVHGZLWKD6DPVXQJDFFHVVRU\
GHVLJQDWHGIRUWKLVSURGXFWRUZKHQXVHGZLWKDQDFFHVVRU\WKDWFRQWDLQV
QRPHWDODQGWKDWSRVLWLRQVWKHKDQGVHWDPLQLPXPRIFPIURPWKH
ERG\
1RQFRPSOLDQFHZLWKWKHDERYHUHVWULFWLRQVPD\UHVXOWLQYLRODWLRQRI)&&
5)H[SRVXUHJXLGHOLQHV
6$5LQIRUPDWLRQRQWKLVDQGRWKHUPRGHOSKRQHVFDQEHYLHZHGRQOLQHDW
7KLVVLWHXVHVWKHSKRQH)&&,'QXPEHU
$/*7B90626RPHWLPHVLWPD\EHQHFHVVDU\WRUHPRYHWKHEDWWHU\SDFN
WRILQGWKHQXPEHU2QFH\RXKDYHWKH)&&,'QXPEHUIRUDSDUWLFXODU
SKRQHIROORZWKHLQVWUXFWLRQVRQWKHZHEVLWHDQGLWVKRXOGSURYLGHYDOXHV
IRUW\SLFDORUPD[LPXP6$5IRUDSDUWLFXODUSKRQH$GGLWLRQDOSURGXFW
VSHFLILF6$5LQIRUPDWLRQFDQDOVREHREWDLQHGDWZZZIFFJRYFJEVDU
&RQVXPHU,QIRUPDWLRQRQ:LUHOHVV3KRQHV
7KH86)RRGDQG'UXJ$GPLQLVWUDWLRQ)'$KDVSXEOLVKHGDVHULHVRI
4XHVWLRQVDQG$QVZHUVIRUFRQVXPHUVUHODWLQJWRUDGLRIUHTXHQF\5)
H[SRVXUHIURPZLUHOHVVSKRQHV7KH)'$SXEOLFDWLRQLQFOXGHVWKH
IROORZLQJLQIRUPDWLRQ
:KDWNLQGVRISKRQHVDUHWKHVXEMHFWRIWKLVXSGDWH"
7KHWHUPZLUHOHVVSKRQHUHIHUVKHUHWRKDQGKHOGZLUHOHVVSKRQHVZLWK
EXLOWLQDQWHQQDVRIWHQFDOOHGFHOOPRELOHRU3&6SKRQHV7KHVH
W\SHVRIZLUHOHVVSKRQHVFDQH[SRVHWKHXVHUWRPHDVXUDEOHUDGLR
IUHTXHQF\HQHUJ\5)EHFDXVHRIWKHVKRUWGLVWDQFHEHWZHHQWKHSKRQH
DQGWKHXVHU VKHDG7KHVH5)H[SRVXUHVDUHOLPLWHGE\)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQVDIHW\JXLGHOLQHVWKDWZHUHGHYHORSHGZLWK
WKHDGYLFHRI)'$DQGRWKHUIHGHUDOKHDOWKDQGVDIHW\DJHQFLHV:KHQWKH
SKRQHLVORFDWHGDWJUHDWHUGLVWDQFHVIURPWKHXVHUWKHH[SRVXUHWR5)LV
GUDVWLFDOO\ORZHUEHFDXVHDSHUVRQ V5)H[SRVXUHGHFUHDVHVUDSLGO\ZLWK
LQFUHDVLQJGLVWDQFHIURPWKHVRXUFH7KHVRFDOOHGFRUGOHVVSKRQHV
ZKLFKKDYHDEDVHXQLWFRQQHFWHGWRWKHWHOHSKRQHZLULQJLQDKRXVH
W\SLFDOO\RSHUDWHDWIDUORZHUSRZHUOHYHOVDQGWKXVSURGXFH5)
H[SRVXUHVZHOOZLWKLQWKH)&&
VFRPSOLDQFHOLPLWV
'RZLUHOHVVSKRQHVSRVHDKHDOWKKD]DUG"
7KHDYDLODEOHVFLHQWLILFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPV
DUHDVVRFLDWHGZLWKXVLQJZLUHOHVVSKRQHV7KHUHLVQRSURRIKRZHYHU
WKDWZLUHOHVVSKRQHVDUHDEVROXWHO\VDIH:LUHOHVVSKRQHVHPLWORZOHYHOV
RIUDGLRIUHTXHQF\HQHUJ\5)LQWKHPLFURZDYHUDQJHZKLOHEHLQJXVHG
7KH\DOVRHPLWYHU\ORZOHYHOVRI5)ZKHQLQWKHVWDQGE\PRGH:KHUHDV
KLJKOHYHOVRI5)FDQSURGXFHKHDOWKHIIHFWVE\KHDWLQJWLVVXHH[SRVXUH
WRORZOHYHO5)WKDWGRHVQRWSURGXFHKHDWLQJHIIHFWVFDXVHVQRNQRZQ
DGYHUVHKHDOWKHIIHFWV0DQ\VWXGLHVRIORZOHYHO5)H[SRVXUHVKDYHQRW
IRXQGDQ\ELRORJLFDOHIIHFWV6RPHVWXGLHVKDYHVXJJHVWHGWKDWVRPH
ELRORJLFDOHIIHFWVPD\RFFXUEXWVXFKILQGLQJVKDYHQRWEHHQFRQILUPHG
E\DGGLWLRQDOUHVHDUFK,QVRPHFDVHVRWKHUUHVHDUFKHUVKDYHKDG
GLIILFXOW\LQUHSURGXFLQJWKRVHVWXGLHVRULQGHWHUPLQLQJWKHUHDVRQVIRU
LQFRQVLVWHQWUHVXOWV
:KDWLV)'$
VUROHFRQFHUQLQJWKHVDIHW\RIZLUHOHVVSKRQHV"
8QGHUWKHODZ)'$GRHVQRWUHYLHZWKHVDIHW\RIUDGLDWLRQHPLWWLQJ
FRQVXPHUSURGXFWVVXFKDVZLUHOHVVSKRQHVEHIRUHWKH\FDQEHVROGDVLW
GRHVZLWKQHZGUXJVRUPHGLFDOGHYLFHV+RZHYHUWKHDJHQF\KDV
DXWKRULW\WRWDNHDFWLRQLIZLUHOHVVSKRQHVDUHVKRZQWRHPLWUDGLR
IUHTXHQF\HQHUJ\5)DWDOHYHOWKDWLVKD]DUGRXVWRWKHXVHU,QVXFKD
FDVH)'$FRXOGUHTXLUHWKHPDQXIDFWXUHUVRIZLUHOHVVSKRQHVWRQRWLI\
XVHUVRIWKHKHDOWKKD]DUGDQGWRUHSDLUUHSODFHRUUHFDOOWKHSKRQHVVR
WKDWWKHKD]DUGQRORQJHUH[LVWV
$OWKRXJKWKHH[LVWLQJVFLHQWLILFGDWDGRQRWMXVWLI\)'$UHJXODWRU\DFWLRQV
)'$KDVXUJHGWKHZLUHOHVVSKRQHLQGXVWU\WRWDNHDQXPEHURIVWHSV
LQFOXGLQJWKHIROORZLQJ
z 6XSSRUWQHHGHGUHVHDUFKLQWRSRVVLEOHELRORJLFDOHIIHFWVRI5)RI
WKHW\SHHPLWWHGE\ZLUHOHVVSKRQHV
z 'HVLJQZLUHOHVVSKRQHVLQDZD\WKDWPLQLPL]HVDQ\5)H[SRVXUH
WRWKHXVHUWKDWLVQRWQHFHVVDU\IRUGHYLFHIXQFWLRQDQG
z &RRSHUDWHLQSURYLGLQJXVHUVRIZLUHOHVVSKRQHVZLWKWKHEHVW
SRVVLEOHLQIRUPDWLRQRQSRVVLEOHHIIHFWVRIZLUHOHVVSKRQHXVHRQ
KXPDQKHDOWK
)'$EHORQJVWRDQLQWHUDJHQF\ZRUNLQJJURXSRIWKHIHGHUDODJHQFLHVWKDW
KDYHUHVSRQVLELOLW\IRUGLIIHUHQWDVSHFWVRI5)VDIHW\WRHQVXUHFRRUGLQDWHG
HIIRUWVDWWKHIHGHUDOOHYHO7KHIROORZLQJDJHQFLHVEHORQJWRWKLVZRUNLQJ
JURXS
z 1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK
z (QYLURQPHQWDO3URWHFWLRQ$JHQF\
z )HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ
z 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ
z 1DWLRQDO7HOHFRPPXQLFDWLRQVDQG,QIRUPDWLRQ$GPLQLVWUDWLRQ
7KH1DWLRQDO,QVWLWXWHVRI+HDOWKSDUWLFLSDWHVLQVRPHLQWHUDJHQF\ZRUNLQJ
JURXSDFWLYLWLHVDVZHOO
)'$VKDUHVUHJXODWRU\UHVSRQVLELOLWLHVIRUZLUHOHVVSKRQHVZLWKWKH)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQ)&&$OOSKRQHVWKDWDUHVROGLQWKH8QLWHG
6WDWHVPXVWFRPSO\ZLWK)&&VDIHW\JXLGHOLQHVWKDWOLPLW5)H[SRVXUH
)&&UHOLHVRQ)'$DQGRWKHUKHDOWKDJHQFLHVIRUVDIHW\TXHVWLRQVDERXW
ZLUHOHVVSKRQHV
)&&DOVRUHJXODWHVWKHEDVHVWDWLRQVWKDWWKHZLUHOHVVSKRQHQHWZRUNV
UHO\XSRQ:KLOHWKHVHEDVHVWDWLRQVRSHUDWHDWKLJKHUSRZHUWKDQGRWKH
ZLUHOHVVSKRQHVWKHPVHOYHVWKH5)H[SRVXUHVWKDWSHRSOHJHWIURPWKHVH
EDVHVWDWLRQVDUHW\SLFDOO\WKRXVDQGVRIWLPHVORZHUWKDQWKRVHWKH\FDQ
JHWIURPZLUHOHVVSKRQHV%DVHVWDWLRQVDUHWKXVQRWWKHSULPDU\VXEMHFW
RIWKHVDIHW\TXHVWLRQVGLVFXVVHGLQWKLVGRFXPHQW
:KDWDUHWKHUHVXOWVRIWKHUHVHDUFKGRQHDOUHDG\"
7KHUHVHDUFKGRQHWKXVIDUKDVSURGXFHGFRQIOLFWLQJUHVXOWVDQGPDQ\
VWXGLHVKDYHVXIIHUHGIURPIODZVLQWKHLUUHVHDUFKPHWKRGV$QLPDO
H[SHULPHQWVLQYHVWLJDWLQJWKHHIIHFWVRIUDGLRIUHTXHQF\HQHUJ\5)
H[SRVXUHVFKDUDFWHULVWLFRIZLUHOHVVSKRQHVKDYH\LHOGHGFRQIOLFWLQJ
UHVXOWVWKDWRIWHQFDQQRWEHUHSHDWHGLQRWKHUODERUDWRULHV$IHZDQLPDO
VWXGLHVKRZHYHUKDYHVXJJHVWHGWKDWORZOHYHOVRI5)FRXOGDFFHOHUDWH
WKHGHYHORSPHQWRIFDQFHULQODERUDWRU\DQLPDOV+RZHYHUPDQ\RIWKH
VWXGLHVWKDWVKRZHGLQFUHDVHGWXPRUGHYHORSPHQWXVHGDQLPDOVWKDWKDG
EHHQJHQHWLFDOO\HQJLQHHUHGRUWUHDWHGZLWKFDQFHUFDXVLQJFKHPLFDOVVR
DVWREHSUHGLVSRVHGWRGHYHORSFDQFHULQDEVHQFHRI5)H[SRVXUH2WKHU
VWXGLHVH[SRVHGWKHDQLPDOVWR5)IRUXSWRKRXUVSHUGD\7KHVH
FRQGLWLRQVDUHQRWVLPLODUWRWKHFRQGLWLRQVXQGHUZKLFKSHRSOHXVH
ZLUHOHVVSKRQHVVRZHGRQ WNQRZZLWKFHUWDLQW\ZKDWWKHUHVXOWVRIVXFK
VWXGLHVPHDQIRUKXPDQKHDOWK
7KUHHODUJHHSLGHPLRORJ\VWXGLHVKDYHEHHQSXEOLVKHGVLQFH'HFHPEHU
%HWZHHQWKHPWKHVWXGLHVLQYHVWLJDWHGDQ\SRVVLEOHDVVRFLDWLRQ
EHWZHHQWKHXVHRIZLUHOHVVSKRQHVDQGSULPDU\EUDLQFDQFHUJOLRPD
PHQLQJLRPDRUDFRXVWLFQHXURPDWXPRUVRIWKHEUDLQRUVDOLYDU\JODQG
OHXNHPLDRURWKHUFDQFHUV1RQHRIWKHVWXGLHVGHPRQVWUDWHGWKH
H[LVWHQFHRIDQ\KDUPIXOKHDOWKHIIHFWVIURPZLUHOHVVSKRQHV5)
H[SRVXUHV+RZHYHUQRQHRIWKHVWXGLHVFDQDQVZHUTXHVWLRQVDERXW
ORQJWHUPH[SRVXUHVVLQFHWKHDYHUDJHSHULRGRISKRQHXVHLQWKHVH
VWXGLHVZDVDURXQGWKUHH\HDUV
:KDWUHVHDUFKLVQHHGHGWRGHFLGHZKHWKHU5)H[SRVXUHIURP
ZLUHOHVVSKRQHVSRVHVDKHDOWKULVN"
$FRPELQDWLRQRIODERUDWRU\VWXGLHVDQGHSLGHPLRORJLFDOVWXGLHVRISHRSOH
DFWXDOO\XVLQJZLUHOHVVSKRQHVZRXOGSURYLGHVRPHRIWKHGDWDWKDWDUH
QHHGHG/LIHWLPHDQLPDOH[SRVXUHVWXGLHVFRXOGEHFRPSOHWHGLQDIHZ
\HDUV+RZHYHUYHU\ODUJHQXPEHUVRIDQLPDOVZRXOGEHQHHGHGWR
SURYLGHUHOLDEOHSURRIRIDFDQFHUSURPRWLQJHIIHFWLIRQHH[LVWV
(SLGHPLRORJLFDOVWXGLHVFDQSURYLGHGDWDWKDWLVGLUHFWO\DSSOLFDEOHWR
KXPDQSRSXODWLRQVEXWWHQRUPRUH\HDUV
IROORZXSPD\EHQHHGHGWR
SURYLGHDQVZHUVDERXWVRPHKHDOWKHIIHFWVVXFKDVFDQFHU7KLVLV
EHFDXVHWKHLQWHUYDOEHWZHHQWKHWLPHRIH[SRVXUHWRDFDQFHUFDXVLQJ
DJHQWDQGWKHWLPHWXPRUVGHYHORSLIWKH\GRPD\EHPDQ\PDQ\
\HDUV7KHLQWHUSUHWDWLRQRIHSLGHPLRORJLFDOVWXGLHVLVKDPSHUHGE\
GLIILFXOWLHVLQPHDVXULQJDFWXDO5)H[SRVXUHGXULQJGD\WRGD\XVHRI
ZLUHOHVVSKRQHV0DQ\IDFWRUVDIIHFWWKLVPHDVXUHPHQWVXFKDVWKHDQJOH
DWZKLFKWKHSKRQHLVKHOGRUZKLFKPRGHORISKRQHLVXVHG
:KDWLV)'$GRLQJWRILQGRXWPRUHDERXWWKHSRVVLEOHKHDOWK
HIIHFWVRIZLUHOHVVSKRQH5)"
)'$LVZRUNLQJZLWKWKH861DWLRQDO7R[LFRORJ\3URJUDPDQGZLWK
JURXSVRILQYHVWLJDWRUVDURXQGWKHZRUOGWRHQVXUHWKDWKLJKSULRULW\
DQLPDOVWXGLHVDUHFRQGXFWHGWRDGGUHVVLPSRUWDQWTXHVWLRQVDERXWWKH
HIIHFWVRIH[SRVXUHWRUDGLRIUHTXHQF\HQHUJ\5)
)'$KDVEHHQDOHDGLQJSDUWLFLSDQWLQWKH:RUOG+HDOWK2UJDQL]DWLRQ
LQWHUQDWLRQDO(OHFWURPDJQHWLF)LHOGV(0)3URMHFWVLQFHLWVLQFHSWLRQLQ
$QLQIOXHQWLDOUHVXOWRIWKLVZRUNKDVEHHQWKHGHYHORSPHQWRID
GHWDLOHGDJHQGDRIUHVHDUFKQHHGVWKDWKDVGULYHQWKHHVWDEOLVKPHQWRI
QHZUHVHDUFKSURJUDPVDURXQGWKHZRUOG7KH3URMHFWKDVDOVRKHOSHG
GHYHORSDVHULHVRISXEOLFLQIRUPDWLRQGRFXPHQWVRQ(0)LVVXHV
)'$DQG&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW$VVRFLDWLRQ&7,$KDYH
DIRUPDO&RRSHUDWLYH5HVHDUFKDQG'HYHORSPHQW$JUHHPHQW&5$'$WR
GRUHVHDUFKRQZLUHOHVVSKRQHVDIHW\)'$SURYLGHVWKHVFLHQWLILF
RYHUVLJKWREWDLQLQJLQSXWIURPH[SHUWVLQJRYHUQPHQWLQGXVWU\DQG
DFDGHPLFRUJDQL]DWLRQV&7,$IXQGHGUHVHDUFKLVFRQGXFWHGWKURXJK
FRQWUDFWVWRLQGHSHQGHQWLQYHVWLJDWRUV7KHLQLWLDOUHVHDUFKZLOOLQFOXGH
ERWKODERUDWRU\VWXGLHVDQGVWXGLHVRIZLUHOHVVSKRQHXVHUV7KH&5$'$
ZLOODOVRLQFOXGHDEURDGDVVHVVPHQWRIDGGLWLRQDOUHVHDUFKQHHGVLQWKH
FRQWH[WRIWKHODWHVWUHVHDUFKGHYHORSPHQWVDURXQGWKHZRUOG
:KDWVWHSVFDQ,WDNHWRUHGXFHP\H[SRVXUHWRUDGLRIUHTXHQF\
HQHUJ\IURPP\ZLUHOHVVSKRQH"
,IWKHUHLVDULVNIURPWKHVHSURGXFWVDQGDWWKLVSRLQWZHGRQRWNQRZ
WKDWWKHUHLVLWLVSUREDEO\YHU\VPDOO%XWLI\RXDUHFRQFHUQHGDERXW
DYRLGLQJHYHQSRWHQWLDOULVNV\RXFDQWDNHDIHZVLPSOHVWHSVWRPLQLPL]H
\RXUH[SRVXUHWRUDGLRIUHTXHQF\HQHUJ\5)6LQFHWLPHLVDNH\IDFWRU
LQKRZPXFKH[SRVXUHDSHUVRQUHFHLYHVUHGXFLQJWKHDPRXQWRIWLPH
VSHQWXVLQJDZLUHOHVVSKRQHZLOOUHGXFH5)H[SRVXUH
z ,I\RXPXVWFRQGXFWH[WHQGHGFRQYHUVDWLRQVE\ZLUHOHVVSKRQH
HYHU\GD\\RXFRXOGSODFHPRUHGLVWDQFHEHWZHHQ\RXUERG\DQG
WKHVRXUFHRIWKH5)VLQFHWKHH[SRVXUHOHYHOGURSVRII
GUDPDWLFDOO\ZLWKGLVWDQFH)RUH[DPSOH\RXFRXOGXVHDKHDGVHW
DQGFDUU\WKHZLUHOHVVSKRQHDZD\IURP\RXUERG\.
$JDLQWKHVFLHQWLILFGDWDGRQRWGHPRQVWUDWHWKDWZLUHOHVVSKRQHVDUH
KDUPIXO%XWLI\RXDUHFRQFHUQHGDERXWWKH5)H[SRVXUHIURPWKHVH
SURGXFWV\RXFDQXVHPHDVXUHVOLNHWKRVHGHVFULEHGDERYHWRUHGXFH
\RXU5)H[SRVXUHIURPZLUHOHVVSKRQHXVH
:KDWDERXWFKLOGUHQXVLQJZLUHOHVVSKRQHV"
7KHVFLHQWLILFHYLGHQFHGRHVQRWVKRZDGDQJHUWRXVHUVRIZLUHOHVV
SKRQHVLQFOXGLQJFKLOGUHQDQGWHHQDJHUV,I\RXZDQWWRWDNHVWHSVWR
ORZHUH[SRVXUHWRUDGLRIUHTXHQF\HQHUJ\5)WKHPHDVXUHVGHVFULEHG
DERYHZRXOGDSSO\WRFKLOGUHQDQGWHHQDJHUVXVLQJZLUHOHVVSKRQHV
5HGXFLQJWKHWLPHRIZLUHOHVVSKRQHXVHDQGLQFUHDVLQJWKHGLVWDQFH
EHWZHHQWKHXVHUDQGWKH5)VRXUFHZLOOUHGXFH5)H[SRVXUH
6RPHJURXSVVSRQVRUHGE\RWKHUQDWLRQDOJRYHUQPHQWVKDYHDGYLVHGWKDW
FKLOGUHQEHGLVFRXUDJHGIURPXVLQJZLUHOHVVSKRQHVDWDOO)RUH[DPSOH
WKHJRYHUQPHQWLQWKH8QLWHG.LQJGRPGLVWULEXWHGOHDIOHWVFRQWDLQLQJVXFK
DUHFRPPHQGDWLRQLQ'HFHPEHU7KH\QRWHGWKDWQRHYLGHQFHH[LVWV
WKDWXVLQJDZLUHOHVVSKRQHFDXVHVEUDLQWXPRUVRURWKHULOOHIIHFWV7KHLU
UHFRPPHQGDWLRQWROLPLWZLUHOHVVSKRQHXVHE\FKLOGUHQZDVVWULFWO\
SUHFDXWLRQDU\LWZDVQRWEDVHGRQVFLHQWLILFHYLGHQFHWKDWDQ\KHDOWK
KD]DUGH[LVWV
'RKDQGVIUHHNLWVIRUZLUHOHVVSKRQHVUHGXFHULVNVIURPH[SRVXUH
WR5)HPLVVLRQV"
6LQFHWKHUHDUHQRNQRZQULVNVIURPH[SRVXUHWR5)HPLVVLRQVIURP
ZLUHOHVVSKRQHVWKHUHLVQRUHDVRQWREHOLHYHWKDWKDQGVIUHHNLWVUHGXFH
ULVNV+DQGVIUHHNLWVFDQEHXVHGZLWKZLUHOHVVSKRQHVIRUFRQYHQLHQFH
DQGFRPIRUW7KHVHV\VWHPVUHGXFHWKHDEVRUSWLRQRI5)HQHUJ\LQWKH
KHDGEHFDXVHWKHSKRQHZKLFKLVWKHVRXUFHRIWKH5)HPLVVLRQVZLOOQRW
EHSODFHGDJDLQVWWKHKHDG2QWKHRWKHUKDQGLIWKHSKRQHLVPRXQWHG
DJDLQVWWKHZDLVWRURWKHUSDUWRIWKHERG\GXULQJXVHWKHQWKDWSDUWRI
WKHERG\ZLOODEVRUEPRUH5)HQHUJ\:LUHOHVVSKRQHVPDUNHWHGLQWKH
86DUHUHTXLUHGWRPHHWVDIHW\UHTXLUHPHQWVUHJDUGOHVVRIZKHWKHUWKH\
DUHXVHGDJDLQVWWKHKHDGRUDJDLQVWWKHERG\(LWKHUFRQILJXUDWLRQVKRXOG
UHVXOWLQFRPSOLDQFHZLWKWKHVDIHW\OLPLW
'RZLUHOHVVSKRQHDFFHVVRULHVWKDWFODLPWRVKLHOGWKHKHDGIURP
5)UDGLDWLRQZRUN"
6LQFHWKHUHDUHQRNQRZQULVNVIURPH[SRVXUHWR5)HPLVVLRQVIURP
ZLUHOHVVSKRQHVWKHUHLVQRUHDVRQWREHOLHYHWKDWDFFHVVRULHVWKDWFODLP
WRVKLHOGWKHKHDGIURPWKRVHHPLVVLRQVUHGXFHULVNV6RPHSURGXFWVWKDW
FODLPWRVKLHOGWKHXVHUIURP5)DEVRUSWLRQXVHVSHFLDOSKRQHFDVHVZKLOH
RWKHUVLQYROYHQRWKLQJPRUHWKDQDPHWDOOLFDFFHVVRU\DWWDFKHGWRWKH
SKRQH6WXGLHVKDYHVKRZQWKDWWKHVHSURGXFWVJHQHUDOO\GRQRWZRUNDV
DGYHUWLVHG8QOLNHKDQGIUHHNLWVWKHVHVRFDOOHGVKLHOGVPD\LQWHUIHUH
ZLWKSURSHURSHUDWLRQRIWKHSKRQH7KHSKRQHPD\EHIRUFHGWRERRVWLWV
SRZHUWRFRPSHQVDWHOHDGLQJWRDQLQFUHDVHLQ5)DEVRUSWLRQ,Q
)HEUXDU\WKH)HGHUDOWUDGH&RPPLVVLRQ)7&FKDUJHGWZR
FRPSDQLHVWKDWVROGGHYLFHVWKDWFODLPHGWRSURWHFWZLUHOHVVSKRQHXVHUV
IURPUDGLDWLRQZLWKPDNLQJIDOVHDQGXQVXEVWDQWLDWHGFODLPV$FFRUGLQJWR
)7&WKHVHGHIHQGDQWVODFNHGDUHDVRQDEOHEDVLVWRVXEVWDQWLDWHWKHLU
FODLP
:KDWDERXWZLUHOHVVSKRQHLQWHUIHUHQFHZLWKPHGLFDOHTXLSPHQW"
5DGLRIUHTXHQF\HQHUJ\5)IURPZLUHOHVVSKRQHVFDQLQWHUDFWZLWKVRPH
HOHFWURQLFGHYLFHV)RUWKLVUHDVRQ)'$KHOSHGGHYHORSDGHWDLOHGWHVW
PHWKRGWRPHDVXUHHOHFWURPDJQHWLFLQWHUIHUHQFH(0,RILPSODQWHG
FDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVIURPZLUHOHVVWHOHSKRQHV7KLVWHVW
PHWKRGLVQRZSDUWRIDVWDQGDUGVSRQVRUHGE\WKH$VVRFLDWLRQIRUWKH
$GYDQFHPHQWRI0HGLFDOLQVWUXPHQWDWLRQ$$0,7KHILQDOGUDIWDMRLQW
HIIRUWE\)'$PHGLFDOGHYLFHPDQXIDFWXUHUVDQGPDQ\RWKHUJURXSV
ZDVFRPSOHWHGLQODWH7KLVVWDQGDUGZLOODOORZPDQXIDFWXUHUVWR
HQVXUHWKDWFDUGLDFSDFHPDNHUVDQGGHILEULOODWRUVDUHVDIHIURPZLUHOHVV
SKRQH(0,)'$KDVWHVWHGZLUHOHVVSKRQHVDQGKHOSHGGHYHORSD
YROXQWDU\VWDQGDUGVSRQVRUHGE\WKH,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLF
(QJLQHHUV,(((7KLVVWDQGDUGVSHFLILHVWHVWPHWKRGVDQGSHUIRUPDQFH
UHTXLUHPHQWVIRUKHDULQJDLGVDQGZLUHOHVVSKRQHVVRWKDWQRLQWHUIHUHQFH
RFFXUVZKHQDSHUVRQXVHVDFRPSDWLEOHSKRQHDQGDFRPSDWLEOHKHDULQJ
DLGDWWKHVDPHWLPH7KLVVWDQGDUGZDVDSSURYHGE\WKH,(((LQ
)'$FRQWLQXHVWRPRQLWRUWKHXVHRIZLUHOHVVSKRQHVIRUSRVVLEOH
LQWHUDFWLRQVZLWKRWKHUPHGLFDOGHYLFHV6KRXOGKDUPIXOLQWHUIHUHQFHEH
IRXQGWRRFFXU)'$ZLOOFRQGXFWWHVWLQJWRDVVHVVWKHLQWHUIHUHQFHDQG
ZRUNWRUHVROYHWKHSUREOHP
$GGLWLRQDOLQIRUPDWLRQRQWKHVDIHW\RI5)H[SRVXUHVIURPYDULRXVVRXUFHV
FDQEHREWDLQHGIURPWKHIROORZLQJRUJDQL]DWLRQV
z )&&5)6DIHW\3URJUDP
KWWS
ZZZIFFJRYRHWUIVDIHW\
z (QYLURQPHQWDO3URWHFWLRQ$JHQF\(3$
KWWSZZZHSDJR YUDGLDWLRQ
z 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ V26+$
KWWSZZZRVKDJRY6/7&UDGLRIUHTXHQF\UDGLDWLRQLQGH[KWPO
z 1DWLRQDOLQVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK1,26+
KWWSZZZFGFJRYQLRVKH PISJKWPO
z :RUOGKHDOWK2UJDQL]DWLRQ:+2
KWWSZZZZKRL QWSHKHPI
KWWS
KWWS
ZZZLFQLUSGH
ZZZQUSERUJXN
z 1DWLRQDO5DGLDWLRQ3URWHFWLRQ%RDUG8.
z ,QWHUQDWLRQDO&RPPLVVLRQRQ1RQ,RQL]LQJ5DGLDWLRQ3URWHFWLRQ
z 8SGDWHG86IRRGDQG'UXJ$GPLQLVWUDWLRQ
5RDG6DIHW\
<RXUZLUHOHVVSKRQHJLYHV\RXWKHSRZHUIXODELOLW\WRFRPPXQLFDWHE\
YRLFHDOPRVWDQ\ZKHUHDQ\WLPH%XWDQLPSRUWDQWUHVSRQVLELOLW\
DFFRPSDQLHVWKHEHQHILWVRIZLUHOHVVSKRQHVRQHWKDWHYHU\XVHUPXVW
XSKROG
:KHQGULYLQJDFDUGULYLQJLV\RXUILUVWUHVSRQVLELOLW\:KHQXVLQJ\RXU
ZLUHOHVVSKRQHEHKLQGWKHZKHHORIDFDUSUDFWLFHJRRGFRPPRQVHQVH
DQGUHPHPEHUWKHIROORZLQJWLSV
*HWWRNQRZ\RXUZLUHOHVVSKRQHDQGLWVIHDWXUHVVXFKDVVSHHG
GLDODQGUHGLDO,IDYDLODEOHWKHVHIHDWXUHVKHOS\RXWRSODFH\RXU
FDOOZLWKRXWWDNLQJ\RXUDWWHQWLRQRIIWKHURDG
:KHQDYDLODEOHXVHDKDQGVIUHHGHYLFH,ISRVVLEOHDGGDQ
DGGLWLRQDOOD\HURIFRQYHQLHQFHDQGVDIHW\WR\RXUZLUHOHVVSKRQH
ZLWKRQHRIWKHPDQ\KDQGVIUHHDFFHVVRULHVDYDLODEOHWRGD\
3RVLWLRQ\RXUZLUHOHVVSKRQHZLWKLQHDV\UHDFK%HDEOHWRDFFHVV
\RXUZLUHOHVVSKRQHZLWKRXWUHPRYLQJ\RXUH\HVIURPWKHURDG,I
\RXJHWDQLQFRPLQJFDOODWDQLQFRQYHQLHQWWLPHOHW\RXUYRLFH
PDLODQVZHULWIRU\RX
/HWWKHSHUVRQ\RXDUHVSHDNLQJZLWKNQRZ\RXDUHGULYLQJLI
QHFHVVDU\VXVSHQGWKHFDOOLQKHDY\WUDIILFRUKD]DUGRXVZHDWKHU
FRQGLWLRQV5DLQVOHHWVQRZLFHDQGHYHQKHDY\WUDIILFFDQEH
KD]DUGRXV
'RQRWWDNHQRWHVRUORRNXSSKRQHQXPEHUVZKLOHGULYLQJ-RWWLQJ
GRZQDWRGROLVWRUIOLSSLQJWKURXJK\RXUDGGUHVVERRNWDNHV
DWWHQWLRQDZD\IURP\RXUSULPDU\UHVSRQVLELOLW\GULYLQJVDIHO\
'LDOVHQVLEO\DQGDVVHVVWKHWUDIILFLISRVVLEOHSODFHFDOOVZKHQ
\RXDUHQRWPRYLQJRUEHIRUHSXOOLQJLQWRWUDIILF7U\WRSODQFDOOV
ZKHQ\RXUFDUZLOOEHVWDWLRQDU\,I\RXQHHGWRPDNHDFDOOZKLOH
PRYLQJGLDORQO\DIHZQXPEHUVFKHFNWKHURDGDQG\RXUPLUURUV
WKHQFRQWLQXH
'RQRWHQJDJHLQVWUHVVIXORUHPRWLRQDOFRQYHUVDWLRQVWKDWPD\EH
GLVWUDFWLQJ0DNHSHRSOH\RXDUHWDONLQJZLWKDZDUH\RXDUHGULYLQJ
DQGVXVSHQGFRQYHUVDWLRQVWKDWKDYHWKHSRWHQWLDOWRGLYHUW\RXU
DWWHQWLRQIURPWKHURDG
8VH\RXUZLUHOHVVSKRQHWRFDOOIRUKHOS'LDORURWKHUORFDO
HPHUJHQF\QXPEHULQWKHFDVHRIILUHWUDIILFDFFLGHQWRUPHGLFDO
HPHUJHQFLHV5HPHPEHULWLVDIUHHFDOORQ\RXUZLUHOHVVSKRQH
8VH\RXUZLUHOHVVSKRQHWRKHOSRWKHUVLQHPHUJHQFLHV,I\RXVHH
DQDXWRDFFLGHQWFULPHLQSURJUHVVRURWKHUVHULRXVHPHUJHQF\
ZKHUHOLYHVDUHLQGDQJHUFDOORURWKHUORFDOHPHUJHQF\
QXPEHUDV\RXZRXOGZDQWRWKHUVWRGRIRU\RX
&DOOURDGVLGHDVVLVWDQFHRUDVSHFLDOQRQHPHUJHQF\ZLUHOHVV
DVVLVWDQFHQXPEHUZKHQQHFHVVDU\,I\RXVHHDEURNHQGRZQ
YHKLFOHSRVLQJQRVHULRXVKD]DUGDEURNHQWUDIILFVLJQDODPLQRU
WUDIILFDFFLGHQWZKHUHQRRQHDSSHDUVLQMXUHGRUDYHKLFOH\RX
NQRZWREHVWROHQFDOOURDGVLGHDVVLVWDQFHRURWKHUVSHFLDOQRQ
HPHUJHQF\QXPEHU
7KHZLUHOHVVLQGXVWU\UHPLQGV\RXWRXVH\RXUSKRQHVDIHO\ZKHQ
GULYLQJ
)RUPRUHLQIRUPDWLRQSOHDVHFDOO6$)(RUYLVLWRXU
ZHEVLWHZZZZRZFRPFRP
3URYLGHGE\WKH&HOOXODU7HOHFRPPXQLFDWLRQV ,QWHUQHW
$VVRFLDWLRQ
2SHUDWLQJ(QYLURQPHQW
5HPHPEHUWRIROORZDQ\VSHFLDOUHJXODWLRQVLQIRUFHLQDQ\DUHDDQG
DOZD\VVZLWFK\RXUSKRQHRIIZKHQHYHULWLVIRUELGGHQWRXVHLWRUZKHQLW
PD\FDXVHLQWHUIHUHQFHRUGDQJHU:KHQFRQQHFWLQJWKHSKRQHRUDQ\
DFFHVVRU\WRDQRWKHUGHYLFHUHDGLWVXVHU VJXLGHIRUGHWDLOHGVDIHW\
LQVWUXFWLRQV'RQRWFRQQHFWLQFRPSDWLEOHSURGXFWV
$VZLWKRWKHUPRELOHUDGLRWUDQVPLWWLQJHTXLSPHQWXVHUVDUHDGYLVHGWKDW
IRUWKHVDWLVIDFWRU\RSHUDWLRQRIWKHHTXLSPHQWDQGIRUWKHVDIHW\RI
SHUVRQQHOLWLVUHFRPPHQGHGWKDWWKHHTXLSPHQWVKRXOGRQO\EHXVHGLQ
WKHQRUPDORSHUDWLQJSRVLWLRQ
8VLQJ<RXU3KRQH1HDU2WKHU(OHFWURQLF'HYLFHV
0RVWPRGHUQHOHFWURQLFHTXLSPHQWLVVKLHOGHGIURPUDGLRIUHTXHQF\5)
VLJQDOV+RZHYHUFHUWDLQHOHFWURQLFHTXLSPHQWPD\QRWEHVKLHOGHG
DJDLQVWWKH5)VLJQDOVIURP\RXUZLUHOHVVSKRQH&RQVXOWWKH
PDQXIDFWXUHUWRGLVFXVVDOWHUQDWLYHV
3DFHPDNHUV
3DFHPDNHUPDQXIDFWXUHUVUHFRPPHQGWKDWDPLQLPXPGLVWDQFHRIFP
LQFKHVEHPDLQWDLQHGEHWZHHQDZLUHOHVVSKRQHDQGDSDFHPDNHUWR
DYRLGSRWHQWLDOLQWHUIHUHQFHZLWKWKHSDFHPDNHU
7KHVHUHFRPPHQGDWLRQVDUHFRQVLVWHQWZLWKWKHLQGHSHQGHQWUHVHDUFK
DQGUHFRPPHQGDWLRQVRI:LUHOHVV7HFKQRORJ\5HVHDUFK
3HUVRQVZLWKSDFHPDNHUV
z VKRXOGDOZD\VNHHSWKHSKRQHPRUHWKDQFP
LQFKHVIURPWKHLUSDFHPDNHUZKHQWKHSKRQHLVVZLWFKHGRQ
z VKRXOGQRWFDUU\WKHSKRQHLQDEUHDVWSRFNHW
z VKRXOGXVHWKHHDURSSRVLWHWKHSDFHPDNHUWRPLQLPL]HSRWHQWLDO
LQWHUIHUHQFH
,I\RXKDYHDQ\UHDVRQWRVXVSHFWWKDWLQWHUIHUHQFHLVWDNLQJSODFHVZLWFK
\RXUSKRQHRIILPPHGLDWHO\
+HDULQJ$LGV
6RPHGLJLWDOZLUHOHVVSKRQHVPD\LQWHUIHUHZLWKVRPHKHDULQJDLGV,QWKH
HYHQWRIVXFKLQWHUIHUHQFH\RXPD\ZLVKWRFRQVXOW\RXUKHDULQJDLG
PDQXIDFWXUHUWRGLVFXVVDOWHUQDWLYHV
2WKHU0HGLFDO'HYLFHV
,I\RXXVHDQ\RWKHUSHUVRQDOPHGLFDOGHYLFHVFRQVXOWWKHPDQXIDFWXUHU
RI\RXUGHYLFHWRGHWHUPLQHLILWLVDGHTXDWHO\VKLHOGHGIURPH[WHUQDO5)
HQHUJ\<RXUSK\VLFLDQPD\EHDEOHWRDVVLVW\RXLQREWDLQLQJWKLV
LQIRUPDWLRQ6ZLWFK\RXUSKRQHRIILQKHDOWKFDUHIDFLOLWLHVZKHQDQ\
UHJXODWLRQVSRVWHGLQWKHVHDUHDVLQVWUXFW\RXWRGRVR+RVSLWDOVRU
KHDOWKFDUHIDFLOLWLHVPD\EHXVLQJHTXLSPHQWWKDWFRXOGEHVHQVLWLYHWR
H[WHUQDO5)HQHUJ\
9HKLFOHV
5)VLJQDOVPD\DIIHFWLPSURSHUO\LQVWDOOHGRULQDGHTXDWHO\VKLHOGHG
HOHFWURQLFV\VWHPVLQPRWRUYHKLFOHV&KHFNZLWKWKHPDQXIDFWXUHURULWV
UHSUHVHQWDWLYHUHJDUGLQJ\RXUYHKLFOH<RXVKRXOGDOVRFRQVXOWWKH
PDQXIDFWXUHURIDQ\HTXLSPHQWWKDWKDVEHHQDGGHGWR\RXUYHKLFOH
3RVWHG)DFLOLWLHV
6ZLWFK\RXUSKRQHRIILQDQ\IDFLOLW\ZKHUHSRVWHGQRWLFHVUHTXLUH\RXWR
GRVR
3RWHQWLDOO\([SORVLYH(QYLURQPHQWV
6ZLWFK\RXUSKRQHRIIZKHQLQDQ\DUHDZLWKDSRWHQWLDOO\H[SORVLYH
DWPRVSKHUHDQGREH\DOOVLJQVDQGLQVWUXFWLRQV6SDUNVLQVXFKDUHDV
FRXOGFDXVHDQH[SORVLRQRUILUHUHVXOWLQJLQERGLO\LQMXU\RUHYHQGHDWK
8VHUVDUHDGYLVHGWRVZLWFKWKHSKRQHRIIZKLOHDWDUHIXHOLQJSRLQW
VHUYLFHVWDWLRQ8VHUVDUHUHPLQGHGRIWKHQHHGWRREVHUYHUHVWULFWLRQV
RQWKHXVHRIUDGLRHTXLSPHQWLQIXHOGHSRWVIXHOVWRUDJHDQGGLVWULEXWLRQ
DUHDVFKHPLFDOSODQWVRUZKHUHEODVWLQJRSHUDWLRQVDUHLQSURJUHVV
$UHDVZLWKDSRWHQWLDOO\H[SORVLYHDWPRVSKHUHDUHRIWHQEXWQRWDOZD\V
FOHDUO\PDUNHG7KH\LQFOXGHEHORZGHFNRQERDWVFKHPLFDOWUDQVIHURU
VWRUDJHIDFLOLWLHVYHKLFOHVXVLQJOLTXHILHGSHWUROHXPJDVVXFKDVSURSDQH
RUEXWDQHDUHDVZKHUHWKHDLUFRQWDLQVFKHPLFDOVRUSDUWLFOHVVXFKDV
JUDLQGXVWRUPHWDOSRZGHUVDQGDQ\RWKHUDUHDZKHUH\RXZRXOG
QRUPDOO\EHDGYLVHGWRWXUQRII\RXUYHKLFOHHQJLQH
(PHUJHQF\&DOOV
7KLVSKRQHOLNHDQ\ZLUHOHVVSKRQHRSHUDWHVXVLQJUDGLRVLJQDOVZLUHOHVV
DQGODQGOLQHQHWZRUNVDVZHOODVXVHUSURJUDPPHGIXQFWLRQVZKLFK
FDQQRWJXDUDQWHHFRQQHFWLRQLQDOOFRQGLWLRQV7KHUHIRUH\RXVKRXOG
QHYHUUHO\VROHO\RQDQ\ZLUHOHVVSKRQHIRUHVVHQWLDOFRPPXQLFDWLRQV
PHGLFDOHPHUJHQFLHVIRUH[DPSOH
5HPHPEHUWRPDNHRUUHFHLYHDQ\FDOOVWKHSKRQHPXVWEHVZLWFKHGRQ
DQGLQDVHUYLFHDUHDZLWKDGHTXDWHVLJQDOVWUHQJWK(PHUJHQF\FDOOVPD\
QRWEHSRVVLEOHRQDOOZLUHOHVVSKRQHQHWZRUNVRUZKHQFHUWDLQQHWZRUN
VHUYLFHVDQGRUSKRQHIHDWXUHVDUHLQXVH&KHFNZLWKORFDOVHUYLFH
SURYLGHUV
7RPDNHDQHPHUJHQF\FDOO
,IWKHSKRQHLVQRWRQVZLWFKLWRQ
.H\LQWKHHPHUJHQF\QXPEHUIRU\RXUSUHVHQWORFDWLRQIRU
H[DPSOHRURWKHURIILFLDOHPHUJHQF\QXPEHU(PHUJHQF\
QXPEHUVYDU\E\ORFDWLRQ
3UHVV
,IFHUWDLQIHDWXUHVDUHLQXVHFDOOEDUULQJIRUH[DPSOH\RXPD\ILUVW
QHHGWRGHDFWLYDWHWKRVHIHDWXUHVEHIRUH\RXFDQPDNHDQHPHUJHQF\FDOO
&RQVXOWWKLVGRFXPHQWDQG\RXUORFDOFHOOXODUVHUYLFHSURYLGHU
:KHQPDNLQJDQHPHUJHQF\FDOOUHPHPEHUWRJLYHDOOWKHQHFHVVDU\
LQIRUPDWLRQDVDFFXUDWHO\DVSRVVLEOH5HPHPEHUWKDW\RXUSKRQHPD\EH
WKHRQO\PHDQVRIFRPPXQLFDWLRQDWWKHVFHQHRIDQDFFLGHQWGRQRWFXW
RIIWKHFDOOXQWLOJLYHQSHUPLVVLRQWRGRVR
5HVWULFWLQJ&KLOGUHQ VDFFHVVWR\RXU3KRQH
<RXUSKRQHLVQRWDWR\&KLOGUHQVKRXOGQRWEHDOORZHGWRSOD\ZLWKLW
EHFDXVHWKH\FRXOGKXUWWKHPVHOYHVDQGRWKHUVGDPDJHWKHSKRQHRU
PDNHFDOOVWKDWLQFUHDVH\RXUSKRQHELOO
)&&1RWLFHDQG&DXWLRQV
)&&1RWLFH
7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&5XOHV2SHUDWLRQLV
VXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQVWKLVGHYLFHPD\QRWFDXVH
KDUPIXOLQWHUIHUHQFHDQGWKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFH
UHFHLYHGLQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ
z 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKH
OLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQWWRSDUWRIWKH)&&
5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOHSURWHFWLRQ
DJDLQVWKDUPIXOLQWHUIHUHQFHLQDUHVLGHQWLDOLQVWDOODWLRQ7KLV
HTXLSPHQWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLRIUHTXHQF\HQHUJ\
DQGLIQRWLQVWDOOHGDQGXVHGLQDFFRUGDQFHZLWKWKHLQVWUXFWLRQV
PD\FDXVHKDUPIXOLQWHUIHUHQFHWRUDGLRFRPPXQLFDWLRQV+RZHYHU
WKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFHZLOOQRWRFFXULQDSDUWLFXODU
LQVWDOODWLRQ,IWKLVHTXLSPHQWGRHVFDXVHKDUPIXOLQWHUIHUHQFHWR
UDGLRRUWHOHYLVLRQUHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\WXUQLQJ
WKHHTXLSPHQWRIIDQGRQWKHXVHULVHQFRXUDJHGWRWU\WRFRUUHFW
WKHLQWHUIHUHQFHE\RQHRUPRUHRIWKHIROORZLQJPHDVXUHV
5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD
,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQGUHFHLYHU
&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLWGLIIHUHQWIURPWKDWWR
ZKLFKWKHUHFHLYHULVFRQQHFWHG
&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79WHFKQLFLDQIRUKHOS
7KHSKRQHPD\FDXVH79RUUDGLRLQWHUIHUHQFHLIXVHGLQFORVHSUR[LPLW\
WRUHFHLYLQJHTXLSPHQW7KH)&&FDQUHTXLUH\RXWRVWRSXVLQJWKHSKRQH
LIVXFKLQWHUIHUHQFHFDQQRWEHHOLPLQDWHG
9HKLFOHVXVLQJOLTXHILHGSHWUROHXPJDVVXFKDVSURSDQHRUEXWDQHPXVW
FRPSO\ZLWKWKH1DWLRQDO)LUH3URWHFWLRQ6WDQGDUG1)3$)RUDFRS\
RIWKLVVWDQGDUGFRQWDFWWKH1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ2QH
%DWWHU\PDUFK3DUN4XLQF\0$$WWQ3XEOLFDWLRQ6DOHV'LYLVLRQ
&DXWLRQV
&KDQJHVRUPRGLILFDWLRQVPDGHLQWKHUDGLRSKRQHQRWH[SUHVVO\
DSSURYHGE\6DPVXQJZLOOYRLGWKHXVHUVDXWKRULW\WRRSHUDWHWKH
HTXLSPHQW
2WKHU,PSRUWDQW6DIHW\,QIRUPDWLRQ
z 2QO\TXDOLILHGSHUVRQQHOVKRXOGVHUYLFHWKHSKRQHRULQVWDOOWKH
SKRQHLQDYHKLFOH)DXOW\LQVWDOODWLRQRUVHUYLFHPD\EHGDQJHURXV
DQGPD\LQYDOLGDWHDQ\ZDUUDQW\DSSOLFDEOHWRWKHGHYLFH
z &KHFNUHJXODUO\WKDWDOOZLUHOHVVSKRQHHTXLSPHQWLQ\RXUYHKLFOHLV
PRXQWHGDQGRSHUDWLQJSURSHUO\
z 'RQRWVWRUHRUFDUU\IODPPDEOHOLTXLGVJDVHVRUH[SORVLYH
PDWHULDOVLQWKHVDPHFRPSDUWPHQWDVWKHSKRQHLWVSDUWVRU
DFFHVVRULHV
z )RUYHKLFOHVHTXLSSHGZLWKDQDLUEDJUHPHPEHUWKDWDQDLUEDJ
LQIODWHVZLWKJUHDWIRUFH'RQRWSODFHREMHFWVLQFOXGLQJERWK
LQVWDOOHGRUSRUWDEOHZLUHOHVVHTXLSPHQWLQWKHDUHDRYHUWKHDLU
EDJRULQWKHDLUEDJGHSOR\PHQWDUHD,IZLUHOHVVHTXLSPHQWLV
LPSURSHUO\LQVWDOOHGDQGWKHDLUEDJLQIODWHVVHULRXVLQMXU\FRXOG
UHVXOW
z 6ZLWFK\RXUSKRQHRIIEHIRUHERDUGLQJDQDLUFUDIW7KHXVHRI
ZLUHOHVVSKRQHLQDLUFUDIWLVLOOHJDODQGPD\EHGDQJHURXVWRWKH
DLUFUDIW VRSHUDWLRQ
z )DLOXUHWRREVHUYHWKHVHLQVWUXFWLRQVPD\OHDGWRWKHVXVSHQVLRQRU
GHQLDORIWHOHSKRQHVHUYLFHVWRWKHRIIHQGHURUOHJDODFWLRQRUERWK
3URGXFW3HUIRUPDQFH
*HWWLQJWKH0RVW2XWRI<RXU6LJQDO5HFHSWLRQ
7KHTXDOLW\RIHDFKFDOO\RXPDNHRUUHFHLYHGHSHQGVRQWKHVLJQDO
VWUHQJWKLQ\RXUDUHD<RXUSKRQHLQIRUPV\RXRIWKHFXUUHQWVLJQDO
VWUHQJWKE\GLVSOD\LQJDQXPEHURIEDUVQH[WWRWKHVLJQDOVWUHQJWKLFRQ
7KHPRUHEDUVGLVSOD\HGWKHVWURQJHUWKHVLJQDO
,I\RX UHLQVLGHDEXLOGLQJEHLQJQHDUDZLQGRZPD\JLYH\RXEHWWHU
UHFHSWLRQ
8QGHUVWDQGLQJWKH3RZHU6DYH)HDWXUH
,I\RXUSKRQHLVXQDEOHWRILQGDVLJQDODIWHUPLQXWHVRIVHDUFKLQJD
3RZHU6DYHIHDWXUHLVDXWRPDWLFDOO\DFWLYDWHG,I\RXUSKRQHLVDFWLYHLW
SHULRGLFDOO\UHFKHFNVVHUYLFHDYDLODELOLW\RU\RXFDQFKHFNLW\RXUVHOIE\
SUHVVLQJDQ\NH\
$Q\WLPHWKH3RZHU6DYHIHDWXUHLVDFWLYDWHGDPHVVDJHGLVSOD\VRQWKH
VFUHHQ:KHQDVLJQDOLVIRXQG\RXUSKRQHUHWXUQVWRVWDQGE\PRGH
0DLQWDLQLQJ<RXU3KRQH V3HDN3HUIRUPDQFH
)RUWKHEHVWFDUHRI\RXUSKRQHRQO\DXWKRUL]HGSHUVRQQHOVKRXOGVHUYLFH
\RXUSKRQHDQGDFFHVVRULHV)DXOW\VHUYLFHPD\YRLGWKHZDUUDQW\
7KHUHDUHVHYHUDOVLPSOHJXLGHOLQHVWRRSHUDWLQJ\RXUSKRQHSURSHUO\DQG
PDLQWDLQLQJVDIHVDWLVIDFWRU\VHUYLFH
z 3ODFHWKHPRELOHSKRQH VDFRXVWLFRXWSXWQH[WWR\RXUHDUIRU
SURSHURULHQWDWLRQ
z 'RQRWWDPSHURUDOWHUWKHSKRQH VDQWHQQD
z 'RQ WXVHWKHSKRQHLIWKHDQWHQQDLVGDPDJHG
z 6SHDNGLUHFWO\LQWRWKHSKRQH VUHFHLYHU
z $YRLGH[SRVLQJ\RXUSKRQHDQGDFFHVVRULHVWRUDLQRUOLTXLGVSLOOV
,I\RXUSKRQHGRHVJHWZHWLPPHGLDWHO\WXUQWKHSRZHURIIDQG
UHPRYHWKHEDWWHU\,ILWLVLQRSHUDEOHFDOO&XVWRPHU&DUHIRU
VHUYLFH
$YDLODELOLW\RI9DULRXV)HDWXUHV5LQJ7RQHV
0DQ\VHUYLFHVDQGIHDWXUHVDUHQHWZRUNGHSHQGHQWDQGPD\UHTXLUH
DGGLWLRQDOVXEVFULSWLRQDQGRUXVDJHFKDUJHV1RWDOOIHDWXUHVDUH
DYDLODEOHIRUSXUFKDVHRUXVHLQDOODUHDV'RZQORDGDEOH5LQJ7RQHVPD\
EHDYDLODEOHDWDQDGGLWLRQDOFRVW2WKHUFRQGLWLRQVDQGUHVWULFWLRQVPD\
DSSO\6HH\RXUVHUYLFHSURYLGHUIRUDGGLWLRQDOLQIRUPDWLRQ
%DWWHU\6WDQGE\DQG7DON7LPH
6WDQGE\DQGWDONWLPHVZLOOYDU\GHSHQGLQJRQSKRQHXVDJHSDWWHUQVDQG
FRQGLWLRQV%DWWHU\SRZHUFRQVXPSWLRQGHSHQGVRQIDFWRUVVXFKDV
QHWZRUNFRQILJXUDWLRQVLJQDOVWUHQJWKRSHUDWLQJWHPSHUDWXUHIHDWXUHV
VHOHFWHGIUHTXHQF\RIFDOOVDQGYRLFHGDWDDQGRWKHUDSSOLFDWLRQXVDJH
SDWWHUQV
%DWWHU\3UHFDXWLRQV
z 1HYHUXVHDQ\FKDUJHURUEDWWHU\WKDWLVGDPDJHGLQDQ\ZD\
z 8VHWKHEDWWHU\RQO\IRULWVLQWHQGHGSXUSRVH
z ,I\RXXVHWKHSKRQHQHDUWKHQHWZRUN VEDVHVWDWLRQLWXVHVOHVV
SRZHUWDONDQGVWDQGE\WLPHDUHJUHDWO\DIIHFWHGE\WKHVLJQDO
VWUHQJWKRQWKHFHOOXODUQHWZRUNDQGWKHSDUDPHWHUVVHWE\WKH
QHWZRUNRSHUDWRU
z %DWWHU\FKDUJLQJWLPHGHSHQGVRQWKHUHPDLQLQJEDWWHU\FKDUJH
DQGWKHW\SHRIEDWWHU\DQGFKDUJHUXVHG7KHEDWWHU\FDQEH
FKDUJHGDQGGLVFKDUJHGKXQGUHGVRIWLPHVEXWLWZLOOJUDGXDOO\
ZHDURXW:KHQWKHRSHUDWLRQWLPHWDONWLPHDQGVWDQGE\WLPHLV
QRWLFHDEO\VKRUWHUWKDQQRUPDOLWLVWLPHWREX\DQHZEDWWHU\
z ,IOHIWXQXVHGDIXOO\FKDUJHGEDWWH U\ZLOOGLVFKDUJHLWVHOIRYHUWLPH
z 8VHRQO\6DPVXQJDSSURYHGEDWWHULHVDQGUHFKDUJH\RXUEDWWHU\
RQO\ZLWK6DPVXQJDSSURYHGFKDUJHUV:KHQDFKDUJHULVQRWLQ
XVHGLVFRQQHFWLWIURPWKHSRZHUVRXUFH'RQRWOHDYHWKHEDWWHU\
FRQQHFWHGWRDFKDUJHUIRUPRUHWKDQDZHHNVLQFHRYHUFKDUJLQJ
PD\VKRUWHQLWVOLIH
z ([WUHPHWHPSHUDWXUHVZLOODIIHFWWKHFKDUJLQJFDSDFLW\RI\RXU
EDWWHU\LWPD\UHTXLUHFRROLQJRUZDUPLQJILUVW
z 'RQRWOHDYHWKHEDWWHU\LQKRWRUFROGSODFHVVXFKDVLQDFDULQ
VXPPHURUZLQWHUFRQGLWLRQVDV\RXZLOOUHGXFHWKHFDSDFLW\DQG
OLIHWLPHRIWKHEDWWHU\$OZD\VWU\WRNHHSWKHEDWWHU\DWURRP
WHPSHUDWXUH$SKRQHZLWKDKRWRUFROGEDWWHU\PD\WHPSRUDULO\
QRWZRUNHYHQZKHQWKHEDWWHU\LVIXOO\FKDUJHG/LLRQEDWWHULHV
DUHSDUWLFXODUO\DIIHFWHGE\WHPSHUDWXUHVEHORZ&)
z 'RQRWVKRUWFLUFXLWWKHEDWWHU\$FFLGHQWDOVKRUWFLUFXLWLQJFDQ
RFFXUZKHQDPHWDOOLFREMHFWFRLQFOLSRUSHQFDXVHVDGLUHFW
FRQQHFWLRQEHWZHHQWKHDQGWHUPLQDOVRIWKHEDWWHU\PHWDO
VWULSVRQWKHEDWWHU\IRUH[DPSOHZKHQ\RXFDUU\DVSDUHEDWWHU\
LQDSRFNHWRUEDJ6KRUWFLUFXLWLQJWKHWHUPLQDOVPD\GDPDJHWKH
EDWWHU\RUWKHREMHFWFDXVLQJWKHVKRUWFLUFXLWLQJ
z 'LVSRVHRIXVHGEDWWHULHVLQDFFRUGDQFHZLWKORFDOUHJXODWLRQV,Q
VRPHDUHDVWKHGLVSRVDORIEDWWHULHVLQKRXVHKROGRUEXVLQHVV
WUDVKPD\EHSURKLELWHG)RUVDIHGLVSRVDORSWLRQVIRU/L,RQ
EDWWHULHVFRQWDFW\RXUQHDUHVW6DPVXQJDXWKRUL]HGVHUYLFHFHQWHU
$OZD\VUHF\FOH'RQRWGLVSRVHRIEDWWHULHVLQDILUH
&DUHDQG0DLQWHQDQFH
<RXUSKRQHLVDSURGXFWRIVXSHULRUGHVLJQDQGFUDIWVPDQVKLSDQGVKRXOG
EHWUHDWHGZLWKFDUH7KHVXJJHVWLRQVEHORZZLOOKHOS\RXIXOILOODQ\
ZDUUDQW\REOLJDWLRQVDQGDOORZ\RXWRHQMR\WKLVSURGXFWIRUPDQ\\HDUV
z .HHSWKHSKRQHDQGDOOLWVSDUWVDQGDFFHVVRULHVRXWRIWKHUHDFKRI
VPDOOFKLOGUHQ
z .HHSWKHSKRQHGU\3UHFLSLWDWLRQKXPLGLW\DQGOLTXLGVFRQWDLQ
PLQHUDOVWKDWZLOOFRUURGHHOHFWURQLFFLUFXLWV
z 'RQRWXVHWKHSKRQHZLWKDZHWKDQG'RLQJVRPD\FDXVHDQ
HOHFWULFVKRFNWR\RXRUGDPDJHWRWKHSKRQH
z 'RQRWXVHRUVWRUHWKHSKRQHLQGXVW\GLUW\DUHDVDVLWVPRYLQJ
SDUWVPD\EHGDPDJHG
z 'RQRWVWRUHWKHSKRQHLQKRWDUHDV+LJKWHPSHUDWXUHVFDQ
VKRUWHQWKHOLIHRIHOHFWURQLFGHYLFHVGDPDJHEDWWHULHVDQGZDUS
RUPHOWFHUWDLQSODVWLFV
z 'RQRWVWRUHWKHSKRQHLQFROGDUHDV:KHQWKHSKRQHZDUPVXSWR
LWVQRUPDORSHUDWLQJWHPSHUDWXUHPRLVWXUHFDQIRUPLQVLGHWKH
SKRQHZKLFKPD\GDPDJHWKHSKRQH VHOHFWURQLFFLUFXLWERDUGV
z 'RQRWGURSNQRFNRUVKDNHWKHSKRQH5RXJKKDQGOLQJFDQEUHDN
LQWHUQDOFLUFXLWERDUGV
z 'RQRWXVHKDUVKFKHPLFDOVFOHDQLQJVROYHQWVRUVWURQJGHWHUJHQWV
WRFOHDQWKHSKRQH:LSHLWZLWKDVRIWFORWKVOLJKWO\GDPSHQHGLQD
PLOGVRDSDQGZDWHUVROXWLRQ
z 'RQRWSDLQWWKHSKRQH3DLQWFDQFORJWKHGHYLFH VPRYLQJSDUWV
DQGSUHYHQWSURSHURSHUDWLRQ
z 'RQRWSXWWKHSKRQHLQRURQKHDWLQJGHYLFHVVXFKDVD
PLFURZDYHRYHQDVWRYHRUDUDGLDWRU7KHSKRQHPD\H[SORGH
ZKHQRYHUKHDWHG
z :KHQWKHSKRQHRUEDWWHU\JHWVZHWWKHODEHOLQGLFDWLQJZDWHU
GDPDJHLQVLGHWKHSKRQHFKDQJHVFRORU,QWKLVFDVHSKRQHUHSDLUV
DUHQRORQJHUJXDUDQWHHGE\WKHPDQXIDFWXUHU VZDUUDQW\HYHQLI
WKHZDUUDQW\IRU\RXUSKRQHKDVQRWH[SLUHG
z ,I\RXUSKRQHKDVDIODVKRUOLJKWGRQRWXVHLWWRRFORVHWRWKH
H\HVRISHRSOHRUDQLPDOV7KLVPD\FDXVHGDPDJHWRWKHLUH\HV
z 8VHRQO\WKHVXSSOLHGRUDQDSSURYHGUHSODFHPHQWDQWHQQD
8QDXWKRUL]HGDQWHQQDVRUPRGLILHGDFFHVVRULHVPD\GDPDJHWKH
SKRQHDQGYLRODWHUHJXODWLRQVJRYHUQLQJUDGLRGHYLFHV
z ,IWKHSKRQHEDWWHU\FKDUJHURUDQ\DFFHVVRU\LVQRWZRUNLQJ
SURSHUO\WDNHLWWR\RXUQHDUHVWTXDOLILHGVHUYLFHIDFLOLW\7KH
SHUVRQQHOWKHUHZLOODVVLVW\RXDQGLIQHFHVVDU\DUUDQJHIRU
VHUYLFH
Correct disposal of this product
(Waste Electrical & Electronic Equipment)
(Applicable in the European Union and other European countries with separate collection systems) This marking shown on the product or its literature, indicates that it should not be disposed with other household wastes at the end of its working life. To prevent possible harm to the environment or human health from uncontrolled waste disposal, please separate this from other types of wastes and recycle it responsibly to promote the sustainable reuse of material resources. Household users should contact either the retailer where they purchased this product, or their local government office, for details of where and how they can take this item for environmentally safe recycling. Business users should contact their supplier and check the terms and conditions of the purchase contract. This product should not be mixed with other commercial wastes for disposal. Correct disposal of batteries in this product
(Applicable in the European Union and other European countries with separate battery return systems) This marking on the battery, manual or packaging indicates that the batteries in this product should not be disposed of with other household waste at the end of their working life. Where marked, the chemical symbols Hg, Cd or Pb indicate that the battery contains mercury, cadmium or lead above the reference levels in EC Directive 2006/66. If batteries are not properly disposed of, these substances can cause harm to human health or the environment. To protect natural resources and to promote material reuse, please separate batteries from other types of waste and recycle them through your local, free battery return system.
Using this manual Thank you for purchasing this Samsung mobile device. This device will provide you with high quality mobile communication and entertainment based on Samsungs exceptional technology and high standards. This user manual has been specially designed to guide you through the functions and features of your device. Read me first Please read all safety precautions and this manual carefully before using your device to ensure safe and proper use. The descriptions in this manual are based on the default settings of your device. Images and screenshots used in this user manual may differ in appearance from the actual product. Content in this user manual may differ from the product, or from software provided by service providers or carriers, and is subject to change without prior notice. Refer to www.samsung.com/cn for the latest version of the user manual. Available features and additional services may vary by device, software, or service provider. Formatting and delivery of this user manual is based on Android operating systems and may vary depending on the users operating system. Applications and their functions may vary by country, region, or hardware specifications. Samsung is not liable for performance issues caused by third-party applications. 2 Using this manual Samsung is not liable for performance issues or incompatibilities caused by edited registry settings or modified operating system software. Attempting to customise the operating system may cause your device or applications to work improperly. You may upgrade your mobile devices software by accessing www.samsung.com/cn. Software, sound sources, wallpapers, images, and other contents provided in this device are licenced for limited use between Samsung and their respective owners. Extracting and using these materials for commercial or other purposes is an infringement of copyright laws. Samsung is not liable for such copyright infringement by the user. You may incur additional charges for data services, such as messaging, uploading and downloading, auto-syncing, or using location services. To avoid additional charges, select an appropriate data tariff plan. For details, contact your service provider. Please keep this manual for future reference. Instructional icons Before you start, familiarise yourself with the icons you will see in this manual:
Warningsituations that could cause injury to yourself or others Cautionsituations that could cause damage to your device or other equipment Using this manual 3 Notenotes, usage tips, or additional information Refer topages with related information; for example: p. 12 (represents see page 12) Followed bythe order of options or menus you must select to perform a step; for example: In Idle mode, open the application list and select Settings About phone (represents Settings, followed by About phone)
[
]
Square bracketsdevice keys; for example: [
(represents the Menu key)
]
Copyright Copyright 2011 Samsung Electronics This user manual is protected under international copyright laws. No part of this user manual may be reproduced, distributed, translated, or transmitted in any form or by any means, electronic or mechanical, including photocopying, recording, or storing in any information storage and retrieval system, without the prior written permission of Samsung Electronics. 4 Using this manual Trademarks SAMSUNG and the SAMSUNG logo are registered trademarks of Samsung Electronics. The Android is a trademark of Google, Inc. is a registered trademark of the Bluetooth SIG, Bluetooth Inc. worldwide. Oracle and Java are registered trademarks of Oracle and/
or its affiliates. Other names may be trademarks of their respective owners. Windows Media Player Microsoft Corporation.
, DivX Certified, DivX and associated logos are trademarks of Rovi Corporation or its subsidiaries and are used under licence. All other trademarks and copyrights are the property of their respective owners. is a registered trademark of Using this manual 5 ABOUT DIVX VIDEO DivX is a digital video format created by DivX, LLC, a subsidiary of Rovi Corporation. This is an official DivX Certified device that plays DivX video. Visit www.divx.com for more information and software tools to convert your files into DivX videos. DivX Certified to play DivX video up to HD 720p, including premium content ABOUT DIVX VIDEO-ON-DEMAND This DivX Certified device must be registered in order to play purchased DivX Video-on-Demand (VOD) movies. To obtain your registration code, locate the DivX VOD section in your device setup menu. Go to vod.divx.com for more information on how to complete your registration. 6 Using this manual Contents Assembling ........................................................ 12 Unpack .............................................................................. 12 Install the SIM or USIM card and battery ................... 13 Charge the battery ......................................................... 15 Insert a memory card ..................................................... 18 Attach a hand strap ........................................................ 21 Getting started .................................................. 22 Turn your device on and off .......................................... 22 Get to know your device ............................................... 23 Use the touch screen ...................................................... 28 Lock or unlock the touch screen and keys ................ 30 Get to know the idle screen .......................................... 31 Access applications ........................................................ 33 Customise your device ................................................... 36 Switch SIM or USIM cards .............................................. 40 Enter text .......................................................................... 42 Communication ................................................ 46 Calling ................................................................................ 46 Messaging ........................................................................ 57 Email .................................................................................. 59 Contents 7
...................................................................... 61 139 Mail ............................................................................. 62 Social Hub ......................................................................... 63 Entertainment ................................................... 64 Camera .............................................................................. 64 Videos ................................................................................ 74 Gallery ............................................................................... 75 Photo editor ..................................................................... 78 Music .................................................................................. 79 FM radio ............................................................................ 82 Personal information ....................................... 85 Contacts ............................................................................ 85 Calendar ............................................................................ 89 Task .................................................................................... 90 Memo ................................................................................. 91 Voice recorder .................................................................. 93 Web ..................................................................... 94 Internet ............................................................................. 94 MM (Mobile Market) ....................................................... 97 Mobile Reader ................................................................. 98 Mobile Stock .................................................................... 98 Navigator .......................................................................... 98 8 Contents Phonebook manager ..................................................... 99 Renren ............................................................................... 99 Weibo ................................................................................. 99
e .................................................................. 100 10086.CN ....................................................................... 100 Connectivity .................................................... 101 Bluetooth ....................................................................... 101 WLAN .............................................................................. 103 WLAN Direct .................................................................. 105 AllShare .......................................................................... 106 Mobile network sharing ............................................. 108 GPS .................................................................................. 110 PC connections ............................................................. 111 VPN connections .......................................................... 114 Tools .................................................................. 116 Clock ............................................................................... 116 Calculator ....................................................................... 119 CoolDict ......................................................................... 119 Customer Service ......................................................... 120 Device management ................................................... 121 Kies air ............................................................................ 122 Mini diary ....................................................................... 123 My files ........................................................................... 124 Contents 9 Namecard Recognition ............................................... 125 Polaris Office ................................................................. 126 Search ............................................................................. 128 SIM Toolkit ..................................................................... 128 Task manager ................................................................ 129 Settings ............................................................. 130 Access the Settings menu .......................................... 130 SIM cards management .............................................. 130 Wireless and network ................................................. 130 Call ................................................................................... 133 Sound settings .............................................................. 134 Display ............................................................................ 135 Power saving mode ..................................................... 136 Location and security .................................................. 137 Applications .................................................................. 139 Accounts and sync ....................................................... 139 Motion ............................................................................ 140 Privacy ............................................................................ 140 Storage ........................................................................... 140 Language and keyboard ............................................ 140 Voice input and output ............................................... 141 Accessibility ................................................................... 142 Date and time ............................................................... 142 About phone ................................................................. 143 10 Contents Troubleshooting ............................................. 144 Safety precautions .......................................... 150 Contents 11 Assembling Unpack Check your product box for the following items:
Mobile device Battery User manual Use only Samsung-approved software. Pirated or illegal software may cause damage or malfunctions that are not covered by your manufacturer's warranty. The items supplied with your device and available accessories may vary depending on your region or service provider. You can purchase additional accessories from your local Samsung dealer. The supplied accessories perform best for your device. Accessories other than the supplied ones may not be compatible with your device. 12 Assembling Install the SIM or USIM card and battery When you subscribe to a cellular service, you will receive a Subscriber Identity Module (SIM) card, with subscription details, such as your personal identification number (PIN) and optional services. To use UMTS or HSDPA services, you can purchase a Universal Subscriber Identity Module (USIM) card. To install the SIM or USIM card and battery, 1 2 If the device is on, press and hold the Power key and select Power off OK to turn it off. Remove the back cover. Be careful not to damage your fingernails when you remove the back cover. Assembling 13 3 4 Insert the SIM or USIM card with the gold-coloured contacts facing down. Your device has two SIM card slots to allow you to use two SIM or USIM cards, and switch between them. Use the bottom slot for your primary, or most frequently used, SIM or USIM card. Use the upper slot for a secondary SIM or USIM card. Remove the SIM card from the upper slot first. Removing the SIM card from the bottom slot first may damage your SIM card. Insert the battery. 14 Assembling 5 Replace the back cover. Charge the battery Before using the device for the first time, you must charge the battery. You can charge the device with a travel adapter or by connecting the device to a PC with a USB cable. Use only Samsung-approved chargers and cables. Unauthorised chargers or cables can cause batteries to explode or damage your device. When your battery is low, the device will emit a warning tone and display a low battery message. The battery icon will also be empty. If the battery level becomes too low, the device will automatically power off. Recharge your battery to continue using your device. If the battery is completely discharged, you cannot turn on the device, even with the travel adapter connected. Allow a depleted battery to charge for a few minutes before you try to turn on the device. Assembling 15 1 Charge with a travel adapter Connect the USB cable to the USB power adapter and then plug the end of the USB cable into the multifunction jack. The shape of the USB power adapter may differ depending on your region. Connecting the USB cable improperly may cause serious damage to the device or USB power adapter. Any damage caused by misuse is not covered by the warranty. 16 Assembling 2 3 Plug the USB power adapter into a power outlet. You can use the device while it is charging, but it may take longer to fully charge the battery. While the device is charging, the touch screen may not function due to an unstable power supply. If this happens, unplug the USB power adapter from the power outlet or unplug the USB cable from the device. While charging, the device may heat up. This is normal and should not affect your devices lifespan or performance. If your device is not charging properly, bring your device and the charger to a Samsung Service Centre. When the battery is fully charged, first unplug the USB power adapter and USB cable from the device and then from the power outlet. Do not remove the battery before removing the USB power adapter and USB cable. Doing this may cause damage to the device. Charging a completely discharged battery may take about XX hours. Because the battery is a consumable part, the battery will gradually wear out and the charging time will be reduced. The initial charging capacity of your battery is about XXXX mAh. To save energy, unplug the travel adapter when not in use. The travel adapter does not have a power switch, so you must unplug the travel adapter from the outlet to interrupt the power supply. The travel adapter should remain close to the socket when in use. Assembling 17 Charge with a USB cable Before charging, ensure that your PC is turned on. 1 2 Plug one end (micro-USB) of the USB cable into the multifunction jack. Plug the other end of the USB cable into a USB port on a PC. Depending on the type of USB cable you are using, it may take some time before charging begins. When the battery is fully charged, first unplug the USB cable from the device and then from the PC. 3 Reduce the battery consumption If you activate auto-syncing, the Bluetooth feature, or the WLAN feature in the background, the battery will drain faster. To use the battery longer, close unnecessary applications. You can also decrease the backlight time and the brightness of the display, or switch to Sleep mode by pressing the Power key when you are not using your device. Insert a memory card To store additional multimedia files, you must insert a memory card. Your device accepts microSD or microSDHC memory cards with maximum capacities of XX GB (depending on memory card manufacturer and type). Samsung uses approved industry standards for memory cards, but some brands may not be fully compatible with your device. Using an incompatible memory card may damage your device or the memory card and can corrupt data stored on the card. 18 Assembling Your device supports only the FAT file structure for memory cards. If you insert a card formatted with a different file structure, your device will ask you to reformat the memory card. Frequent writing and erasing of data will shorten the lifespan of memory cards. When you insert a memory card in your device, the file directory of the memory card will appear in the external_sd folder under the internal memory. Remove the back cover and battery. Insert a memory card with the gold-coloured contacts facing down. Replace the battery and back cover. 1 2 3 Assembling 19 Remove the memory card Before removing a memory card, first unmount it for safe removal. 1 2 3 4 In Idle mode, select Storage Unmount SD card OK. Remove the back cover and battery. Remove the memory card. Replace the battery and back cover. Applications Settings Do not remove a memory card while the device is transferring or accessing information, as this could result in loss of data or damage to the memory card or device. Format the memory card Formatting your memory card on a PC may cause incompatibilities with your device. Format the memory card only on the device. In Idle mode, select Applications Settings Storage Unmount SD card OK Format SD card Format SD card Erase everything. Before formatting the memory card, remember to make backup copies of all important data stored on your device. The manufacturers warranty does not cover loss of data resulting from user actions. 20 Assembling Attach a hand strap 1 Remove the back cover. 2 Slide a hand strap through the slot and hook it over the small projection. 3 Replace the back cover. Assembling 21 Getting started Turn your device on and off To turn on your device, press and hold the Power key. If you turn on your device for the first time, follow the on-screen instructions to set up your device. To turn off your device, press and hold the Power key and then select Power off OK. Follow all posted warnings and directions from authorised personnel when in areas where the use of wireless devices is restricted, such as aeroplanes and hospitals. To use your device's non-network services only, switch to Flight mode. Press and hold the Power key and select Flight mode. 22 Getting started Get to know your device Device layout Light sensor Proximity sensor Front camera lens Earpiece Volume key Touch screen Home key Menu key Mouthpiece Back key Multifunction jack Getting started 23 Headset jack Power/Reset/
Lock key Network switch key Internal antenna Keys Key Power/
Reset1/
Lock Menu Home Speaker Rear camera lens Flashbulb Back cover Function Turn on the device (press and hold); Access the quick menus
(press and hold); Reset the device
(press and hold for XX-XX seconds until the SAMSUNG log appears);
Lock the touch screen. Open a list of options available on the current screen; Open the quick search bar (press and hold). Return to the idle screen; Open the list of recent applications (press and hold). 1. If your device experiences fatal errors, hanging, or freezing, you may need to reset the device to regain functionality. 24 Getting started Key Function Back Return to the previous screen. Network switch Switch between SIM or USIM cards; In Idle mode, access the SIM cards management menu (press and hold). Volume Adjust the devices volume. Indicator icons Icon Definition No signal Signal strength 1
/
Activated card type GPRS network connected EDGE network connected TD-SCDMA network connected 1. This icon may vary depending on your SIM card setting. Getting started 25 Icon Definition Open WLANs available WLAN connected WLAN Direct connected Bluetooth activated Bluetooth headset connected GPS activated Call in progress Call on hold Speakerphone activated Missed call Synchronised with the web Uploading data Downloading data Call diverting activated Connected to PC USB tethering activated 26 Getting started Icon Definition WLAN tethering activated No SIM or USIM card New text or multimedia message New email message New voice mail message Alarm activated Event notification Roaming (outside of normal service area) Silent mode activated Vibration mode activated Flight mode activated Music playback in progress Music playback paused FM radio turned on in the background Error occurred or caution required Battery power level 10:00 Current time Getting started 27 Use the touch screen Your devices touch screen lets you easily select items or perform functions. Learn basic actions to use the touch screen. To avoid scratching the touch screen, do not use sharp tools. Do not allow the touch screen to come into contact with other electrical devices. Electrostatic discharges can cause the touch screen to malfunction. Do not allow the touch screen to come into contact with water. The touch screen may malfunction in humid conditions or when exposed to water. For optimal use of the touch screen, remove the screen protection film before using your device. Your touch screen has a layer that detects small electrical charges emitted by the human body. For best performance, tap the touch screen with your fingertip. The touch screen will not react to touches of sharp tools, such as a stylus or pen. Control your touch screen with the following actions:
Tap: Touch once to select or launch a menu, option, or application. 28 Getting started Tap and hold: Tap an item and hold it for more than 2 seconds. Drag: Tap an item and move it to the location you want. Double-tap: Tap an item twice quickly. Flick: Scroll up, down, left, or right to move through lists or screens. Getting started 29 Pinch: Place two fingers far apart, and then pinch them together. Your device turns off the touch screen when you do not use the device for a specified period. To turn on the screen, press the Power key or the Home key. You can also adjust the backlight time. In Idle mode, open the application list and select Settings Display Screen time-out. Lock or unlock the touch screen and keys You can lock the touch screen and keys to prevent any unwanted device operations. To lock, press the Power key. To unlock, turn on the screen by pressing the Power key or the Home key and then flick the window with your finger. You can activate the screen lock feature to prevent others from using or accessing your personal data and information saved in your device. p. 38 30 Getting started Get to know the idle screen When the device is in Idle mode, you will see the idle screen. From the idle screen, you can view indicator icons, widgets, shortcuts to applications, and other items. The idle screen has multiple panels. Scroll left or right to a panel of the idle screen. You can also select a dot at the bottom of the screen to move directly to the corresponding screen. Add items to the idle screen You can customise the idle screen by adding shortcuts to applications or items in applications, widgets, or folders. To add items to the idle screen, 1 2
] Add or tap and hold the empty area on an item:
Press [
the idle screen. Select the item category
: Add widgets to the idle screen.
: Add shortcuts to items, such as Widgets Shortcuts applications, bookmarks, and contacts. Folders contacts. Wallpapers
: Set a background image.
: Create a new folder or add folders for your 1 2 Move items on the idle screen Tap and hold an item to move. Drag the item to the location you want. Getting started 31 1 Use the notifications panel Remove items from the idle screen Tap and hold an item to remove. The trash bin appears at the bottom of the idle screen. Drag the item to the trash bin. When the item turns red, release the item. 2 3 In Idle mode or while using an application, tap the indicator icons area and drag your finger down to open the notifications panel. You can activate or deactivate wireless connection features and access a list of notifications, such as messages, calls, events or processing status. To hide the panel, drag the bottom of the list up. From the notifications panel, you can use the following options:
WLAN feature. p. 104 BT connection feature. p. 101 Data Sound Auto rotation
: Activate or deactivate the data connection feature.
/Vibration: Activate or deactivate Vibration mode.
: Activate or deactivate the Bluetooth wireless
: Activate or deactivate the WLAN connection
: Activate or deactivate the auto rotation. 32 Getting started Add or remove panels to the idle screen You can add or remove panels of the idle screen to organise widgets according to your preferences and needs. 1
] Edit. In Idle mode, press [
You can also place your two fingers on the screen and pinch to switch to Edit mode. Add or remove panels by using the following features:
To remove a panel, tap and hold the thumbnail of a panel and drag it to the trash bin at the bottom of the screen. To add a new panel, select To change the order of the panels, tap and hold the thumbnail of a panel and drag it to the location you want. When you are finished, press [
]. 2 3 Access applications To access your devices applications, 1 2 Applications to access the In Idle mode, select application list. Scroll left or right to another screen. You can also select a dot at the bottom of the screen to move directly to the corresponding screen. Select an application. 3 You can add a shortcut to an application by tapping and holding the application icon from the application list. You can move the icon to the location you want on the idle screen. Getting started 33 4 Press [
Home key to return to the idle screen.
] to return to the previous screen; Press the If you rotate the device while using some features, the interface will automatically rotate as well. To prevent the interface from rotating, open the shortcuts panel and select Auto rotation. While using the device, you can capture an image of a screen by pressing and holding Home key and the Power key simultaneously. The image will be saved in My files ScreenCapture. Organise applications You can reorganise the applications in the application list by changing their order or grouping them into categories to suit your preferences and needs. 1 In the application list, press [
2 Tap and hold an application. 3 Drag the application icon to the location you want. You can move an application icon to another main menu screen. You can also move most-used applications next to Home. Press [
] Edit OK.
] Save. 4 To add a folder or panel to the menu screen, 1
] Edit. 2 3 4 In the application list, press [
Tap and hold an application. Drag the application icon to the bottom of the screen. Repeat steps 2-3 to add more applications. Add Folder or Add Page at 34 Getting started 5
] Save. Add Folder or Add Page to the menu screen. Drag A new folder or panel containing the applications is added to the menu screen. If you added a folder, enter a name and select Press [
6 7 To change the order of the main menu screens, 1 2 In the application list, place your two fingers on the screen and pinch. Tap and hold the thumbnail of a screen and drag it to the location you want. Yes. Access recent applications Press and hold the Home key to view the applications you have accessed recently. Select an application to access. 1 2 Your device is a multitasking device. It can run more than one application at the same time. However, multitasking may cause hang-ups, freezing, memory problems, or additional power consumption. To avoid these problems, end unnecessary programs using the task manager. 1 Use the task manager In Idle mode, open the application list and select manager Active applications. The list of all the applications currently running on your device appears. To close an application, select To close all active applications, select Exit all. Task Exit. 2 Getting started 35 Turn on or off the touch tone Set the current time and date In Idle mode, open the application list and select Settings Date and time. Set the time and date and change other options. Customise your device Get more from your device by customising it to match your preferences. 1 2 In Idle mode, open the application list and select Settings Sound settings Audible selection. Press the Volume key up or down to adjust the ringtone volume. You can change your devices sounds by customising the current sound profile or switching to another sound profile. To set up a profile, 1 2 3 In Idle mode, open the application list and select Settings Sound settings Phone Profiles. Select the profile you are using. Customise the sound options for incoming calls, incoming messages, and other device sounds. p. 134 Adjust the volume of the ringtones Set up a sound profile To switch to another profile, select the dot next to the profile. 36 Getting started Switch to Silent mode To mute or unmute your device, do one of the following:
Phone Keypad and tap and hold #. In Idle mode, select Open the shortcuts panel from the top of the screen and select Sound. Press and hold the Power key and select Silent mode. You can set the device to alert you to various events in Silent mode. In Idle mode, open the application list and select Settings Sound settings Vibration Always or Only in Silent mode. When you switch to Silent mode, will appear in place of
. Activate animation for switching windows In Idle mode, open the application list and select Settings Display Animation Some animations or All animations. 1 2 3 Select a wallpaper for the idle screen In Idle mode, press [
Select an image. Select
] Wallpaper an option. Save or Set wallpaper. Samsung is not responsible for any use of default images or wallpapers provided on your device. 1 2 Adjust the brightness of the display In Idle mode, open the application list and select Settings Display Brightness. Clear the check box next to Automatic brightness. Getting started 37 3 4 Drag the slider Select OK. to adjust the level of brightness. The brightness level of the display will affect how quickly the device consumes battery power. Set a screen lock You can lock the touch screen by activating the screen lock feature. Your device will require the unlock code each time you turn on the device or unlock the touch screen. If you forget your unlock code, bring your device to a Samsung Service Centre to reset it. Samsung is not responsible for any loss of security codes or private information or other damages caused by illegal software. Set an unlock pattern 1 In Idle mode, open the application list and select Settings Location and security Set screen lock Pattern. See the on-screen instructions and example patterns and select Next. Draw a pattern by dragging your finger to connect at least 4 dots and select Continue. Draw the pattern again to confirm and select 2 3 4 Set an unlock PIN code 1 In Idle mode, open the application list and select Settings Location and security Set screen lock PIN. Enter a new PIN (numeric) and select Continue. Confirm. 2 38 Getting started Enter the PIN again and select 3 Set an unlock password 1 OK. OK. Lock your SIM or USIM card In Idle mode, open the application list and select Settings Location and security Set screen lock Password. Enter a new password (alphanumeric) and select Continue. Enter the password again and select 2 3 You can lock your device by activating the PIN supplied with your SIM or USIM card. 1 In Idle mode, open the application list and select Settings Location and security Set up SIM card lock. Select a SIM or USIM card Enter your PIN and select 2 3 Once the PIN lock is enabled, you must enter the PIN each time you turn on the device. Lock SIM card. OK. If you enter an incorrect PIN too many times, your SIM or USIM card will be blocked. You must enter a PIN unlock key (PUK) to unblock the SIM or USIM card. If you block your SIM or USIM card by entering an incorrect PUK, bring the card to your service provider to unblock it. Getting started 39 Switch SIM or USIM cards Once you insert two SIM or USIM cards, you can switch back and forth between each card. To switch between SIM or USIM cards, press [
] except for when the device is sending or receiving messages or data from the network. Activate the SIM or USIM card 1
]. Activate. In Idle mode, open the application list and select Settings SIM cards management Network. You can also press and hold [
Select the SIM or USIM card you want to activate. Select the check box next to Select 2 3 4 Change the names and icons of the SIM or 1 2 USIM cards In Idle mode, open the application list and select Settings SIM cards management Register Card. Select a SIM or USIM card. Save. 40 Getting started 3 Change the icon and the name for the SIM or USIM card, and select Save.
12
12
1
12
1
12
Activate the mobile tracker When someone inserts a new SIM or USIM card in your device, the mobile tracker feature will automatically send the contact number to specified recipients to help you locate and recover your device. 1 In Idle mode, open the application list and select Settings Location and security Set mobile tracker. Enter a new password for the mobile tracker, enter the new password again, and select OK. Select Enter phone numbers and select Enter a senders name. Enter the text message to be sent to the recipients. Select Save Accept. Recipients. Save. 2 3 4 5 6 7 Getting started 41 Enter text You can enter text by selecting characters on the virtual keypad or by inputting handwriting on the screen. You cannot enter text in some languages. To enter text, you should change the writing language to one of the supported languages. p. 140 1 2 Enter text using the Samsung IME keypad Scroll left or right on the keypad to switch between keypad types. Enter text by selecting alphanumeric keys or writing on the screen. You can also use the following keys:
4 5 6 1 2 3 42 Getting started Number Function 1 2 3 4 5 6 Switch to Symbol/Number mode. Access the keypad settings; Change the keyboard type (tap and hold). Insert a space. Clear your input. Start a new line. Change the input language. In the handwriting mode, you can use the following gestures:
Function Gesture Space Enter Backspace When entering text with the 3x4 keypad, you can use the following modes:
Option Pinyin Function 1.
). Select the input mode key to switch to Pinyin mode (
Select appropriate virtual keys to enter pinyins. Select a pinyin. Select and select a character. 2. 3. 4. Getting started 43 Option Stroke ABC T9 Korean Number Symbol Function 1.
).
). to switch to T9 and select a character. Select the input mode key to switch to Stroke mode(
Select appropriate virtual keys to enter strokes. Select 6 when you are unsure which stroke to enter. Select Select the input mode key to switch to ABC mode (
Select an appropriate virtual key until the character you want appears. In ABC mode, select mode. The dot turns green in T9 mode. Select appropriate virtual keys to enter characters. Select the input mode key to switch to Korean mode (
Select an appropriate virtual key until the character you want appears. You can enter vowels by combining , , and Select switch to Number mode. Select appropriate virtual keys to enter numbers. Select Select you want. Select appropriate virtual keys to enter symbols. switch to Symbol mode. or to scroll to a symbol set
). 2. 3. 1. 2. 1. 2. 1. 2. 1. 2. 1. 2. 3. 44 Getting started
. Copy and paste text Select word or Select all to select the text you While you are entering text, you can use the copy and paste feature to use text in other applications. 1 2 3 4 5 6 7 Place the cursor on the text you want to copy. Select Select want. Drag Select clipboard. In another application, place the cursor where you want to paste the text. Select into the text field. or Copy to copy, or Cut to cut the text onto the Paste to insert the text from the clipboard to select the text you want. Getting started 45 Communication Calling Learn to use calling functions, such as making and answering calls, using options available during a call or customising and using call-related features. You can use the buttons or the touch screen when you make, accept, end or reject calls. Make or answer a call When you turn on the proximity sensor, your device automatically turns off and locks the touch screen to prevent accidental inputs when you hold the device near your face. p. 133 Static electricity discharged from your body or clothing may interfere with the proximity sensor during a call. 46 Communication Make a call 1 In Idle mode, select Phone Keypad. 1 2 5 6 3 4 7 8 Number Function 1 2 3 4 5 6 7 8 Access the call log. Open the dialling screen. Make a voice call. Make an IP call. Access the contact list. Access your favourite contacts. Send a message. Make a video call. Communication 47 2 3 4 Enter an area code and a phone number. You can set the device to show the area code. In Idle mode, open the application list and select Settings Call Phone number locator Enable PNL. to make a voice call. Select For a video call, select To end the call, select
. End call. Use the phonebook to save numbers you dial frequently. p. 85 To quickly access the call log to redial the numbers you dialled recently, select Phone Logs. Answer a call 1 When a call comes in, drag reaches the border of the circle. in any direction until it When the device is ringing, press the Volume key to mute the ringtone. To end the call, select End call. 2 48 Communication Reject a call When a call comes in, drag the border of the circle. in any direction until it reaches To send a message when you reject incoming calls, select Reject call with message. First set a text message to be sent to callers. In Idle mode, open the application list and select Settings Call Set reject messages. Make an IP call 1 2 Phone Keypad and enter an area In Idle mode, select code and a phone number. Select Your device automatically adds the preset IP call number in front of the phone number and dials the number over the internet. You can change to another prefix and add a new IP call prefix. In Idle mode, open the application list and select Settings Call IP Call List. Communication 49 Use a pause Learn to add a pause between your numbers when entering a PIN or account number on an automatic answering system, such as mobile banking. 1 In Idle mode, select code and a phone number. 2 Press [
3 Enter additional numbers. 4 Select Phone Keypad and enter an area
] Add 2 sec pause or Add wait. to dial the phone number. For a 2-second pause, the additional numbers will be sent to the system automatically after 2 seconds. For a waiting pause, select window appears. Yes when a pop-up Call an international number 1 2 In Idle mode, select 0 to insert the + character. Enter the complete number you want to dial (country code, area code and phone number), and then select Phone Keypad, and tap and hold to dial the number. Use a headset By plugging a headset into the device, you can answer and control calls hands-free:
To answer a call, press the headset button. To reject a call, press and hold the headset button. 50 Communication To place a call on hold or retrieve a held call during a call, press and hold the headset button. To end a call, press the headset button. You can use the following options while a call is in progress:
Use options during a voice call 1 2 3 4 5 6 7 Number 1 2 3 4 Function Place a call on hold. To retrieve a held call, tap Record a call conversation. Activate the speakerphone feature. In noisy environments, you may have difficulty hearing some calls while using the speakerphone feature. For better audio performance, use the normal phone mode. Open the dialling screen. Communication 51 Number Function 5 6 7 End a current call. Converse with the other party via a Bluetooth headset. Turn off the microphone so that the other party cannot hear you. You can use the following options while a voice call is in progress:
To adjust the voice volume, press the Volume key up or down. right when a call waiting To answer a second call, drag tone sounds. The device asks whether to end or hold the first call. You must subscribe to the call waiting service to use this feature. To open the phonebook, press [
] Memo. To add a memo, press [
To switch between the two calls, select To make a multiparty call (conference call), make or answer a second call and select Merge when connected to the second party. Repeat to add more parties. You must subscribe to the multiparty call service to use this feature.
] Contacts. Swap. 52 Communication
]
Use options during a video call You can use the following options while a video call is in progress:
] Outgoing image. To switch between the front and rear camera lens, select Switch camera. To turn off the microphone so that the other party cannot hear you, select Mute. To hide your image from the other party, press [
Hide me. To select an alternative image to be shown to the other party, press [
] Dialpad. To open the dialling screen, press [
To listen and talk to the other party via a Bluetooth headset, press [
To activate the speakerphone feature, press [
Speaker on. To use the other partys image, tap and hold the other partys image. You can capture an image of the screen or record the video call. Your device will display calls you have missed on the display. To dial the number of a missed call, open the shortcuts panel and select the missed call. View and dial missed calls
] Switch to headset.
]
Communication 53 Use additional features You can use various other call-related features, such as auto rejection, Fixed Dialling Number (FDN) mode, or call diverting or barring. Set auto rejection Use auto rejection to reject calls from certain numbers automatically. To activate auto rejection and create auto reject lists, 1 2 In Idle mode, open the application list and select Settings Call Call rejection a call type. Select Auto reject mode an option. Option Function All numbers Auto reject numbers Reject all calls. Reject calls from phone numbers on the auto reject list. 3 4 5 6 7 Auto reject list. Add and enter a phone number. Match criteria an option (if necessary). Save. Select Select Select Select To add more numbers, repeat steps 4-6. 54 Communication Use Fixed Dialling Number (FDN) mode In FDN mode, your device will restrict outgoing calls, except for the numbers stored in the FDN list. To activate FDN mode, 1 In Idle mode, open the application list and select Settings Call Additional settings a SIM or USIM card Fixed Dialing Numbers Enable FDN. Enter the PIN2 supplied with your SIM or USIM card and select OK. Select mode. FDN list and add contacts to be used in FDN 2 3 Set call forwarding Call diverting is a network feature to send incoming calls to another number that you specify. You can set this feature separately for several conditions when you are not able to answer calls, such as when you are already on the phone or when you are outside of the service area. 1 In Idle mode, open the application list and select Settings Call Call forwarding a call type a SIM or USIM card. Select a condition. Enter a number to which calls will be forwarded and select Enable. Your setting will be sent to the network. 2 3 Set call barring Call barring is a network feature to restrict certain types of calling or to prevent others from making calls with your device. Communication 55 1 2 3 In Idle mode, open the application list and select Settings Call Additional settings a SIM or USIM card Call barring a call type. Select a call barring option. Enter a call barring password and select Your setting will be sent to the network. OK. Set call waiting Call waiting is a network feature to alert you of an incoming call while you are on a previous call. This feature is available only for voice calls. In Idle mode, open the application list and select Settings Call Additional settings a SIM or USIM card Call waiting. Your setting will be sent to the network. You can view logs of your calls filtered by their types. 1 2
] View by an option to sort the call logs. In Idle mode, select Press [
View call logs Phone Logs. From the call logs, you can make a call or send a message directly to a contact by quickly flicking the contact to the left or right. Select a log to view its details. 3 From the detail view, you can dial the number, send a message to the number or add the number to the phonebook or reject list. 56 Communication Messaging Learn to create and send text (SMS) or multimedia (MMS) messages, and view or manage messages you have sent or received. 1 2 3 Send a text message In Idle mode, select Messaging. Select Add recipients of your message. Enter phone numbers manually and separate them by inserting a semicolon or comma. Select phone numbers from the lists by selecting
. Tap to enter message and enter your message To insert emoticons, press [
To insert a text template, select Send to send the message.
] Insert smiley. a template. Send a multimedia message In Idle mode, select Messaging. Select
. Communication 57 Select text. Select 4 5 1 2 3 4 5 6 7 1 2 3 Add recipients of your message. Enter phone numbers or email addresses manually and separate them by inserting a semicolon or a comma. Select phone numbers or email addresses from the lists by selecting When you enter an email address, the device will convert the message as a multimedia message. Tap to enter message and enter your message
] Add subject and add a subject for the To insert emoticons, press [
To insert a text template, select Press [
message. Select text. Select You can select a file from the file list or create a new photo, video, or sound. Select
] Insert smiley. a template. Send to send the message. and add an item. View a text or multimedia message In Idle mode, select Messaging. Your messages are grouped into message threads by contact, like a messenger. Select a contact. Select a message to view the details. 58 Communication Listen to voice mail messages If you have set missed calls to be diverted to the voice mail server, callers may leave voice messages when you do not answer incoming calls. To access your voice mail inbox and listen to voice mail messages, 1 2 In Idle mode, select and hold 1. Follow the instructions from the voice mail server. Phone Keypad and then tap You must save the voice mail server number before accessing the server. Your service provider can give you the number. Email Learn to send or view email messages via your personal or company email account. 1 2 3 4 Set up an email account In Idle mode, open the application list and select Email. Select an email service name to use or another general email account. Enter your email address and password. Select setup (for other company email accounts). Next (for general email accounts) or Manual Others for Communication 59 Follow the on-screen instructions. 5 When you are finished setting up the email account, the email messages are downloaded to your device. If you have created more than two accounts, you can switch between email accounts; Select an account name at the top left of the screen and select one you want to retrieve messages from. 1 2 3 Send an email message In Idle mode, open the application list and select Email. Select Add recipients of your message. Enter email addresses manually and separate them by inserting a semicolon or a comma. Select email addresses from the lists by selecting Select the subject field to enter a subject. Select the text input field to enter your email text. Select Attach and attach a file. You cannot attach Digital Rights Management (DRM)-
protected files. Select Send to send the message. If you are offline or outside your service area, the message will be held in the message thread list until you are online and in your service area. 4 5 6 7 60 Communication View an email message When you open an email account, you can view previously retrieved emails offline or connect to the email server to view new messages. After retrieving email messages, you can view them offline. 1 2 3 From the message view, use the following options:
To move to the previous or next message, select In Idle mode, open the application list and select an email account. Press [
Select an email message.
] Refresh to update the message list. Email or
. To move the message to another folder, select To delete the message, select To reply to the message, select To forward the message to other people, select Forward. To view an attachment, select save it to your device, select Reply. the attachment. To
.
Learn to chat with friends and family via the Fetion messenger. With Fetion, you can stay available to other users by receiving and sending instant messages. For more information, contact your service provider. Communication 61 1 2 1 2 3 4 Log in to the Fetion messenger In Idle mode, open the application list and select Enter your user name and password and select
. Start a chat
. In Idle mode, open the application list and select All list. The chat screen opens. Select a contact from the If you are not logged in, you can send a text message to one of your phonebook contacts. Select Local contact a contact. Enter your message and select To end the chat, press [
] End chat. Send. 139 Mail You can receive emails from your preset account assigned by your service provider, and reply promptly when a new email arrives. For more details, contact your service provider. 1 2 Set up an email account using 139 mail In Idle mode, open the application list and select Mail. Start the 139 Mail wizard to create a 139 Mail account. The account will be added to the message centre automatically. 139 62 Communication 1 2 View an email message In Idle mode, open the application list and select
. Select an email message. 139 Social Hub Learn to access Social Hub, the integrated communication application for Social Network Service
(SNS), email, messages, or instant messages. Visit socialhub.samsungapps.com for more details. 1 2 3 In Idle mode, open the application list and select Hub. If you are launching this application for the first time, add an account or skip it for a later setup. Check and use contents delivered from Social Hub. Social Communication 63 Entertainment Camera Learn how to capture and view photos and videos. You can take photos at resolutions up to 2560 x 1920 pixels
(5 megapixels) and videos at resolutions up to 1280 x 720 pixels. The camera automatically turns off when you do not use it for a specified period. The memory capacity may differ depending on the shooting scene or shooting conditions. 1 2 Capture a photo In Idle mode, open the application list and select Camera to turn on the camera. Aim the lens at the subject and make any necessary adjustments. 1 3 4 2 64 Entertainment 5 6 Number Function 1 2 3 4 5 6 Change the camera settings. Open the image viewer to view photos you captured. Use camera shortcuts.
: Change the flash setting.
: Switch between the front and rear camera lenses. You can add or remove shortcuts to frequently used options. p. 74 View the default storage location. Capture a photo. Switch to the camcorder. 3 4 5 Press the Volume key to zoom in or out. You can also tap the screen with two fingers and spread them apart (move your fingers closer together to zoom out). Tap where you want to focus on the preview screen. The focus frame moves to the place you tap and changes to green when the subject is in focus. Select The photo is saved automatically. to take a photo. After taking photos, select the image viewer icon to view the taken photos. To view more photos, scroll left or right. Entertainment 65
-
To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also double-tap the screen. To send a photo to others, select Delete. To delete a photo, select To use additional features with a photo, select use the following options:
-
: Set a photo as wallpaper or a caller ID image for More and Share. Set as a contact. Rename
: Rename a photo file. Capture a photo by using preset options for various scenes Your camera provides you with predefined settings for various scenes. You can simply select the proper mode for your shooting conditions and subjects. For example, when you take photos at night, select the night mode that uses an extended exposure. 1 2 3 4 5 In Idle mode, open the application list and select Camera to turn on the camera. Select Press [
Make any necessary adjustments. Select Scene mode a scene.
]. to take a photo. 66 Entertainment to take a photo. Self-portrait. Capture a photo in Self shot mode In Idle mode, open the application list and select Camera to turn on the camera. Select Make any necessary adjustments. Select You can take photos of yourself conveniently using the front camera lens. 1 2 3 4 Your camera can recognise peoples faces and help you take photos of their smiling faces. 1 2 3 4 In Idle mode, open the application list and select Camera to turn on the camera. Select Make any necessary adjustments. Aim the camera lens at your subject and select Your device recognises people in an image and detects their smiles. When the subject smiles, the device automatically takes a photo. Capture a photo in Smile shot mode Shooting mode Smile shot. Capture a panoramic photo You can take wide panoramic photos using Panorama shooting mode. This mode is convenient for photographing landscapes. 1 2 In Idle mode, open the application list and select Camera to turn on the camera. Select Shooting mode Panorama. Entertainment 67 3 4 5 Make any necessary adjustments. Select to take the first photo. Slowly move the device in any direction and align the green frame with the viewfinder. When you have aligned the green frame and viewfinder, the camera will automatically take the next photo. Repeat step 5 to complete the panoramic photo. Capture a photo of action 6 You can capture shots of a moving subject and then combine them into a single photo that shows the action. 1 2 3 4 5 In Idle mode, open the application list and select Camera to turn on the camera. Select Make any necessary adjustments. Select Move the device to follow the moving subject. The device automatically captures the next photos. Continue to follow the subject until the device has captured all the shots necessary for the action photo. Shooting mode Action shot. to capture the first photo. 6 Capture a photo in Cartoon mode You can take photos with cartoon effects. 1 2 3 4 In Idle mode, open the application list and select Camera to turn on the camera. Select Make any necessary adjustments. Select Shooting mode Cartoon. to take a photo. 68 Entertainment Customise camera settings Before taking a photo, select options:
to access the following Option Edit shortcuts Self-portrait Flash Shooting mode Function Add or remove shortcuts to frequently used options. Switch between the front and rear camera lenses. Change the flash setting; You can manually turn the flash on or off, or set the camera to automatically use the flash when needed. Change the shooting mode. Scene mode Change the scene mode. Exposure value Focus mode Timer Effects Resolution White balance ISO Metering Adjust the exposure value. Take close-up photos or set the camera to focus on the subject. Select the length of the delay before the camera takes a photo. Apply a special effect, such as sepia or black and white tones. Change the resolution option. Adjust the colour balance according to lighting conditions. Adjust the sensitivity of the camera imaging sensor. Select a type of exposure metre. Entertainment 69 Option Auto contrast Image quality GPS tag Storage Function Automatically adjust contrast between your subject and background. Set the quality level for your photos. Set the camera to include location information for your photos. To improve GPS signals, avoid shooting in locations where the signal may be obstructed, such as between buildings or in low-lying areas, or in poor weather conditions. Your location may appear on your photos when you upload them to the web. To avoid this, deactivate the GPS tag setting. Select a memory location for storing captured photos. Reset menus and shooting options. Reset 1 2 Record a video In Idle mode, open the application list and select Camera to turn on the camera. Drag the slider to the camcorder to switch to the camcorder. 70 Entertainment 3 Aim the lens at the subject and make any necessary adjustments. 1 3 4 2 Number Function 5 6 1 2 3 Change the camcorder settings. Open the image viewer to view videos you recorded. Use camcorder shortcuts.
: Change the flash setting.
: Change the recording mode or switch between the front and rear camera lenses. You can add or remove shortcuts to frequently used options. p. 74 Entertainment 71 Number 4 5 6 Function Check the camcorder status.
: Length of video that can be recorded (according to available memory)
: Default storage location Switch to the camera. Record a video. 4 5 6 Press the Volume key to zoom in or out. You can also tap the screen with two fingers and spread them apart (move your fingers closer together to zoom out). The zoom function may be unavailable when recording in the highest resolution. Select Select The video is saved automatically. to start recording. to stop recording. The camcorder may not be able to properly record videos to a memory card with a slow transfer speed. After recording videos, select the image viewer icon to view the recorded videos. To view more videos, scroll left or right. Share. To send a video to others, select Delete. To delete a video, select 72 Entertainment More and
: Play a video. Play Rename To use additional features with a video, select use the following options:
-
-
Before recording a video, select options:
Customise camcorder settings
: Rename a video file. to access the following Option Edit shortcuts Flash Recording mode Exposure value Timer Effects Resolution White balance Video quality Storage Reset Function Add or remove shortcuts to frequently used options. Change the flash setting; You can manually turn the flash on or off. Change the recording mode. Adjust the exposure value. Select the length of the delay before the camera starts recording a video. Apply a special effect, such as sepia or black and white tones. Change the resolution option. Adjust the colour balance according to lighting conditions. Set the quality level for your videos. Select a memory location for storing recorded videos. Reset menus and recording options. Entertainment 73 Edit the shortcut icons You can add or remove shortcuts to frequently used options. 1 Edit shortcuts or 2 From the preview screen, press [
Tap and hold an icon from the option list and drag it to the shortcut area. To remove shortcuts, tap and hold an icon and drag it to the option list. Press [
] to return to the preview screen.
] Edit shortcuts. select 3 Videos Learn to use the video player to play various kinds of videos. The video player supports the following file formats: 3gp, mp4, avi, wmv, flv, mkv, rm, rmvb (Codec: MPEG4, H.263, H.264, DivX, RV30, RV40). Avoid locking the devices screen while playing a DivX Video-On-Demand. Each time you lock the screen while playing a DivX Video-On-Demand, one of your available rental counts will be decremented. Some file formats are not supported depending on the software of the device. If the file size exceeds the available memory, an error can occur when you open files. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. 1 2 74 In Idle mode, open the application list and select Videos. Select a video to play. Entertainment 3 4 Rotate the device to landscape view. Control playback with the following icons:
Icon Function to resume Change a ratio of the video screen. Restart playback; Skip backward
(double-tap); Scan backward in a file
(tap and hold). Pause playback; Select playback. Stop playback. Skip forward; Scan forward in a file (tap and hold). Activate the 5.1 channel surround sound system when a headset is connected. Adjust the volume. Gallery Learn to view photos and play videos saved in your devices memory and memory card. Type Supported file formats Format Image bmp, gif, jpg, png, agif, wbmp Entertainment 75 Type Video Format 3gp, mp4, avi, wmv, flv, mkv, rm, rmvb
(Codec: MPEG4, H.263, Sorenson H.263, H.264, DivX, RV30, RV40) Avoid locking the devices screen while playing a DivX Video-On-Demand. Each time you lock the screen while playing a DivX Video-On-Demand, one of your available rental counts will be decremented. Some file formats are not supported depending on the software of the device. If the file size exceeds the available memory, an error can occur when you open files. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. View a photo In Idle mode, open the application list and select Gallery. Select a folder. To change the view mode, select right of the screen. Select a photo (with no icon) to view. 1 2 3 4 While viewing a photo, use the following options:
To view more photos, scroll left or right. To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also double-tap the screen. or at the top 76 Entertainment
-
-
-
-
-
-
-
1 2 3 4
]
Send via.
] Set as.
] Share via. To send a photo to others, select Delete Confirm deletions. To delete a photo, select To share a photo with others via AllShare or community websites, press [
To set a photo as wallpaper or a caller ID image for a contact, press [
To use additional features with a photo, press [
More and use the following options:
-
-
Copy
: Copy a photo file. Print
: Print a photo using a WLAN or connection. Your device is compatible only with some Samsung printers. Edit Crop Rotate left Rotate right Slideshow Rename Details
: Edit a photo file.
: Crop an image from a photo.
: Rename a photo file.
: View photo details.
: Start a slideshow in the selected folder.
: Rotate a photo anti-clockwise.
: Rotate a photo clockwise. Play a video In Idle mode, open the application list and select Gallery. Select a video (with the Rotate the device to landscape view. Control playback with the virtual keys. icon) to play. p. 74 Entertainment 77 Photo editor You can edit photos and apply various effects. 1 2 In Idle mode, open the application list and select editor. Select picture a folder an image. Select To take a new photo, select Capture picture. Select New selection OK. Photo To add to or subtract from the selection border, select Add to selection or Remove from selection. Inverse To reverse the selection, select selection. To change the selection size, select To rotate or flip the image, select To crop the image, select To undo or redo your last action, select Drag your finger over the area you want to select. Select a filter effect. To use additional tools, such as copying and warping, select Adjust the image as desired (if necessary) and select Done. When you are finished, press [
to apply a colour effect, or select
] Save. or
. to apply 3 4 5 6 7 78 Entertainment Music Learn to listen to your favourite music while on the go with the music player. The music player supports the following file formats: mp3, m4a, mp4, 3gp, 3ga, wma, ogg, oga, aac, flac. Some file formats are not supported depending on the software of the device. If the file size exceeds the available memory, an error can occur when you open files. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. p. 103 p. 112 Add music files to your device Start by transferring files to your device or memory card:
p. 94 Download from the wireless web. Download from a PC with Samsung Kies. Receive via Bluetooth. Copy to your memory card. Synchronise with Windows Media Player 11. After transferring music files to your device or memory card, 1 Music. 2 In Idle mode, open the application list and select Select a music category a music file. Play music p. 113 p. 112 Entertainment 79 3 Control playback with the following icons:
Icon Function Adjust the volume. Activate the 5.1 channel surround sound system when a headset is connected. Activate Shuffle mode. Change the repeat mode (off, repeating a file, or repeating all files). Restart playback; Skip backward
(double-tap); Scan backward in a file
(tap and hold). Pause playback; Select playback. Stop playback. Skip forward; Scan forward in a file (tap and hold). to resume You can control the music player with a headset. In Idle mode, press and hold the headset button to launch the music player. Press the headset button to start or pause playback. 1 2 3 Create a playlist In Idle mode, open the application list and select Select Press [
] Create. Playlists. Music. 80 Entertainment Add. Save. Add music.
] Add to playlist. Add songs to the quick list Enter a title for your new playlist and select Select Select the files you want to include and select 4 5 6 During playback, you can add files to a playlist by pressing
[
You can add songs to the quick list and save them as a playlist. During playback, press [
add the current song to the quick list. To go to the quick list, from the music library screen, select Playlists Quick list. To save the quick list as a playlist, press [
1 2 3 Customise music player settings In Idle mode, open the application list and select Press [
Adjust the following settings to customise your music player:
] Save as playlist.
] Settings.
] Add to quick list to Music. Option Equaliser Sound effect Music menu Visualisation Function Select a default equaliser type. Select a sound effect. Select music categories to display on the music library screen. Display an animated visualisation during playback. Entertainment 81 FM radio Learn to listen to music and news on the FM radio. To listen to the FM radio, you must connect a headset, which serves as the radio antenna. 1 2 Listen to the FM radio Plug a headset into the device. In Idle mode, open the application list and select radio. The FM radio scans and saves available stations automatically. FM The first time you turn on the FM radio, it will start automatic tuning. Automatic tuning will only locate stations with an adequate signal. 3 Control the FM radio with the following keys:
4 5 2 1 2 3 82 Entertainment Number Function 1 2 3 4 5 Turn the FM radio on or off. Search for an available radio station. Add the current radio station to the favourites list. Adjust the volume. Fine-tune the frequency. Save a radio station automatically Plug a headset into the device. In Idle mode, open the application list and select radio. Press [
The FM radio scans and saves available stations automatically.
] Scan a scanning option. FM Add a radio station to the favourites list Plug a headset into the device. In Idle mode, open the application list and select radio. Select to turn on the FM radio. FM 1 2 3 1 2 3 Entertainment 83 4 5 1 2 3 Scroll to the radio station you want. Select to add the radio station to the favourites list. You can add a name for a radio station or remove a radio station; Tap and hold a radio station on the favourites list and select Remove or Rename. Customise FM radio settings In Idle mode, open the application list and select radio. Press [
Adjust the following settings to customise your FM radio:
] Settings. FM Option Background playing FM auto off Function Set whether or not to run the FM radio in the background while using other applications. If this feature is on, you can control the FM radio from the shortcuts panel. Set the FM radio to automatically turn off after a specified length of time. 84 Entertainment Personal information Contacts Learn to create and manage a list of your personal or business contacts. You can save names, mobile phone numbers, home phone numbers, email addresses, birthdays and more for your contacts. Create a contact 1 2 3
. Contacts. In Idle mode, select Select Select a memory location. If you have more than one account, select an account to which you want to add the contact. Enter contact information. 4
. To delete an item, To add a new item, select select If you are saving the contact on a SIM or USIM card, you can save only the contacts name and a phone number. Select Save to add the contact to memory. 5 You can also create a contact from the dialling screen. 1 2 In Idle mode, select Enter a phone number. Phone Keypad. Personal information 85 3 4 5 6 1 2
. Add to Contacts Select Select a memory location. If you have more than one account, select an account to which you want to add the contact. Enter contact information. Select Save to add the contact to memory. Find a contact In Idle mode, select Contacts. Scroll up or down on the contact list. You can also drag your finger along the index on the right side to quickly scroll through the list. Select a contacts name. 3 Once you find a contact, you can use the following options:
To make a voice call, select To make a video call, select To make an IP call, select To send a message, select To send an email message, select an email address.
] Edit. To edit the contact information, press [
To set as a favourite, select 1 2 3 Set a speed dial number Contacts. In Idle mode, select Press [
Select a location number
] Speed dial settings. a contact. IP call. Video call. 86 Personal information 4 1 2 3 4 Select a phone number (if necessary). You can quickly dial this number by tapping and holding the location number from the dialling screen. Create your namecard In Idle mode, select Press [
Enter your own personal details. Select
] My profile. Contacts. Save. You can send your namecard by attaching it to a message or email or transferring it via the Bluetooth wireless feature. Retrieve contacts from your community accounts Contacts.
] More View Friends. In Idle mode, select Press [
Select an account. Follow the on-screen instructions. You can view the list of community website accounts and select an account to add a contact from the website to your phone contacts. 1 2 3 4 By creating groups of contacts, you can manage multiple contacts and send messages or email to an entire group. Start by creating a group. 1 In Idle mode, select Create a group of contacts Contacts. Personal information 87 Save. Groups. Contacts.
] Import/Export Import from SIM card Scroll left or right to
] Create. Press [
Enter a name and select a ringtone for the group. Add member, select contacts to add to the Select group, and select Add. Select 2 3 4 5 6 Copy contacts To copy contacts from the SIM or USIM card to your device, 1 2 3 In Idle mode, select Press [
a SIM or USIM card. Select a memory location. If you have more than one account, select an account to which you want to add the contact. Select contacts to copy and select In Idle mode, select Press [
a SIM or USIM card. Select contacts to copy and select 4 To copy contacts from your device to the SIM or USIM card, 1 2 3 To import contact files (in vcf format) from a memory card to your device, 1 2
] Import/Export Export to SIM card
] Import/Export Import from SD card. In Idle mode, select Press [
Import or export contacts Export Yes. Contacts. Contacts. Import. 88 Personal information 3 Select a memory location. If you have more than one account, select an account to which you want to add the contact. Select an option for importing a single contact file, multiple contact files, or all contact files, and select OK. Select contact files to import and select 4 5 To export contacts from your device to a memory card, 1 2 3 In Idle mode, select Press [
Select
] Import/Export Export to SD card. OK to confirm. Contacts. OK. Calendar Learn to create and manage daily, weekly or monthly events, and set alarms to remind yourself of important events. 1 2 3 4 To change the calendar view, 1 Create an event In Idle mode, open the application list and select Calendar. Select Enter the details of the event as required. Select In Idle mode, open the application list and select Calendar. Tap to create event or press [
View events
] Create. Save. Personal information 89 Select a view mode from the top of the calendar. 2 To view events of a specific date, 1 2 In Idle mode, open the application list and select Calendar. Select a date on the calendar. In month view, days with scheduled events are indicated by a small square. To move to a specific day by entering a date manually,
] Go to, enter the date by selecting + or press [
-, and select Set. To select todays date, press [
Select an event to view its details.
] Today. You can send the event to others by pressing [
Send via an option.
]
3 Stop an event alarm If you set an alarm for a calendar event, the event alarm icon will appear at the specified time. 1 2 3 Open the shortcuts panel from the top of the screen. Select a reminder to view more details about the event. To snooze or dismiss the reminder, select the check box and then select Snooze all or Dismiss all. Task Learn to create a task list and set alarms to remind yourself of important tasks or set priority. 90 Personal information 1 2 3 4 1 2 3 Create a task In Idle mode, open the application list and select Select a task. Enter the details of the task. Select Create task or press [
Task.
] Create to create Save. View a task In Idle mode, open the application list and select Press [
Select a task to view its details. For completed tasks with an expired deadline, you can set their status to completed by selecting the check box.
] List by an option to sort the tasks. Task. You can send the task to others by pressing [
Share an option.
]
Memo Learn to record important information to save and view at a later date. 1 2 3 Create a memo In Idle mode, open the application list and select If there is a memo saved, select
] Create to create a memo.
[
Enter your memo text and select Memo. Create memo or press Save. Personal information 91 1 2 3 View memos In Idle mode, open the application list and select Press [
for a memo (if necessary). Select a memo to view its details. To use additional features with a memo, select
] Search or press and hold [
. Memo.
] to search Option Function Edit the memo. Delete a memo. Change the colour of the memo. Lock the memo. Print the memo using WLAN connection. You can send the memo by pressing [
an option. You can upload the memo to a community website by pressing [
] Update SNS.
] Send 92 Personal information 5 1 2 3 Voice recorder Learn to operate your devices voice recorder. 1 2 3 4 Record a voice memo In Idle mode, open the application list and select recorder. Select Speak into the microphone. Stop. When you are finished, select Your memo is saved automatically. To record more voice memos, select Record to start recording. Record again. Voice Play a voice memo In Idle mode, open the application list and select recorder. List. Select Select a voice memo to play. Voice You can send the voice memo to others by pressing
[
] Share an option. Personal information 93 Web Web services require a data connection. Contact your operator to choose the best data plan. Internet Learn to access and bookmark your favourite web pages. You may incur additional charges for accessing the web and downloading media files. For details, contact your service provider. Available icons may vary depending on your region or service provider. Browse web pages 1 In Idle mode, open the application list and select Internet to launch a specified homepage. To access a specific web page, select the URL input field, enter the web address (URL) of the web page, and select Navigate web pages with the following keys:
. 2 1 2 Number 1 Function Enter the web address of a web page to access. 94 Web Number 2 Function Open a list of saved bookmarks, frequently visited pages and recent internet history.
] New window.
]
While browsing the web page, use the following options:
To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also double-tap the screen. To open a new window, press [
To view the currently active windows, press [
Windows. You can open multiple pages and switch back and forth between them.
]
To adjust the brightness of the screen, press [
Browser brightness. This feature may be unavailable depending on your region. To reload the current web page, press [
To go to a next page in history, press [
To bookmark the current web page, press [
Add bookmark. To add a shortcut to the current web page to the idle
] More Add shortcut to home screen, press [
screen. To search for text on the web page, press [
Find on page. To view the web page details, press [
Page info. To send the web address (URL) of the web page to others, press [
To view the web browser in Full screen mode, press [
More Toggle fullscreen.
] Refresh.
] Forward.
] More Share page.
] More
]
] More
] More Web 95
] More
] More
] More Exit. Bookmark your favourite web pages To view the download history, press [
Downloads. To customise the browser settings, press [
Settings. To print the current web page or screen using a WLAN or
] More Print. Your device USB connection, press [
is compatible only with some Samsung printers. To close the web browser, press [
If you know the web address of the web page, you can manually add a bookmark. To add a bookmark, 1 2 3 In Idle mode, open the application list and select Internet. Select Select page. To bookmark the web page you were viewing, skip to step 5. Enter a page title and a web address (URL). Select 4 5 From the bookmark list, tap and hold a bookmark and use the following options:
To open the web page in the current window, select To open the web page in a new window, select new window. To edit the bookmark details, select To add the bookmark shortcut to the idle screen, select Add shortcut to home screen.
] Bookmark last-viewed Bookmarks. Edit bookmark. Add or press [
Open in OK. Open. 96 Web To send the web address (URL) of the web page to others, select Share link. To copy the web address (URL) of the web page, select Copy link URL. To delete the bookmark, select To use the web page as your homepage of the browser, select Set as homepage. Delete bookmark. Access the frequently visited pages or the recent history In Idle mode, open the application list and select Internet. Select Select a web page to access. Most visited or History. 1 2 3 You can add a web page to the bookmark list by selecting
. MM (Mobile Market) You can download games, ringtones, or other applications from the Market. This feature may be unavailable depending on your region or service provider. In Idle mode, open the application list and select Search for a file and download it to the device. MM. 1 2 Web 97 Mobile Reader Learn to access the online ebook reader service and read electronic book, contents, such as a variety of books, newspaper, and magazines. 1 2 In Idle mode, open the application list and select Reader. Select a category an ebook content. Mobile Mobile Stock 1 2 In Idle mode, open the application list and select Stock. Use the online stock transaction service to check market conditions. Mobile Navigator Learn about the navigation service that gives you road guides and information about your location and trip distance. Navigation maps, your current location, and other navigational data may differ from actual location information. You should always pay attention to road conditions, traffic, and any other factors that may affect your driving and follow all safety warnings and regulations while driving. In Idle mode, open the application list and select Navigator. Follow the on-screen instructions to start the mobile navigator. 1 2 98 Web Phonebook manager Learn to back up and restore your contacts and calendar events by using the online phonebook on the web server preset by your service provider. 1 2 In Idle mode, open the application list and select Phonebook manager. Back up your contact information and manage them online. Renren Renren is a social networking site. You can keep in touch with your people in Renren. 1 2 In Idle mode, open the application list and select Renren. Enter your user name and password and sign in. Weibo SinaWeibo is the online community website in China. You can access the Weibo (Microblog) and share your interests and thoughts using one sentence. In Idle mode, open the application list and select Weibo. Web 99
e Learn to find and connect to a WLAN provided by your service provider. 1 2 3 In Idle mode, open the application list and select If you are launching this application for the first time, read the on-screen instructions and select . Enter a network name and a password and select
.
e. 10086.CN Access the 10086.cn homepage and use a variety of web services. In Idle mode, open the application list and select 10086.CN. 100 Web Connectivity Bluetooth Bluetooth is a short-range wireless communications technology capable of exchanging information over a distance of about 10 m without requiring a physical connection. You do not need to line up the devices to beam information with Bluetooth. If the devices are within range of one another, you can exchange information between them even if they are located in different rooms. Samsung is not responsible for the loss, interception, or misuse of data sent or received via the Bluetooth wireless feature. Always ensure that you share and receive data with devices that are trusted and properly secured. If there are obstacles between the devices, the operating distance may be reduced. Some devices, especially those that are not tested or approved by Bluetooth SIG, may be incompatible with your device. Turn on the Bluetooth wireless feature 1 In Idle mode, open the application list and select Settings Wireless and network Bluetooth settings. Select feature. Bluetooth to turn on the Bluetooth wireless 2 Connectivity 101 1 2 3 1 2 3 Find and pair with other Bluetooth-enabled devices In Idle mode, open the application list and select Settings Wireless and network Bluetooth settings Search for devices. Select a device. Enter a PIN for the Bluetooth wireless feature or the other devices Bluetooth PIN, if it has one, and select OK. Alternatively, select Accept to match the PIN between your device and the device. When the owner of the other device enters the same PIN or accepts the connection, pairing is complete. If the pairing is successful, the device will automatically search for available services. Some devices, especially headsets or hands-free car kits, may have a fixed Bluetooth PIN, such as 0000. If the other device has a PIN, you must enter it. Send data using the Bluetooth wireless feature Select a file or item, such as a contact, calendar event, memo, or media file, from an appropriate application or My files. Select an option for sending data via Bluetooth. The method for selecting an option may vary by data type. Search for and pair with a Bluetooth-enabled device. 102 Connectivity Receive data using the Bluetooth wireless 1 feature In Idle mode, open the application list and select Settings Wireless and network Bluetooth settings Visible. Your device is visible to other Bluetooth devices for a specified period. You can set the duration that your device is visible to other Bluetooth devices by selecting Visible time-out. When prompted, enter the PIN for the Bluetooth wireless feature and select OK. Alternatively, select Accept to match the PIN between your device and the device. Select data from the device. Accept to confirm that you are willing to receive 2 3 Received data is saved to the bluetooth folder. If you receive a contact, it is automatically saved to the phonebook. WLAN Learn to use your devices wireless networking capabilities to activate and connect to any wireless local area network
(WLAN) compatible with the IEEE 802.11 b/g standards. You can connect to the internet or other network devices anywhere an access point or wireless hotspot is available. Connectivity 103 Activate the WLAN feature In Idle mode, open the application list and select Settings Wireless and network WLAN settings WLAN. An active WLAN running in the background will consume battery power. To preserve battery power, activate the WLAN only when needed. 1 2 3 4 1 2 3 4 Find and connect to a WLAN In Idle mode, open the application list and select Settings Wireless and network WLAN settings. The device will automatically search for available WLANs. Select a network under Enter a password for the network (if necessary). Select WLAN networks. Connect. Add a WLAN manually In Idle mode, open the application list and select Settings Wireless and network WLAN settings Add WLAN network. Enter the SSID for the network and select the security type. Set the security settings depending on the selected security type. Save. Select 104 Connectivity Connect to a WLAN using a WLAN Protected Setup (WPS) Using WPS, you can connect to a secured network. To connect to a WLAN with a WPS button, 1 2 3 In Idle mode, open the application list and select Settings Wireless and network WLAN settings. Select Press a WPS button on the access point within 2 minutes. WPS button connection. To connect to a WLAN with a WPS PIN, 1 2 3 In Idle mode, open the application list and select Settings Wireless and network WLAN settings. Select a network indicated by the WPS icon and select WPS PIN. On the access point, enter the PIN and press the start button. WLAN Direct Learn to use the WLAN Direct feature to connect two devices via a WLAN without requiring an access point. 1 Connect your device to another device In Idle mode, open the application list and select Settings Wireless and network WLAN Direct settings OK OK WLAN Direct. Press [
] Scan. 2 Connectivity 105 3 1 2 Select a device and then select When the owner of the other device accepts the connection, the devices are connected. Connect. Send data via a WLAN Select a file or item, such as a memo, media file, or web address, from an appropriate application or My files. Select an option for sending data via a WLAN. The method for selecting an option may vary by data type. Search for and select another device. 3 When prompted, select OK to confirm that you are willing to receive data. Received data is saved to the ShareViaWifi folder. Receive data via a WLAN AllShare Learn to use the Digital Living Network Alliance (DLNA) service that enables you to share media files between DLNA-
enabled devices in your home over a WLAN. You must first activate the WLAN feature and add a WLAN profile. p. 104 The supported file formats may vary depending on the software of the device. Some files may not play on the DLNA-enabled devices depending on the devices. 106 Connectivity Customise DLNA settings for sharing media files To allow other DLNA-enabled devices to access media files on your device, you must activate media sharing. 1 2 3 In Idle mode, open the application list and select AllShare. Press [
Adjust the following settings to customise the DLNA feature:
] Settings. Option Device name Share videos Share photos Share music Upload from other devices Default memory Subtitles Function Enter a name for your device as a media server. Turn on video sharing with other DLNA-enabled devices. Turn on image sharing with other DLNA-enabled devices. Turn on music sharing with other DLNA-enabled devices. Set whether or not to accept the upload from other devices. Select the default memory location for saving downloaded media files. Set to display subtitles. 1 Play your files on another DLNA-enabled device In Idle mode, open the application list and select AllShare. Connectivity 107 2 3 4 5 1 2 3 4 5 6 My device. Select Select a media category and a file. Select a playerthe one that will play the media file. Playback begins at the selected player. Control playback using icons of your device. Playback may be buffered, depending on the network connection and the connected server. Remote device. Play files of one device on the other device In Idle mode, open the application list and select AllShare. Select Your device automatically searches for DLNA-enabled devices. Select a device as the media serverthe one that contains media files. Select a media category and a file. Select a playerthe one that will play the media file. Playback begins at the selected player. Control playback using icons of your device. Mobile network sharing Learn to set your device as a wireless modem or wireless access point for PCs or other devices, and share your devices mobile network connection. 108 Connectivity 2 3 4 5 6 Share your devices mobile network via 1 WLAN In Idle mode, open the application list and select Settings Wireless and network Tethering and portable hotspot. Select Select tethering feature. Select network settings to use your device as an access point:
Portable WLAN hotspot settings OK. Portable WLAN hotspot to activate the WLAN Configure portable WLAN hotspot to configure Function Option Network SSID View and edit the device name that will be shown to external devices. Select the security type. Security Save. When you are finished, select From another device, locate your devices name in the available connection list and connect to the network. Your device shares the mobile network connection on another device. Share your devices mobile network via USB 1 2 Using a USB cable, connect the multifunction jack on your device to a PC. In Idle mode, open the application list and select Settings Wireless and network Tethering and portable hotspot. Connectivity 109 3 USB tethering to activate the USB tethering Select feature. Your device shares the mobile network connection on your PC. To stop sharing the network connection, clear the check box next to USB tethering. The sharing method for the network connection may differ depending on the PCs operating system. GPS Your device is equipped with a global positioning system
(GPS) receiver. Learn to activate location services. To receive better GPS signals, avoid using your device in the following conditions:
between buildings, in tunnels or underground passages, or inside buildings in poor weather around high voltage or electromagnetic fields in a vehicle with sun protection film Do not touch or cover the antenna area with your hands or other objects while using the GPS functions. This feature may be unavailable depending on your region or service provider. Activate location services You must activate location services to receive location information and search the map. 1 In Idle mode, open the application list and select Settings Location and security. 110 Connectivity 2 Adjust the following settings to activate location services:
Option Use GPS satellites Use sensor aiding Function Set to use the GPS satellite for finding your location. Use sensors to enhance pedestrian positioning when the GPS signal is obstructed. There may be variations between the sensor estimates and your actual location. PC connections Learn to connect your device to a PC with a USB cable in USB connection modes. By connecting the device to a PC, you can synchronise files with Windows Media Player, transfer data to and from your device directly, and use the Samsung Kies program. To use PC connections, you must deactivate USB debugging mode. In Idle mode, open the application list and select Settings Applications Development, and then clear the check box next to USB debugging. Connectivity 111 Connect with Samsung Kies Ensure that Samsung Kies is installed on your PC. You can download the program from the Samsung website
(www.samsung.com/kies). 1 2 3 Using a USB cable, connect the multifunction jack on your device to a PC. Double-click the Samsung Kies icon on your PC to launch Samsung Kies. Transfer or synchronise mobile data, such as contacts, calendars, music, or photos, between Samsung Kies and your device. Refer to the Samsung Kies help for more information. Synchronise with Windows Media Player Ensure that Windows Media Player is installed on your PC. 1 Using a USB cable, connect the multifunction jack on your device to a PC with Windows Media Player installed. When connected, a pop-up window will appear on the PC. Open Windows Media Player to synchronise music files. Edit or enter your devices name in the pop-up window
(if necessary). Select and drag the music files you want to the sync list. Start synchronisation. 2 3 4 5 112 Connectivity Connect as a mass storage device You can connect your device to a PC as a removable disk and access the file directory. If you insert a memory card in the device, you can access the file directory of the memory card by using the device as a memory card reader. Please download the corresponding USB drivers from Samsung website (www.samsung.com/cn) and install it correctly in your PC before using your phone as a removable disc. The file directory of the memory card will appear as a removable disk, separate from the internal memory. 1 2 3 4 5 6 7 If you want to transfer files from or to a memory card, insert a memory card into the device. In Idle mode, open the application list and select Settings Wireless and network USB utilities Connect storage to PC. Using a USB cable, connect the multifunction jack on your device to a PC. When connected, select Open the folder to view files. Copy files from the PC to the memory card. When you are finished, select from PC. Connect storage to PC. Disconnect storage To disconnect the device from the PC, click the USB device icon on the Windows task bar and click the option to safely remove the mass storage device. Then remove the USB cable from the PC. Otherwise, you may lose data stored on the memory card or damage the memory card. Connectivity 113 VPN connections You can create virtual private networks (VPN) and connect to your private network securely through a public network, such as the internet. Your device should already be configured with internet access. If you have trouble accessing the internet, you need to edit connections. If you are not sure about the connection information to enter, ask your service provider. 1 2 3 Set up VPN connections In Idle mode, open the application list and select Settings Wireless and network VPN settings Add VPN. Select a VPN type. Customise the connection information. Available options may vary depending on the VPN type. Option Function VPN name Set VPN server Enable Encryption Set IPsec pre-
shared key Enable L2TP secret Enter a name of the VPN server. Enter the IP address of the VPN server. Set to encrypt the VPN server. Enter a pre-shared key. Set to use the L2TP secret password. 114 Connectivity Option Set L2TP secret Set user certificate Set CA certificate DNS search domains Function Enter the L2TP secret password. Select a user certificate that the VPN server uses to identify you. You can import certificates from the VPN server or download from the web. Select a certificate authority (CA) certificate that the VPN server uses to identify you. You can import certificates from the VPN server or download from the web. Enter the domain name server (DNS) address. 4 1 2 3 When you are finished, press [
] Save. Connect to a private network In Idle mode, open the application list and select Settings Wireless and network VPN settings. Select a private network. Enter the user name and password and select Connect. Connectivity 115 Connectivity Bluetooth Bluetooth is a short-range wireless communications technology capable of exchanging information over a distance of about 10 m without requiring a physical connection. You do not need to line up the devices to beam information with Bluetooth. If the devices are within range of one another, you can exchange information between them even if they are located in different rooms. Samsung is not responsible for the loss, interception, or misuse of data sent or received via the Bluetooth wireless feature. Always ensure that you share and receive data with devices that are trusted and properly secured. If there are obstacles between the devices, the operating distance may be reduced. Some devices, especially those that are not tested or approved by Bluetooth SIG, may be incompatible with your device. Turn on the Bluetooth wireless feature 1 2 In Menu mode, select Bluetooth. Select feature. Bluetooth to turn on the Bluetooth wireless Settings Connectivity Connectivity 3 Settings My phones visibility Always To allow other devices to locate your device, select on Set. If you selected Custom, enter duration that your device is visible and select Done. Settings My Once the Bluetooth wireless feature is active, select and use the following options:
To change your devices name, select phones name. To set limits on browsing your files to others, select Settings Secure mode. To check Bluetooth services available on your device and information about the services, select Bluetooth services. Find and pair with other Bluetooth-enabled devices 1 In Menu mode, select Bluetooth Search. 2 Select a device. 3 Enter a PIN for the Bluetooth wireless feature or the other devices Bluetooth PIN, if it has one, and select Done. Alternatively, select Yes to match the PIN between your device and the device. When the owner of the other device enters the same PIN or accepts the connection, pairing is complete. If the pairing is successful, the device will automatically search for available services. Settings Connectivity Some devices, especially headsets or hands-free car kits, may have a fixed Bluetooth PIN, such as 0000. If the other device has a PIN, you must enter it. Connectivity Service Rename. Browse files. Once the device is paired with another Bluetooth-enabled device, the device icon will turn green. Select a paired device and use the following options:
To browse files on the paired device, select To view the service list of the paired device, select list. To change the paired device name, select To allow the paired device to access and browse your files, select Authorise device. Send My files. To send your files to the paired device, select To end the connection and delete the paired device, select Delete. Send data using the Bluetooth wireless feature 1 Select a file or item, such as a contact, calendar event, memo, task, or media file, from an appropriate application or My files. 2 an option for sending via Bluetooth. Select 3 Search for and pair with a Bluetooth-enabled device. Receive data using the Bluetooth wireless feature 1 Enter the PIN for the Bluetooth wireless feature and select OK (if necessary). 2 Select from the device (if necessary). Yes to confirm that you are willing to receive data Received data is saved to an appropriate application or folder according to its type. For example, a music or sound clip is saved to the sound folder and a contact to the phonebook. Connectivity Use Remote SIM mode In Remote SIM mode, you can make or answer calls only with a connected Bluetooth hands-free car kit via the SIM or USIM card on your device. To activate Remote SIM mode, 1 2 To use Remote SIM mode, start the Bluetooth connection from a Bluetooth hands-free car kit. In Menu mode, select Bluetooth. Select Settings Remote SIM mode. Settings Connectivity You must authorise the Bluetooth hands-free car kit. Wi-Fi Learn to use your devices wireless networking capabilities to activate and connect to any wireless local area network
(WLAN) compatible with the IEEE 802.11 b/g/n standards. You can connect to the internet or other network devices anywhere an access point or wireless hotspot is available. Your device uses non-harmonised frequency and is intended for use in all European countries. The WLAN can be operated in the EU without restriction indoors, but cannot be operated outdoors in France. Activate the WLAN feature In Menu mode, select Settings Connectivity Wi-Fi. An active WLAN running in the background will consume battery power. To preserve battery power, activate the WLAN only when needed. Connectivity Find and connect to a WLAN 1 2 3 Settings Connectivity Wi-Fi. In Menu mode, select The device will automatically search for available WLANs. Select the check box next to a network. Enter a password for the network and select necessary). Done (if Settings Connectivity Wi-Fi. Customise the connection profile 1 In Menu mode, select 2 Select the discovered WLAN AP. The current connection profile for the network appears. 3 Customise the connection profile of the selected WLAN:
Option Name Security type Function View the name of the profile. View the security type of the WLAN AP. Select an EAP method. This option is available depending on the selected security type. Enter your user name. This option is available depending on the selected security type. Enter your password. This option is available depending on the selected security type. IP address View your IP address of the WLAN AP. IP address type Select the IP address type of the WLAN EAP method User name Password AP. Connectivity Option Proxy address and port AP MAC Function Enter the address and port number of the proxy server. View the MAC address of the WLAN AP. To delete all details of the connection profile, select Forget. Connect to a WLAN using a Wi-Fi Protected Setup (WPS) 1 In Menu mode, select 2 Select type. 3 Press a WPS button on the AP device within 2 minutes. Or, enter a PIN on the AP device and select Start within 2 minutes. Settings Connectivity Wi-Fi. WPS PBC or WPS PIN depending on the AP device Mobile AP Learn about the Mobile AP feature, which sets your device as an wireless AP (Access Point) to connect to the internet on other network devices. 1 2 3 In Menu mode, select Mobile AP. Select feature. Select Mobile AP on the top to activate the Mobile AP Settings Connectivity OK to confirm. Connectivity Tools Clock
] Create. Create alarm or press [
Clock Learn to set and control alarms and world clocks. You can also use the stopwatch and the desk clock. 1 2 3 Set a new alarm In Idle mode, open the application list and select Alarm. Select Set alarm details. Select the check box next to Smart alarm to activate simulated nature sounds with the alarm screen prior to the main alarm. When you are finished, select 4 When the alarm sounds, To stop the alarm, drag the border of the circle. To repeat the alarm after a specified length of time, drag in any direction until it reaches the border of the circle. in any direction until it reaches Stop an alarm Save. 116 Tools 1 2 3 4 1 2 3 4 1 2 3 4 5 Delete an alarm In Idle mode, open the application list and select Alarm.
] Delete. Press [
Select alarms to delete. Select Delete. Clock Create a world clock In Idle mode, open the application list and select World clock. Select Enter a city name or select one from the city list. To select a city in the world map view, select
. To add more world clocks, repeat steps 2-3. Add city or press [
] Add. Clock To apply the summer time to the clocks, tap and hold a clock and select DST settings. Use the stopwatch In Idle mode, open the application list and select Stopwatch. Start to begin the stopwatch. Select Lap to record lap times. Select When you are finished, select Select Stop. Reset to clear recorded times. Clock Tools 117 1 2 3 4 Use the count-down timer In Idle mode, open the application list and select Timer. Set the length of time to count down. Start to begin the countdown. Select When the timer expires, drag reaches the border of the circle. in any direction until it Clock Use the desk clock The desk clock displays the current time and date, and weather. 1 2 3 4 In Idle mode, open the application list and select Desk clock. Select Press [
Change the following options:
to set an idle clock.
] Settings. Clock Option Hide status bar Wallpaper Time/Calendar display Brightness Reset to default Function Set whether to show the status bar at the top of the screen. Select a background image for the idle clock. Set to display the clock or calendar. Set the brightness of the display. Reset the desk clock settings to the factory default values. 118 Tools Calculator Learn to perform mathematical calculations directly on your device like a typical hand-held or desktop calculator. 1 2 Perform the calculation In Idle mode, open the application list and select Calculator. Use the keys that correspond to the calculator display to perform basic mathematical operations. Rotate the device to landscape view to use the scientific calculator. If you deactivate the auto
] Scientific calculator. rotation, press [
1 2 3 4 View the calculation history In Idle mode, open the application list and select Calculator. Perform the calculation. Select The calculation history appears. To clear the history, press [
to close the calculator keypad.
] Clear history. CoolDict Learn to look up English or Chinese words in your dictionary. 1 Look up a word In Idle mode, open the application list and select CoolDict. Tools 119 2 3 4 1 2 3 If you are launching this application for the first time, select Accept. Enter a Chinese or English word. Select the word. To add the word to your wordbook, select
. View your wordbook In Idle mode, open the application list and select CoolDict. Press [
Select a word from your wordbook.
] New word. Customer Service Learn to access customer services from your device or view information about where you can contact customer services. For details, contact your service provider. 1 2 In Idle mode, open the application list and select Customer Service. Call numbers and connect to wep pages to get a variety of services and information. Option Service Guide Service Hotline Function View the hotline number and web page address where you can receive after-sales services for your device. Make a call to the China Mobile service centre. 120 Tools Option SMS Customer Center Customer Center Online Customer Manager Settings Function Send a text message the China Mobile service centre. Access the online China Mobile service centre. Make a call to the contact in the customer centre. Set the name and phone number of a contact in the customer centre. Device Software update. Find software updates to check the server for Device management Learn to upgrade software files related to your devices basic configuration settings. 1 2 3 4 5 In Idle mode, open the application list and select management. Select Select available updates. Download updates, if available. When downloading is finished, access management again and select Software Update Install updates. Follow the on-screen instructions to complete the upgrading process. Device 6 Tools 121 Kies air Kies air allows you to connect a PC to your device via a WLAN. From the PC browser, you can view and control media files, contacts, messages, and any other data saved on your device. 1 2 3 Customise Kies air settings In Idle mode, open the application list and select air. Press [
Change the following options:
] Settings. Kies Option Access request Enable visibility Time-out Lock contents Reset settings Function Set to receive authorisation requests from other devices while using Kies air. Set the device to be visible to a PC. Select the length of time the device waits before ending the connection. Select the types of date that should not display on the PC browser. Reset your settings to the factory default values. 122 Tools 1 2 3 4 Kies Connect a PC to your device via a WLAN In Idle mode, open the application list and select air Start. Enter the web address displayed by Kies air in the browser on your PC. Select When connected, you will see your device data on the PCs web browser. To end the connection, select Allow (if necessary). Stop. Mini Mini diary Learn to keep a photo diary. 1 2 3 4 5 Create a Mini diary In Idle mode, open the application list and select diary. Read the information of charge and select If there is a diary saved, select new entry. Change the todays date and set the weather (if necessary). Select a photo. To add a short description of the attached photo, select Add location. Select Select Tap to add text, enter text, and select Done. Save. Tap to add photo and add an image or capture Create diary to create a 6 7 Yes. Tools 123 1 2 View a Mini diary In Idle mode, open the application list and select diary. Select a diary. Mini
] More Publish. To upload a mini diary to your community website, press [
To send a mini diary to others, press [
Send via.
] More My files Learn to quickly and easily access all of your images, videos, music, sound clips, and other types of files stored in your device and memory card. 1 2 In Idle mode, open the application list and select files. Select a folder. Select a file to open. To return to the Home directory, select To move up one level in the file directory, select Home. Up. My 3 In a folder, press [
] to use the following options:
Share. Create folder. To send a file to others, select To create a new folder, select To delete files or folders, select To change the view mode, select To sort files or folders, select To use additional features using a file, such as moving, copying or renaming option, select More. View by. Delete. List by. 124 Tools Namecard Recognition Learn to take a photo of a namecard and extract contact information from the card. 1 2 3 Capture a namecard Place the name card on a flat, well-lit surface. In Idle mode, open the application list and select Namecard Recognition. Position the device over the name card, so that the frame on the viewfinder aligns with the edges of the name card. The device automatically captures and reads the contact information from the namecard. Edit any contact details that were not converted correctly. Press [
] Add to phonebook. Customise the namecard recognition settings In Idle mode, open the application list and select Namecard Recognition. Select Adjust the following settings:
. Option Auto saving Function Set the device to save a photo of a namecard you captured. Tools 125 4 5 1 2 3 Option Auto recognition Function Set the device to automatically capture a namecard when it is properly aligned with the frame. Polaris Office Learn to view and edit document files. If you have an account with the Polaris Office web services, you can manage documents online. documents. This application supports the following file formats: doc, docx, ppt, pptx, xls, xlsx. 1 2 3 4 5 6 7 Create a document In Idle mode, open the application list and select Office. Read the registration information and select Register. Select Create the document. When you are finished, press [
Enter a name for the document and select the saving location. Select a document type.
] Save. Later or Polaris Save. 126 Tools 1 2 3 Open a document In Idle mode, open the application list and select Office. Select file. View the document as desired. My files or Recent documents a document Polaris
] Edit mode.
] Find.
]
To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers
] Zoom closer together. You can also press [
an option. To open the toolbar to edit the document (word, presentation, or excel file), press [
To search for text in a document, press [
To bookmark the current page, press [
Bookclip. To adjust a document to fit the screen, press [
Reflow text. To send a file to others, press [
file. To print a file via a WLAN or USB connection, press
[
with some Samsung printers. To read a document via the text-to-speech feature, press [
To customise the settings for displaying or managing documents, press [
Available options may vary depending on a document type.
] More Print. Your device is compatible only
] More Text to speech.
] More Settings.
] More Send
]
Tools 127 1 2 3 4 Manage documents online In Idle mode, open the application list and select Office. Select Enter your box.net email address and password to access your account, and then select Add. View and manage your documents on the server. Web files a service. Polaris Search Learn to search for applications and files in your device and specific data on the web. 1 2 3 4 In Idle mode, open the application list and select Search. Select a category. Enter a letter or a word of the data to search for. Select the items name you want to access. SIM Toolkit Use a variety of additional services offered by your service provider. Depending on your SIM or USIM card, this menu may be available but labelled differently. In Idle mode, open the application list and select SIM Toolkit. 128 Tools Task manager With the task manager, you can view currently running applications and memory information. 1 2 In Idle mode, open the application list and select manager. Use the following options:
Task
: View the total amount of memory used
: View the list of all the Active applications applications currently running on your device. Downloaded for applications installed on your device. RAM Storage your device and memory card. Help life and RAM manager.
: Check and manage the RAM for your device.
: View the used and available memory on
: View help information about extending battery Tools 129 Settings Access the Settings menu 1 2 In Idle mode, open the application list and select Settings. Select a setting category and select an option. SIM cards management Access and alter the settings to control the network and the card settings for your device. p. 40 Flight mode Wireless and network Change the settings for wireless network connections. Disable all wireless functions on your device. You can use only non-network services. WLAN settings WLAN Connect to network manually manual input when connecting to a network. Network notification an open network is available.
: Turn the WLAN feature on or off. p. 104
: Set the device to notify you when
: Set the device to require 130 Settings
: Add WLAN APs manually.
: Connect to a WLAN using a WPS button connection WLAN Protected Setup (WPS) button. Add WLAN network WLAN Direct settings WLAN Direct two devices via a WLAN without requiring an access point. p. 105
: View or edit your devices name and
: Activate the WLAN Direct feature to connect Device name password. Status Disconnect WLAN Direct Kies via WLAN
: Disconnect the connected
: View the connection status. device. Connect your device to Samsung Kies via a WLAN. Bluetooth settings Bluetooth p. 101 Device name Visible devices. Visible time-out Search for devices Connect your device to a PC as a mass storage. p. 113
: Set a Bluetooth name for your device. USB utilities
: Set your device to be visible to other Bluetooth
: Turn the Bluetooth wireless feature on or off.
: Set duration that your device is visible.
: Search for available Bluetooth devices. Settings 131 Tethering and portable hotspot USB tethering
: Activate the USB tethering feature to share your devices mobile network connection with PCs via USB. When connected to a PC, your device is used as a wireless modem for a PC. p. 109 Portable WLAN hotspot settings
:
-
: Activate the WLAN tethering Portable WLAN hotspot feature to share your devices mobile network connection with PCs or other devices through the WLAN feature. p. 109 Configure portable WLAN hotspot settings to use your device as an access point.
: Configure network
-
VPN settings
: Learn more about USB and WLAN tethering. Help Set up and connect to virtual private networks (VPNs). p. 114 Mobile networks Use packet data networks for network services. Data roaming when you are roaming or your home network is not available. Preferred Networks Access Point Names Network operators select a network for roaming.
: Select a network type.
: Set up access point names (APNs).
: Search for available networks and
: Set to allow packet switched data
: Set the device to connect another network 132 Settings Call Customise the settings for calling features.
: Add or edit the message that will be
: Set to reject calls from specified phone Call rejection numbers automatically. You can add phone numbers to the reject list. p. 54 Set reject messages sent when you reject a call. Call alert
:
-
Outgoing call vibration the other party answers a call. Call status tones tone, minute minder tone, or call disconnection tone. Alerts on call
: Set the device to alert you alert you to events during a call.
-
-
: Activate or deactivate call connection
: Set the device to vibrate when Call answering/ending
:
-
-
: Set to answer automatically
: Set the device to answer calls by Answering key pressing the Home key. Automatic answering after a specified period (available only when a headset is connected). The power key ends calls when you press the Power key.
-
: Set the device to end a call Turn on proximity sensor: Set to turn on the proximity sensor during a call. Call forwarding Phone number locator information on calls, or update the information from the server.
: Set whether to show region
: Divert incoming calls to another number. You may incur additional charges for updating region information from the server. Settings 133 Additional settings
:
-
-
-
-
-
: Display your caller ID to other parties for
: Block incoming or outgoing calls.
: Allow incoming call alerts when a call is Caller ID outgoing calls. Call barring Call waiting in progress. Auto redial redialling a call that was not connected or cut off during a call. Fixed Dialing Numbers
: Activate or deactivate FDN mode to restrict calls to numbers in the FDN list. You must enter the PIN2 supplied with your SIM or USIM card and reboot the device.
: Activate auto redial for automatically
: Select whether or not to retry a voice
: Select an image to be shown to the Video call image other party. Use call fail options call when a video call fails to connect. Automatic accept
: Set whether to automatically accept a video call when you select the accept by voice call option. IP Call List Voicemail service another provider to receive voice mails. Voicemail
: Enter the number to access the voice mail service. You can obtain this number from your service provider.
: Add or manage IP call prefix numbers.
: Select your service provider or set Sound settings Change the settings for various sounds on your device.
: Activate Silent mode to mute all sounds Silent mode except media sounds and alarm ringtones. 134 Settings
: Select a sound profile to use or customise
/Phone ringtone(SIM2): Select a
: Set the time when the device
: Adjust the volume level for call ringtones,
: Set when the device will vibrate for various Phone Profiles sound options in profiles as desired. Vibration events. Auto silent mode automatically switches to the silent mode. Volume music and videos, device system sound, and notification ringtones. Phone ringtone(SIM1) ringtone to alert you to incoming calls. Notification ringtone events, such as incoming messages and missed calls. Audible touch tones touch the keys on the dialling screen. Audible selection select an application or option on the touch screen. Screen lock sounds lock or unlock the touch screen. Haptic feedback touch the keys. Vibration intensity haptic feedback.
: Set the device to vibrate when you
: Set the device to sound when you
: Set the device to sound when you
: Select a ringtone to alert you to
: Adjust the vibration intensity of the
: Set the device to sound when you Display Change the settings for the display. Screen display
:
-
-
: Change the font type for the display text. Font style Home screen
:
Wallpaper: Select a background image for the idle screen. Settings 135
-
Lock screen
:
Wallpaper: Select an image to display when the screen is locked. Clock position: Select the location of the clock on the locked screen.
: Set the device to display animation when you
: Set whether or not to rotate the
: Set the brightness of the display. Brightness Auto-rotate screen content automatically when the device is rotated. Animation switch between windows. Screen time-out before turning off the displays backlight. Touch key light duration key backlight. Horizontal calibration
: Calibrate the accelerometer to adjust the horizontal axis of the device for better motion recognition.
: Set the length of time the device waits
: Set the duration for the touch
: Automatically activate Power
: Select a power level for Power Power saving mode Use Power saving mode saving mode when the battery is low. Power saving mode at saving mode. Turn off WLAN device is not connected with a WLAN AP. Turn off Bluetooth when not in use. Turn off GPS Turn off Sync synchronising with a web server.
: Deactivate the WLAN feature when the
: Deactivate the Bluetooth feature
: Deactivate the GPS feature when not in use.
: Turn off sync when the device is not 136 Settings
: Activate the brightness level for Power saving
: Set the brightness of the display. Brightness mode. Brightness Screen time-out before turning off the displays backlight. Power saving tips consumption.
: Learn how to reduce battery
: Set the length of time the device waits Location and security Change the settings for securing your device and the SIM or USIM card, and GPS functionality.
: Set to use sensors to enhance
: Set the device to download data
: Set to use the GPS satellite for finding Use GPS satellites your location. Use sensor aiding pedestrian positioning when the GPS signal is obstructed. There may be variations between the sensor estimates and your actual location. A-GPS function automatically to improve GPS functionality. GPS Satellite view GPS clock Sync with time information from the GPS satellites. Set screen lock you have set your security code, this option changes to Change screen lock.
-
None
-
Pattern PIN -
-
Password
: Set an unlock pattern to unlock the screen.
: Set a password (alphanumeric) to unlock.
: Set a PIN (numeric) to unlock the screen.
: Set the device to synchronise the clock
: Set the unlock security code. When
: View the GPS satellite information.
: Disable the screen lock. Settings 137 Set up SIM card lock
:
-
-
: Change the PIN used to access SIM Lock SIM card
: Activate or deactivate the PIN lock feature to require the PIN before using the device. Change SIM PIN or USIM data. Mobile tracker
: Activate or deactivate the mobile tracker feature which helps you locate your device when it is lost or stolen. p. 41 Set mobile tracker
( p. 41), you can customise the following settings.
: When you activate the mobile tracker The setting options may differ depending on your region or service provider.
: Set up recipients to receive a tracking
-
-
Set recipient message from your lost device. Change password tracker feature.
: Change the password for the mobile
: View device administrators
: Set the device to display your Visible passwords password as you enter. Select device administrators installed on your device. You can activate device administrators to apply new policies to your device. Use secure credentials ensure secure use of various applications. Install from USB storage that are stored in the USB storage. Set password accessing credentials. Clear storage device and reset the password.
: Create and confirm a password for
: Erase the credential contents from the
: Install encrypted certificates
: Use certificates and credentials to 138 Settings Applications Change the settings for managing installed applications.
: Select to download applications
: View available memory and the memory
: Access the list of the applications Unknown sources from any source. If you do not select this option, you can download applications only from Market. Manage applications installed on the device and check the application information. Running services access them to manage. Memory usage used by applications on your device. Battery usage your device. Development
:
-
: View the amount of power consumed by
: View the services you are using and
: Select to connect your device to USB debugging a PC by using a USB cable. This is for application development. Allow mock locations service information to be sent to a Location Manager service for testing. This is for application development.
: Allow mock locations and
-
Accounts and sync Change the settings for the auto sync feature or manage accounts for synchronisation. Background data
: Select this setting to use the auto sync feature. The auto sync will run in the background without opening applications and synchronise data. Auto-sync calendar, and email data automatically.
: Set the device to synchronise contact, Settings 139 Motion Change the settings that control motion recognition on your device. Motion activation Turn over the FM radio by placing the device face down. Tutorial
: Learn how to control the motion.
: Set to use motion recognition.
: Set to mute incoming calls, alarms, music, and Privacy Factory data reset: Reset your settings to the factory default values and delete all your data. Storage View memory information for your device and memory card. You can also format the USB storage and the memory card. Formatting a memory card will permanently delete all data from the memory card. Language and keyboard Change the settings for text input. Select language Select a display language for all menus and applications. Select a default keyboard type for text input. Select input method 140 Settings
: Select the default input method, such as the Samsung IME Input Mode QWERTY keyboard, traditional keypad, or handwriting screen. Space key to input association
: Set the device to enter the highlighted Chinese word when you select the space bar. English Prediction words according to your input and display word suggestions. Input Language Fuzzy Pinyin Input can easily enter Chinese characters that are similar in phonetic spelling. Handwriting setting
: Customise the settings for Handwriting mode, such as recognition time, pen thickness or pen colour. About
: View Samsung IME keypad information.
: Select Fuzzy pinyin pairs so that you
: Set the device to predict English
: Select languages for text input. Voice input and output Change the settings for the text-to speech feature. Text-to-speech settings Listen to an example example. Driving mode read contents aloud. Driving mode settings Driving mode.
: Specify applications to use in
: Listen to the spoken text for an
: Activate Driving mode to set the device to Settings 141
: Set the speech synthesis engine to be Always use my settings
: Set to use the speech rate and language settings you specify over the settings saved in applications. Default engine used for spoken text. Install voice data text-to-speech feature. Speech rate Language feature. Engines
: View the text-to-speech engines in your device.
: Select a language for the text-to-speech
: Select a speed for the text-to-speech feature.
: Download and install voice data for the Accessibility Accessibility
: Activate an accessibility application you have downloaded, such as Talkback or Kickback, which provide voice, melody, or vibration feedback. The power key ends calls when you press the Power key.
: Set the device to end a call Date and time Access and alter the following settings to control how time and date are displayed on your device. If the battery remains fully discharged or removed from the device, the time and date will be reset.
: Automatically update the time when you Automatic move across time zones. Set date
: Set the current date manually. 142 Settings
: Set your home time zone.
: Set the current time manually.
: Set to the time to be displayed in Select time zone Set time Use 24-hour format 24-hour format. Select date format
: Select a date format. About phone Access information about your device and check the devices status. Settings 143 Troubleshooting When you turn on your device or while you are using the device, it prompts you to enter one of the following codes:
Code Password PIN PUK PIN2 Try this to solve the problem:
When the device lock feature is enabled, you must enter the password you set for the device. When using the device for the first time or when the PIN requirement is enabled, you must enter the PIN supplied with the SIM or USIM card. You can disable this feature by using the Lock SIM card menu. Your SIM or USIM card is blocked, usually as a result of entering your PIN incorrectly several times. You must enter the PUK supplied by your service provider. When you access a menu requiring the PIN2, you must enter the PIN2 supplied with the SIM or USIM card. For details, contact your service provider. Your device displays network or service error messages When you are in areas with weak signals or poor reception, you may lose reception. Move to another area and try again. 144 Troubleshooting You cannot access some options without a subscription. Contact your service provider for more details. The touch screen responds slowly or improperly If your device has a touch screen and the touch screen is not responding properly, try the following:
Remove any protective covers from the touch screen. Protective covers may prevent the device from recognising your inputs and are not recommended for touch screen devices. Ensure that your hands are clean and dry when tapping the touch screen. Restart your device to clear any temporary software bugs. Ensure that your device software is upgraded to the latest version. If the touch screen is scratched or damaged, take it to your local Samsung Service Centre. Your device freezes or has fatal errors If your device freezes or hangs, you may need to close programs or reset the device to regain functionality. If your device is frozen and unresponsive, press and hold the Power key for XX-XX seconds until the SAMSUNG log appears. The device will reboot automatically. If this does not solve the problem, perform a factory data reset. In Idle mode, open the application list and select Settings Privacy Factory data reset Reset phone Erase everything. Troubleshooting 145 Calls are being dropped When you are in areas with weak signals or poor reception, you may lose your connection to the network. Move to another area and try again. Outgoing calls are not connected Ensure that you have pressed the Dial key. Ensure that you have accessed the right cellular network. Ensure that you have not set call barring for the phone number you are dialling. Incoming calls are not connected Ensure that your device is turned on. Ensure that you have accessed the right cellular network. Ensure that you have not set call barring for the incoming phone number. Others cannot hear you speaking on a call Ensure that you are not covering the built-in microphone. Ensure that the microphone is close to your mouth. If using a headset, ensure that it is properly connected. Audio quality is poor Ensure that you are not blocking the devices internal antenna. When you are in areas with weak signals or poor reception, you may lose reception. Move to another area and try again. 146 Troubleshooting When dialling from contacts, the call is not connected Ensure that the correct number is stored in the contact list. Re-enter and save the number, if necessary. Ensure that you have not set call barring for the contacts phone number. The device beeps and the battery icon flashes Your battery is low. Recharge or replace the battery to continue using the device. The battery does not charge properly or the device turns off The battery terminals may be dirty. Wipe both gold-
coloured contacts with a clean, soft cloth and try charging the battery again. If the battery will no longer charge completely, dispose of the old battery properly and replace it with a new battery (refer to your local ordinances for proper disposal instructions). Your device is hot to the touch When you use applications that require more power or use applications on your device for an extended period of time, your device may feel hot to the touch. This is normal and should not affect your devices lifespan or performance. Troubleshooting 147 Error messages appear when launching the camera Your Samsung mobile device must have sufficient available memory and battery power to operate the camera application. If you receive error messages when launching the camera, try the following:
Charge the battery or replace it with a battery that is fully charged. Free some memory by transferring files to a PC or deleting files from your device. Restart the device. If you are still having trouble with the camera application after trying these tips, contact a Samsung Service Centre. Error messages appear when launching the FM radio The FM radio application on your Samsung mobile device uses the headset cable as an antenna. Without a headset connected, the FM radio will be unable to receive radio stations. To use the FM radio, first ensure that the headset is properly connected. Next, scan for and save the available radio stations. If you still cannot use the FM radio after performing these steps, try accessing your desired station with another radio receiver. If you can hear the station with another receiver, your device may require service. Contact a Samsung Service Centre. 148 Troubleshooting Error messages appear when opening music files Some music files may not play on your Samsung mobile device for a variety of reasons. If you receive error messages when opening music files on your device, try the following:
Free some memory by transferring files to a PC or deleting files from your device. Ensure that the music file is not Digital Rights Management (DRM)-protected. If the file is DRM-
protected, ensure that you have the appropriate licence or key to play the file. Ensure that your device supports the file type. Another Bluetooth device is not located Ensure that the Bluetooth wireless feature is activated on your device. Ensure that the Bluetooth wireless feature is activated on the device you wish to connect to, if necessary. Ensure that your device and the other Bluetooth device are within the maximum Bluetooth range (10 m). If the tips above do not solve the problem, contact a Samsung Service Centre. A connection is not established when you connect the device to a PC Ensure that the USB cable you are using is compatible with your device. Ensure that you have the proper drivers installed and updated on your PC. Troubleshooting 149 Safety precautions To prevent injury to yourself and others or damage to your device, read all of the following information before using your device. Warning: Prevent electric shock, fire, and explosion Do not use damaged power cords or plugs, or loose electrical sockets Do not touch the power cord with wet hands, or disconnect the charger by pulling on the cord Do not bend or damage the power cord Do not use your device while charging or touch your device with wet hands Do not short-circuit the charger or the battery Do not drop or cause an impact to the charger or the battery Do not charge the battery with chargers that are not approved by the manufacturer Do not use your device during a thunderstorm Your device may malfunction and your risk of electric shock is increased. Do not handle a damaged or leaking Lithium Ion (Li-Ion) battery For safe disposal of your Li-Ion batteries, contact your nearest authorised service centre. Handle and dispose of batteries and chargers with care Use only Samsung-approved batteries and chargers specifically designed for your device. Incompatible batteries and chargers can cause serious injuries or damage to your device. Never dispose of batteries or devices in a fire. Follow all local regulations when disposing of used batteries or devices. Never place batteries or devices on or in heating devices, such as microwave ovens, stoves, or radiators. Batteries may explode when overheated. 150 Safety precautions Never crush or puncture the battery. Avoid exposing the battery to high external pressure, which can lead to an internal short circuit and overheating. Protect the device, batteries, and chargers from damage Avoid exposing your device and batteries to very cold or very hot temperatures. Extreme temperatures can cause the deformation of the device and reduce the charging capacity and life of your device and batteries. Prevent batteries from contacting metal objects, as this can create a connection between the + and terminals of your batteries and lead to temporary or permanent battery damage. Never use a damaged charger or battery. Caution: Follow all safety warnings and regulations when using your device in restricted areas Turn off your device where prohibited Comply with all regulations that restrict the use of a mobile device in a particular area. Do not use your device near other electronic devices Most electronic devices use radio frequency signals. Your device may interfere with other electronic devices. Do not use your device near a pacemaker Avoid using your device within a 15 cm range of a pacemaker if possible, as your device can interfere with the pacemaker. If you must use your device, keep it at least 15 cm away from the pacemaker. To minimise the possible interference with a pacemaker, use your device on the opposite side of your body from the pacemaker. Do not use your device in a hospital or near medical equipment that can be interfered with by radio frequency If you personally use any medical equipment, contact the manufacturer of the equipment to ensure the safety of your equipment from radio frequency. If you are using a hearing aid, contact the manufacturer for information about radio interference Some hearing aids may be interfered with by the radio frequency of your device. Contact the manufacturer to ensure the safety of your hearing aid. Safety precautions 151 Turn off the device in potentially explosive environments Turn off your device in potentially explosive environments instead of removing the battery. Always comply with regulations, instructions and signs in potentially explosive environments. Do not use your device at refuelling points (service stations), near fuels or chemicals, and at blasting areas. Do not store or carry flammable liquids, gases, or explosive materials in the same compartment as the device, its parts, or accessories. Turn off your device when in an aircraft Using your device in an aircraft is illegal. Your device may interfere with the electronic navigation instruments of the aircraft. Electronic devices in a motor vehicle may malfunction due to the radio frequency of your device Electronic devices in your car may malfunction due to radio frequency of your device. Contact the manufacturer for more information. Do not use a headset while operating an automobile, motorcycle, or bicycle Doing so can lead to a serious accident and may be prohibited by law in some areas. Using a headset while walking or jogging on roads or in crosswalks can lead to a serious accident. Comply with all safety warnings and regulations regarding mobile device usage while operating a vehicle While driving, safely operating the vehicle is your first responsibility. Never use your mobile device while driving, if it is prohibited by law. For your safety and the safety of others, practice good common sense and remember the following tips:
Use a hands-free device. Get to know your device and its convenience features, such as speed dial and redial. These features help you reduce the time needed to place or receive calls on your mobile device. Position your device within easy reach. Be able to access your wireless device without removing your eyes from the road. If you receive an incoming call at an inconvenient time, let your voice mail answer it for you. 152 Safety precautions Let the person you are speaking with know you are driving. Suspend calls in heavy traffic or hazardous weather conditions. Rain, sleet, snow, ice, and heavy traffic can be hazardous. Do not take notes or look up phone numbers. Jotting down a to do list or flipping through your address book takes attention away from your primary responsibility of driving safely. Dial sensibly and assess the traffic. Place calls when you are not moving or before pulling into traffic. Try to plan calls when your car will be stationary. If you need to make a call, dial only a few numbers, check the road and your mirrors, then continue. Do not engage in stressful or emotional conversations that may be distracting. Make people you are talking with aware you are driving and suspend conversations that have the potential to divert your attention from the road. Use your device to call for help. Dial a local emergency number in the case of fire, traffic accident, or medical emergencies. Use your device to help others in emergencies. If you see an auto accident, a crime in progress, or a serious emergency where lives are in danger, call a local emergency number. Call roadside assistance or a special, non-emergency assistance number when necessary. If you see a broken-down vehicle posing no serious hazard, a broken traffic signal, a minor traffic accident where no one appears injured, or a vehicle you know to be stolen, call roadside assistance or another special, non-emergency number. Proper care and use of your mobile device Keep your device dry Humidity and all types of liquids may damage device parts or electronic circuits. Do not turn on your device if it is wet. If your device is already on, turn it off and remove the battery immediately (if the device will not turn off or you cannot remove the battery, leave it as-is). Then, dry the device with a towel and take it to a service centre. Liquids will change the colour of the label that indicates water damage inside the device. Water damage to your device can void your manufacturers warranty. Do not use or store your device in dusty, dirty areas Dust can cause your device to malfunction. Do not store your device on slopes If your device falls, it can be damaged. Safety precautions 153 Do not store your device in hot or cold areas. Use your device at
-20 C to 50 C Your device can explode if left inside a closed vehicle, as the inside temperature can reach up to 80 C. Do not expose your device to direct sunlight for extended periods of time
(such as on the dashboard of a car). Store the battery at 0 C to 40 C. Do not store your device with such metal objects as coins, keys and necklaces Your device may become deformed or malfunction. If the battery terminals are in contact with metal objects, it may cause a fire. Do not store your device near magnetic fields Your device may malfunction or the battery may discharge from exposure to magnetic fields. Magnetic stripe cards, including credit cards, phone cards, passbooks, and boarding passes, may be damaged by magnetic fields. Do not use carrying cases or accessories with magnetic closures or allow your device to come in contact with magnetic fields for extended periods of time. Do not store your device near or in heaters, microwaves, hot cooking equipment, or high pressure containers The battery may leak. Your device may overheat and cause a fire. Do not drop your device or cause impacts to your device The screen of your device may be damaged. If bent or deformed, your device may be damaged or parts may malfunction. Do not use your device or applications for a while if the device is overheated Prolonged exposure of your skin to an overheated device may cause low temperature burn symptoms, such as red spots and pigmentation. If your device has a camera flash or light, do not use a flash close to the eyes of people or pets Using a flash close to the eyes may cause temporary loss of vision or damage to the eyes. 154 Safety precautions Use caution when exposed to flashing lights While using your device, leave some lights on in the room and do not hold the screen too close to your eyes. Seizures or blackouts can occur when you are exposed to flashing lights while watching videos or playing Flash-based games for extended periods. If you feel any discomfort, stop using the device immediately. Reduce the risk of repetitive motion injuries When you repetitively perform actions, such as pressing keys, drawing characters on a touch screen with your fingers, or playing games, you may experience occasional discomfort in your hands, neck, shoulders, or other parts of your body. When using your device for extended periods, hold the device with a relaxed grip, press the keys lightly, and take frequent breaks. If you continue to have discomfort during or after such use, stop use and see a physician. Ensure maximum battery and charger life Avoid charging batteries for more than a week, as overcharging may shorten battery life. Over time, unused batteries will discharge and must be recharged before use. Disconnect chargers from power sources when not in use. Use batteries only for their intended purposes. Maximum battery life This information is based on fully charged batteries. Time1 Standby time Voice call time2 Video call time Battery Standard battery (xxxx mAh) up to xxx hours up to xxx minutes up to xxx hours 1. Battery life is affected by many conditions, including your usage habits and the condition of the battery. As a result, all talk times and standby times are estimates and cannot be guaranteed. 2. Criterion for Measuring Time: The talk time is measured with an input level of +10 dBm, Voice Rate Half. Safety precautions 155 Depending on how you use your device, actual operation time may vary and may be shorter than declared. Standby time will be reduced in the following conditions:
When you use the additional features on your device such as writing and storing messages, playing games, and connecting to the internet If you are frequently out of the service area If you are out of the service area for a long period of time Use manufacturer-approved batteries, chargers, accessories and supplies Using generic batteries or chargers may shorten the life of your device or cause the device to malfunction. Samsung cannot be responsible for the users safety when using accessories or supplies that are not approved by Samsung. Do not bite or suck on the device or the battery Doing so may damage the device or cause explosion. If children use the device, make sure that they use the device properly. When speaking on the device:
Hold the device upright, as you would with a traditional phone. Speak directly into the mouthpiece. Avoid contact with your devices internal antenna. Touching the antenna may reduce the call quality or cause the device to transmit more radio frequency than necessary. Protect your hearing and ears when using a headset Excessive exposure to loud sounds can cause hearing damage. Exposure to loud sounds while driving may distract your attention and cause an accident. Always turn the volume down before plugging the earphones into an audio source and use only the minimum volume setting necessary to hear your conversation or music. In dry environments, static electricity can build up in the headset. Avoid using headsets in dry environments or touch a metal object to discharge static electricity before connecting a headset to the device. 156 Safety precautions Use caution when using the device while walking or moving Always be aware of your surroundings to avoid injury to yourself or others. Do not carry your device in your back pockets or around your waist You can be injured or damage the device if you fall. Do not disassemble, modify, or repair your device Any changes or modifications to your device can void your manufacturers warranty. For service, take your device to a Samsung Service Centre. Do not disassemble or puncture the battery, as this can cause explosion or fire. Do not paint or put stickers on your device Paint and stickers can clog moving parts and prevent proper operation. If you are allergic to paint or metal parts of the product, you may experience itching, eczema, or swelling of the skin. When this happens, stop using the product and consult your physician. When cleaning your device:
Wipe your device or charger with a towel or an eraser. Clean the terminals of the battery with a cotton ball or a towel. Do not use chemicals or detergents. Do not use the device if the screen is cracked or broken Broken glass or acrylic could cause injury to your hands and face. Take the device to a Samsung Service Centre to have it repaired. Do not use the device for anything other than its intended use Avoid disturbing others when using the device in public Do not allow children to use your device Your device is not a toy. Do not allow children to play with it as they could hurt themselves and others, damage the device, or make calls that increase your charges. Install mobile devices and equipment with caution Ensure that any mobile devices or related equipment installed in your vehicle are securely mounted. Avoid placing your device and accessories near or in an air bag deployment area. Improperly installed wireless equipment can cause serious injury when air bags inflate rapidly. Safety precautions 157 Allow only qualified personnel to service your device Allowing unqualified personnel to service your device may result in damage to your device and will void your manufacturers warranty. Handle SIM cards or memory cards with care Do not remove a card while the device is transferring or accessing information, as this could result in loss of data and/or damage to the card or device. Protect cards from strong shocks, static electricity, and electrical noise from other devices. Do not touch gold-coloured contacts or terminals with your fingers or metal objects. If dirty, wipe the card with a soft cloth. Ensure access to emergency services Emergency calls from your device may not be possible in some areas or circumstances. Before travelling in remote or undeveloped areas, plan an alternative method of contacting emergency services personnel. Keep your personal and important data safe While using your device, be sure to back up important data. Samsung is not responsible for data loss. When disposing of your device, back up all data and then reset your device to prevent misuse of your personal information. Do not distribute copyright-protected material Do not distribute copyright-protected material that you have recorded to others without the permission of the content owners. Doing this may violate copyright laws. The manufacturer is not liable for any legal issues caused by the users illegal use of copyrighted material. The names and content of toxic and hazardous substances or elements Part PBA Plastic Metal Toxic and hazardous substances or elements Pb X O X Hg Cd Cr6+
PBB PBDE O O O O O O O O O O O O O O O 158 Safety precautions Part Battery Accessory Toxic and hazardous substances or elements Pb X X Hg O O Cd O O Cr6+
PBB PBDE O O O O O O O: Indicates that the toxic or hazardous substance contained in all of the homogeneous materials for this part is below the limit specified in SJ/
T11363-2006. Indicates that the toxic or hazardous substance contained in at least one of the homogeneous materials used for this part is above the limit specified in SJ/T11363-2006. X:
The information provided in this table is based on figures presented by supply manufacturers and tests conducted by Samsung. All toxic and hazardous substances or elements are used at the minimum level allowed by current technology. Samsung continues to make every effort to reduce the need for these substances or elements through improved technology. The environmental protection use period for this product is 20 years and the corresponding logo is as shown on the left. Exchangeable parts, such as batteries, may have different periods of warranty. The environmental protection use period is valid only when the product is used under normal conditions, as described in the user manual. Safety precautions 159 Disclaimer Some content and services accessible through this device belong to third parties and are protected by copyright, patent, trademark and/or other intellectual property laws. Such content and services are provided solely for your personal noncommercial use. You may not use any content or services in a manner that has not been authorised by the content owner or service provider. Without limiting the foregoing, unless expressly authorised by the applicable content owner or service provider, you may not modify, copy, republish, upload, post, transmit, translate, sell, create derivative works, exploit, or distribute in any manner or medium any content or services displayed through this device. THIRD PARTY CONTENT AND SERVICES ARE PROVIDED AS IS. SAMSUNG DOES NOT WARRANT CONTENT OR SERVICES SO PROVIDED, EITHER EXPRESSLY OR IMPLIEDLY, FOR ANY PURPOSE. SAMSUNG EXPRESSLY DISCLAIMS ANY IMPLIED WARRANTIES, INCLUDING BUT NOT LIMITED TO, WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. SAMSUNG DOES NOT GUARANTEE THE ACCURACY, VALIDITY, TIMELINESS, LEGALITY, OR COMPLETENESS OF ANY CONTENT OR SERVICE MADE AVAILABLE THROUGH THIS DEVICE AND UNDER NO CIRCUMSTANCES, INCLUDING NEGLIGENCE, SHALL SAMSUNG BE LIABLE, WHETHER IN CONTRACT OR TORT, FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL OR CONSEQUENTIAL DAMAGES, ATTORNEY FEES, EXPENSES, OR ANY OTHER DAMAGES ARISING OUT OF, OR IN CONNECTION WITH, ANY INFORMATION CONTAINED IN, OR AS A RESULT OF THE USE OF ANY CONTENT OR SERVICE BY YOU OR ANY THIRD PARTY, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. Third party services may be terminated or interrupted at any time, and Samsung makes no representation or warranty that any content or service will remain available for any period of time. Content and services are transmitted by third parties by means of networks and transmission facilities over which Samsung has no control. Without limiting the generality of this disclaimer, Samsung expressly disclaims any responsibility or liability for any interruption or suspension of any content or service made available through this device. Samsung is neither responsible nor liable for customer service related to the content and services. Any question or request for service relating to the content or services should be made directly to the respective content and service providers. 160 Safety precautions Some of the contents in this manual may differ from your device depending on the software of your device or your service provider. The maximum of SAR is 0.880 W/kg, and accords with the requirement of standard GB 21288-2007.
9
(300385)
2
(518057)
(516029)
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2012-01-31 | 2402 ~ 2480 | DSS - Part 15 Spread Spectrum Transmitter | Original Equipment |
2 | 1850.2 ~ 1909.8 | PCE - PCS Licensed Transmitter held to ear | ||
3 | 2412 ~ 2462 | DTS - Digital Transmission System | ||
4 | JBP - Part 15 Class B Computing Device Peripheral |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 3 4 | Effective |
2012-01-31
|
||||
1 2 3 4 | Applicant's complete, legal business name |
Samsung Electronics Co Ltd
|
||||
1 2 3 4 | FCC Registration Number (FRN) |
0005810205
|
||||
1 2 3 4 | Physical Address |
19 Chapin Rd., Building D
|
||||
1 2 3 4 |
Pine Brook, New Jersey 07058
|
|||||
1 2 3 4 |
United States
|
|||||
app s | TCB Information | |||||
1 2 3 4 | TCB Application Email Address |
t******@pctestlab.com
|
||||
1 2 3 4 | TCB Scope |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
||||
1 2 3 4 |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
|||||
1 2 3 4 |
A1: Low Power Transmitters below 1 GHz (except Spread Spectrum), Unintentional Radiators, EAS (Part 11) & Consumer ISM devices
|
|||||
app s | FCC ID | |||||
1 2 3 4 | Grantee Code |
A3L
|
||||
1 2 3 4 | Equipment Product Code |
GTB9062
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 3 4 | Name |
J****** C******
|
||||
1 2 3 4 | Title |
General Manager
|
||||
1 2 3 4 | Telephone Number |
973-8********
|
||||
1 2 3 4 | Fax Number |
973-8********
|
||||
1 2 3 4 |
j******@samsung.com
|
|||||
app s | Technical Contact | |||||
1 2 3 4 | Firm Name |
PCTEST Engineering Lab., Inc.
|
||||
1 2 3 4 | Name |
R****** O******
|
||||
1 2 3 4 | Physical Address |
6660-B Dobbin Road
|
||||
1 2 3 4 |
Columbia, Maryland 21045
|
|||||
1 2 3 4 |
United States
|
|||||
1 2 3 4 | Telephone Number |
410-2********
|
||||
1 2 3 4 | Fax Number |
410-2********
|
||||
1 2 3 4 |
t******@pctestlab.com
|
|||||
app s | Non Technical Contact | |||||
n/a | ||||||
app s | Confidentiality (long or short term) | |||||
1 2 3 4 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 4 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 4 | If so, specify the short-term confidentiality release date (MM/DD/YYYY format) | 07/29/2012 | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 3 4 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 3 4 | Equipment Class | DSS - Part 15 Spread Spectrum Transmitter | ||||
1 2 3 4 | PCE - PCS Licensed Transmitter held to ear | |||||
1 2 3 4 | DTS - Digital Transmission System | |||||
1 2 3 4 | JBP - Part 15 Class B Computing Device Peripheral | |||||
1 2 3 4 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | PCS GSM/EDGE Phone with WLAN and Bluetooth | ||||
1 2 3 4 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 2 3 4 | Modular Equipment Type | Does not apply | ||||
1 2 3 4 | Purpose / Application is for | Original Equipment | ||||
1 2 3 4 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | Yes | ||||
1 2 3 4 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 3 4 | Grant Comments | Output power is conducted. This device is approved for use in the handset described in the filing. | ||||
1 2 3 4 | Power output listed is EIRP. SAR compliance for body-worn operation is based on a separation distance of 1.0 cm between the unit and the body of the user. End-users must be informed of the body-worn operating requirements for satisfying RF exposure compliance. Belt clips or holsters not listed in this filing may not contain metallic components. The highest reported SAR values for head, body-worn accessory, product specific use (wireless router), and simultaneous use conditions are 0.49 W/kg, 0.66 W/kg, 0.66 W/kg and 0.88 W/kg respectively. This device also contains functions that are not operational in U.S. Territories. This filing is only applicable for US operations. | |||||
1 2 3 4 | Output power is conducted. This device is approved for use in the handset described in the filing. SAR compliance for body-worn operation is based on a separation distance of 1.0 cm between the unit and the body of the user. End-users must be informed of the body-worn operating requirements for satisfying RF exposure compliance. Belt clips or holsters not listed in this filing may not contain metallic components. The highest reported SAR values for head, body-worn accessory, product specific use (wireless router), and simultaneous use conditions are <0.10 W/kg, <0.10 W/kg, <0.10 W/kg and 0.88 W/kg respectively. | |||||
1 2 3 4 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 3 4 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 2 3 4 | Firm Name |
SGS Korea Co., Ltd.
|
||||
1 2 3 4 |
PCTEST Engineering Laboratory, Inc.
|
|||||
1 2 3 4 |
Samsung Electronics Co., Ltd. Global CS Center
|
|||||
1 2 3 4 | Name |
F**** L******
|
||||
1 2 3 4 |
R******** O********
|
|||||
1 2 3 4 |
P**** N********
|
|||||
1 2 3 4 | Telephone Number |
82(0)********
|
||||
1 2 3 4 |
410-2********
|
|||||
1 2 3 4 |
82-31********
|
|||||
1 2 3 4 | Fax Number |
82(0)********
|
||||
1 2 3 4 |
410-2********
|
|||||
1 2 3 4 |
82-31********
|
|||||
1 2 3 4 |
f******@sgs.com
|
|||||
1 2 3 4 |
r******@pctestlab.com
|
|||||
1 2 3 4 |
p******@samsung.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 15C | CC | 2402.00000000 | 2480.00000000 | 0.0139000 | |||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 24E | 1850.2 | 1909.8 | 0.889 | 2.5 ppm | 246KGXW | ||||||||||||||||||||||||||||||||||
2 | 2 | 24E | 1850.2 | 1909.8 | 0.406 | 2.5 ppm | 243KG7W | ||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
3 | 1 | 15C | CC | 2412.00000000 | 2462.00000000 | 0.0260000 | |||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
4 | 1 | 15B | 16 CC |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC