all | frequencies |
|
exhibits | applications |
---|---|---|---|---|
manual |
app s | submitted / available | |||||||
---|---|---|---|---|---|---|---|---|
1 2 3 4 |
|
User Manual | Users Manual | 1008.23 KiB | ||||
1 2 3 4 | Cover Letter(s) | / August 05 2012 | ||||||
1 2 3 4 | Cover Letter(s) | / August 05 2012 | ||||||
1 2 3 4 | Attestation Statements | April 05 2012 / August 05 2012 | ||||||
1 2 3 4 | Cover Letter(s) | / August 05 2012 | ||||||
1 2 3 4 | ID Label/Location Info | / August 05 2012 | ||||||
1 2 3 4 | External Photos | |||||||
1 2 3 4 | Internal Photos | |||||||
1 2 3 4 | Internal Photos | |||||||
1 2 3 4 | Test Setup Photos | |||||||
1 2 3 4 | Test Setup Photos | |||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | Test Report | / August 05 2012 | ||||||
1 2 3 4 | Test Setup Photos | |||||||
1 2 3 4 | Test Setup Photos | |||||||
1 2 3 4 | External Photos | |||||||
1 2 3 4 | Internal Photos | |||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | RF Exposure Info | / August 05 2012 | ||||||
1 2 3 4 | Test Report | / August 05 2012 | ||||||
1 2 3 4 | Test Report | / August 05 2012 | ||||||
1 2 3 4 | Cover Letter(s) | / August 05 2012 | ||||||
1 2 3 4 | Test Report | / August 05 2012 | ||||||
1 2 3 4 | Internal Photos | |||||||
1 2 3 4 | Internal Photos |
1 2 3 4 | User Manual | Users Manual | 1008.23 KiB |
Some of the contents in this manual may differ from your device depending on the software of the device or your service provider. To install Kies (PC Sync) 1. Download the latest version of Kies from the Samsung website (www.samsung.com/kies) and install it on your PC. Using a USB cable, connect your device to your PC. Samsung Kies will launch automatically. Refer to the Kies help for more information. 2. www.samsung.com English (EU). 11/2011. Rev. 1.0
GT-P6200 quick start guide View the electronic version of the user manual For more information, refer to the user manual at www.samsung.com. The manual is available as an Adobe Acrobat file (.pdf). If you do not have Adobe Reader, you can download the free program at www.adobe.com. Using this manual Congratulations on your purchase of the Samsung mobile device. This powerful, go anywhere device, puts the best of the web and mobile computing at your fingertips in a lightweight, highly versatile platform that fits your active lifestyle. Built on the Google Android operating system, the Samsung mobile device gives you access to thousands of useful and entertaining applications to enrich your mobile web experience. With integrated wireless access and a responsive touch screen, you can read books and newspapers on the go; stay up-to-date on the latest news, sports, and weather; manage your multimedia and business files; and browse the web for maps, business locations, and more. Read me first Please read all safety precautions and this manual carefully before using your device to ensure safe and proper use. The descriptions in this manual are based on the default settings of your device. Images and screenshots used in this user manual may differ in appearance from the actual product. Content in this user manual may differ from the product, or from software provided by service providers or carriers, and is subject to change without prior notice. Refer to www.samsung.com for the latest version of the user manual. Available features and additional services may vary by device, software, or service provider. Using this manual 2 Formatting and delivery of this user manual is based on Google Android operating systems and may vary depending on the users operating system. Applications and their functions may vary by country, region, or hardware specifications. Samsung is not liable for performance issues caused by third-party applications. Samsung is not liable for performance issues or incompatibilities caused by user editing of registry settings. You may upgrade your mobile devices software by accessing www.samsung.com. Software, sound sources, wallpapers, images, and other contents provided in this device are licenced for limited use between Samsung and their respective owners. Extracting and using these materials for commercial or other purposes is an infringement of copyright laws. Samsung is not liable for such copyright infringement by the user. Please keep this manual for future reference. Instructional icons Before you start, familiarise yourself with the icons you will see in this manual:
Warningsituations that could cause injury to yourself or others Cautionsituations that could cause damage to your device or other equipment Notenotes, usage tips, or additional information Using this manual 3
[
]
Refer topages with related information; for example: p. 12 (represents see page 12) Followed bythe order of options or menus you must select to perform a step; for example: Open the application list and select Settings Wireless and networks (represents Settings, followed by Wireless and networks) Square bracketsdevice keys; for example: [
(represents the Power/Reset/Lock key)
]
Copyright Copyright 2011 Samsung Electronics This user manual is protected under international copyright laws. No part of this user manual may be reproduced, distributed, translated, or transmitted in any form or by any means, electronic or mechanical, including photocopying, recording, or storing in any information storage and retrieval system, without the prior written permission of Samsung Electronics. Trademarks SAMSUNG and the SAMSUNG logo are registered trademarks of Samsung Electronics. The Android logo, Google Search Google Mail, YouTube, Android Market, and Google Talk are trademarks of Google, Inc.
, Google Maps, Using this manual 4 is a registered trademark of the Bluetooth SIG, is a registered trademark of Bluetooth Inc. worldwide. Oracle and Java are registered trademarks of Oracle and/
or its affiliates. Other names may be trademarks of their respective owners. Windows Media Player Microsoft Corporation. Wi-Fi registered trademarks of the Wi-Fi Alliance. DivX associated logos are trademarks of Rovi Corporation or its subsidiaries and are used under licence. All other trademarks and copyrights are the property of their respective owners.
, the Wi-Fi CERTIFIED logo, and the Wi-Fi logo are
, DivX Certified, and Using this manual 5 ABOUT DIVX VIDEO DivX is a digital video format created by DivX, LLC, a subsidiary of Rovi Corporation. This is an official DivX Certified device that plays DivX video. Visit www.divx.com for more information and software tools to convert your files into DivX videos. DivX Certified to play DivX video up to HD 720p, including premium content ABOUT DIVX VIDEO-ON-DEMAND This DivX Certified device must be registered in order to play purchased DivX Video-on-Demand (VOD) movies. To obtain your registration code, locate the DivX VOD section in your device setup menu. Go to vod.divx.com for more information on how to complete your registration. Using this manual 6 Contents Assembling ............................................................. 11 Unpack .................................................................................... 11 Install the SIM or USIM card ............................................... 12 Charge the battery ............................................................... 12 Insert a memory card (optional) ....................................... 14 Getting started ....................................................... 17 Turn your device on and off ............................................... 17 Get to know your device ..................................................... 18 Use the touch screen ........................................................... 23 Get to know the Home screen ........................................... 25 Access applications .............................................................. 29 Customise your device ........................................................ 30 Enter text ................................................................................ 35 Web .......................................................................... 41 Browser ................................................................................... 41 Pulse ........................................................................................ 45 Market ..................................................................................... 46 YouTube .................................................................................. 47 Maps ........................................................................................ 47 Latitude ................................................................................... 49 Places ....................................................................................... 50 Navigation .............................................................................. 50 Samsung Apps ...................................................................... 51 Communication ..................................................... 52 Calling ..................................................................................... 52 Contents 7 Messaging .............................................................................. 58 Google Mail ............................................................................ 60 Email ........................................................................................ 62 Talk ........................................................................................... 64 Social Hub .............................................................................. 65 Entertainment ........................................................ 66 Music player ........................................................................... 66 Camera .................................................................................... 68 Video player ........................................................................... 78 Gallery ..................................................................................... 79 Photo editor ........................................................................... 81 Personal information ............................................ 82 Contacts .................................................................................. 82 Calendar ................................................................................. 85 Memo ...................................................................................... 87 Connectivity ........................................................... 88 PC connections ..................................................................... 88 Wi-Fi ......................................................................................... 90 Wi-Fi Direct ............................................................................. 92 Bluetooth ................................................................................ 93 AllShare ................................................................................... 95 Mobile network sharing ..................................................... 98 GPS ......................................................................................... 100 TV connections ................................................................... 101 VPN connections ................................................................ 102 Tools ....................................................................... 104 Alarm ..................................................................................... 104 Contents 8 Calculator ............................................................................. 105 Downloads ........................................................................... 105 eBook .................................................................................... 105 Google Search ..................................................................... 107 My files .................................................................................. 107 Pen memo ............................................................................ 109 Polaris Office ........................................................................ 110 SIM Toolkit ............................................................................ 112 Task Manager ...................................................................... 112 Voice Search ......................................................................... 112 World clock .......................................................................... 113 Settings .................................................................. 114 Access the Settings menu ................................................ 114 Wireless and networks ...................................................... 114 Call .......................................................................................... 116 Sound .................................................................................... 118 Screen .................................................................................... 119 Power saving mode ........................................................... 120 Location and security ........................................................ 120 Applications ......................................................................... 122 Accounts and sync .............................................................. 123 Motion ................................................................................... 124 Privacy ................................................................................... 124 Storage .................................................................................. 124 Language and input .......................................................... 125 Accessibility ......................................................................... 129 Date and time ...................................................................... 130 About device ....................................................................... 130 Contents 9 Troubleshooting .................................................. 131 Safety precautions ............................................... 136 Index ...................................................................... 147 Contents 10 Assembling Unpack Check your product box for the following items:
Mobile device Quick start guide Use only Samsung-approved software. Pirated or illegal software may cause damage or malfunctions that are not covered by your manufacturer's warranty. The items supplied with your device and available accessories may vary depending on your region or service provider. You can purchase additional accessories from your local Samsung dealer. The supplied accessories perform best for your device. Accessories other than the supplied ones may not be compatible with your device. Assembling 11 Install the SIM or USIM card When you subscribe to a cellular service, you will receive a Subscriber Identity Module (SIM) card, with subscription details, such as your personal identification number (PIN) and optional services. To use UMTS or HSDPA services, you can purchase a Universal Subscriber Identity Module (USIM) card. To install the SIM or USIM card, 1 2 Open the cover of the SIM card slot. Insert the SIM or USIM card with the gold-coloured contacts facing down. 3 Close the cover of the SIM card slot. Charge the battery Your device has a built-in battery. Before using the device for the first time, you must charge the battery. Use only Samsung-approved chargers. Unauthorised chargers can cause batteries to explode or damage your device. Assembling 12 Charge the battery only with a charger. You cannot charge the battery with the USB cable. When your battery is low, the device will emit a warning tone and display a low battery message. The will also be empty. If the battery level battery icon becomes too low, the device will automatically power off. Recharge your battery to continue using your device. If the battery is completely discharged, you cannot turn on the device, even with the USB power adapter connected. Allow a depleted battery to charge for a few minutes before you try to turn on the device. Connect the USB cable to the USB power adapter and then plug the end of the USB cable into the multifunction jack. The shape of the USB power adapter may differ depending on your region. 1 Connecting the USB cable improperly may cause serious damage to the device or USB power adapter. Any damage caused by misuse is not covered by the warranty. Assembling 13 2 3 Plug the USB power adapter into a power outlet. You can use the device while it is charging, but it may take longer to fully charge the battery. While the device is charging, the touch screen may not function due to an unstable power supply. If this happens, unplug the USB power adapter from the power outlet or unplug the USB cable from the device. While charging, the device may heat up. This is normal and should not affect your devices lifespan or performance. If your device is not charging properly, bring your device and the charger to a Samsung Service Centre. When the battery is fully charged, first unplug the USB power adapter and USB cable from the device and then from the power outlet. To save energy, unplug the USB power adapter when not in use. The USB power adapter does not have a power switch, so you must unplug the USB power adapter from the outlet when not in use to avoid wasting power. The USB power adapter should remain close to the socket when in use. Insert a memory card (optional) To store additional files, you must insert a memory card. Your device accepts microSD or microSDHC memory cards with maximum capacities of 32 GB (depending on memory card manufacturer and type). Assembling 14 Samsung uses approved industry standards for memory cards, but some brands may not be fully compatible with your device. Using an incompatible memory card may damage your device or the memory card and can corrupt data stored on the card. Your device supports only the FAT file structure for memory cards. If you insert a card formatted with a different file structure, your device will ask you to reformat the memory card. Frequent writing and erasing of data will shorten the lifespan of memory cards. When you insert a memory card in your device, the file directory of the memory card will appear in the external_sd folder under the internal memory. Open the cover of the memory card slot. Insert a memory card with the gold-coloured contacts facing down. Push the memory card in the memory card slot until it locks in place. Close the memory card cover. Assembling 15 1 2 3 4 Remove the memory card Before removing a memory card, first unmount it for safe removal. 1 2 3 4 Open the application list and select Unmount SD card. Open the memory card cover. Push the memory card gently until it disengages from the device. Remove the memory card. Settings Storage Do not remove a memory card while the device is transferring or accessing information, as this could result in loss of data or damage to the memory card or device. Format the memory card Formatting your memory card on a PC may cause incompatibilities with your device. Format the memory card only on the device. Open the application list and select Settings Storage Erase SD card Format SD card Erase everything. Before formatting the memory card, remember to make backup copies of all important data stored on your device. The manufacturers warranty does not cover loss of data resulting from user actions. Assembling 16 Getting started Turn your device on and off To turn on your device, press and hold [
device for the first time, follow the on-screen instructions to set up your device. To turn off your device, press and hold [
off OK.
] and select Power
]. If you turn on your Follow all posted warnings and directions from authorised personnel in areas where the use of wireless devices is restricted, such as aeroplanes and hospitals. To use your devices non-network services only, switch to Flight mode. Getting started 17 Indicator icons Icons shown on the bottom of the screen may vary depending on your region or service provider. Icon Definition No signal Signal strength GPRS network connected EDGE network connected UMTS network connected Open WLANs available WLAN connected Bluetooth activated Receiving GPS data Synchronised with the web Call in progress Call on hold Speakerphone activated Missed call Uploading data Downloading data Getting started 21 Icon Definition Connected to PC Call diverting activated Power saving mode activated USB tethering activated Wi-Fi tethering activated New text or multimedia message New email message New Google Mail New voice mail message Alarm activated Event notification Roaming (outside of normal service area) Flight mode activated Music playback in progress Error occurred or caution required Battery power level Unable to charge Current time 1 1. If you use a charger that is not approved by Samsung, this indicator will not appear. Getting started 22 Use the touch screen Your devices touch screen lets you easily select items or perform functions. Learn basic actions to use the touch screen. To avoid scratching the touch screen, do not use sharp tools. Do not allow the touch screen to come into contact with other electrical devices. Electrostatic discharges can cause the touch screen to malfunction. Do not allow the touch screen to come into contact with water. The touch screen may malfunction in humid conditions or when exposed to water. For optimal use of the touch screen, remove the screen protection film before using your device. Your touch screen has a layer that detects small electrical charges emitted by the human body. For best performance, tap the touch screen with your fingertip. The touch screen will not react to touches of sharp tools, such as a stylus or pen. Getting started 23 You can control your touch screen with the following actions:
Tap: Touch once with your finger to select or launch a menu, option, or application. Drag: Tap and drag your finger up, down, left, or right to move to items on lists. Tap and hold: Tap an item and hold it for more than 2 seconds to open a pop-up option list. Drag and drop: Tap and hold your finger on an item, and then drag your finger to move the item. Double-tap: Tap twice quickly with your finger to zoom in or out while viewing photos. Rotate the touch screen Your device has a built-in motion sensor that detects its orientation. If you rotate the device, the interface will automatically rotate according to the orientation. To set the interface to keep the orientation, select the right side of the system bar and then select Auto Rotation on the notifications panel. Getting started 24 Lock or unlock the touch screen When you do not use the device for a specified period, your device turns off the touch screen and automatically locks the touch screen to prevent any unwanted device operations. To
]. manually lock the touch screen, press [
To unlock, turn on the screen by pressing [
any direction until it reaches the border of the circle.
], and drag in You can activate the screen lock feature to prevent others from using or accessing your personal data and information saved in your device. p. 32 Get to know the Home screen When the device is in Idle mode, you will see the Home screen. From the Home screen, you can view indicator icons, widgets, shortcuts to applications, and other items. Scroll left or right to a panel of the Home screen. 1 2 3 4 5 The above screen may differ depending on your region or service provider. Getting started 25 Number 1 2 3 4 5 Function Search for applications and files in your device and specific data on the web with the Google Search widget. Select a dot at the top of the screen to move directly to the corresponding screen. Access the application list. Customise the Home screen. System bar (See the following section). System bar From the system bar, you can quickly navigate screens, access applications, view system information, and more. 1 2 3 4 5 6 Number 1 2 3 4 5 Function Capture the current screen; Capture the current screen and open the drawing pad (tap and hold). Return to the previous screen. Return to the Home screen; Access the task manager (tap and hold). Open the list of recent applications; Access the application list (tap and hold). Display indicator icons and your device's current status; Open the notifications panel. Getting started 26
. 6 Number Function Open the mini apps panel. Add items to the Home screen You can customise the Home screen by adding shortcuts to applications or items in applications, widgets, or folders. To add an item to the Home screen, 1 2 From the Home screen, select Select an item category.
: Add widgets. Widgets are small applications Widgets that provide convenient functions and information. App Shortcuts Wallpaper More contacts, and maps.
: Add shortcuts to items, such as bookmarks,
: Add shortcuts to applications.
: Set a background image. Select an item to add to the Home screen. 3 Move items on the Home screen 1 Tap and hold an item to move until the Home screen grid appears. 2 Drag the item to the location you want. Getting started 27 Remove items from the Home screen 1 Tap and hold an item to remove. The trash bin appears at the top right of the Home screen. 2 Drag the item to the trash bin. 3 When the item turns red, release the item. Add a shortcut to an application 1 From the application list, tap and hold an application icon and drag it to a Home screen panel at the bottom of the screen. The shortcut icon for the application is added to the Home screen. Move the icon to the location you want or move it to another panel of the Home screen. 2 Use the notifications panel From the Home screen or while using an application, select the right side of the system bar, and then select an option on the notifications panel. You can view the devices current status and use the following options:
Wi-Fi Notifications GPS Sound Auto Rotation Bluetooth connection feature.
/Vibration: Activate or deactivate Vibration mode.
: Activate or deactivate the auto rotation.
: Activate or deactivate the Bluetooth wireless
: Set the device to alert you for various events.
: Activate or deactivate the WLAN feature.
: Activate or deactivate the GPS feature. Getting started 28 Flight mode
: Activate or deactivate Flight mode. You can also adjust the display brightness or access the settings menu. Available options may vary depending on your region or service provider. Access applications 1 2 3 From the Home screen, select application list. Select To view downloaded applications, select Downloaded. to Select return to the Home screen. to return to the previous screen; Select All an application. Apps to access the to view the applications you have accessed Access recent applications 1 Select recently. 2 Select an application. Use the task manager Your device is a multitasking device. It can run more than one application at the same time. However, multitasking may cause hang-ups, freezing, memory problems, or additional power consumption. To avoid these problems, end unnecessary programs using the task manager. 1 2 Tap and hold To close an application, select To close all active applications, select End all. End. Getting started 29 Customise your device Get more from your device by customising it to match your preferences. Change the language of the display 1 Open the application list and select Language and input Select language. 2 Select a language you want. Set the current time and date 1 Open the application list and select time. 2 Select your time zone, set the time and date, and change other options. Settings Settings Date and Turn the touch tone on or off Open the application list and select Settings Sound Audible selection. Adjust the devices volume 1 Press the Volume key up or down. 2 Select and drag the sliders to adjust the volume level for call ringtones, media sounds, notifications and alarm sounds. Switch to Silent mode To mute or unmute your device, do one of the following:
Open the application list and select tap and hold Open the notifications panel at the right side of the system bar and select Sound. Phone Dialer and
. Getting started 30 Press and hold the Power key and select Silent mode. You can set the device to alert you to various events in Silent mode. Open the application list and select Settings Sound Vibrate Always or Only in Silent mode. When you switch to Silent mode, Vibration will appear in place of Silent on the notifications panel. Select a wallpaper for the Home screen 1 Wallpaper. From the Home screen, select 2 Select an image folder. If you selected Gallery or Wallpaper, select Home screen wallpaper. Select an image. If you selected a live wallpaper, select If you selected an image from Gallery, move or resize the rectangle to select a portion of the image, and then select OK. Set wallpaper. 3 4 Samsung is not responsible for any use of default images or wallpapers provided on your device. Activate animation for switching windows You can set a transition effect between windows while using the device. 1 2 Open the application list and select Animation. Select an animation option. Settings Screen Getting started 31 Adjust the brightness of the display 1 Open the application list and select Brightness. 2 Clear the check box next to 3 Drag the slider to adjust the level of brightness. 4 Select OK. Automatic brightness. Settings Screen The brightness level of the display will affect how quickly the device consumes battery power. Set a screen lock You can lock the touch screen with an unlock pattern or password to prevent unauthorised people from using the device without your permission. Once you set a screen lock, your device will require an unlock code each time you turn it on or unlock the touch screen. If you forget your PIN or password, bring your device to a Samsung Service Centre to reset it. Samsung is not responsible for any loss of security codes or private information or other damages caused by illegal software. Set an unlock pattern 1 2 Open the application list and select and security Configure lock screen Pattern. See the on-screen instructions and example patterns and select Next. Settings Location Getting started 32 OK. Confirm. Settings Location Draw a pattern by dragging your finger to connect at least 4 dots and select Continue. Draw the pattern again to confirm and select Open the application list and select and security Configure lock screen PIN. Continue. Enter a new PIN (numeric) and select Enter the PIN again and select 3 4 Set an unlock PIN code 1 2 3 Set an unlock password 1 2 3 Lock your SIM or USIM card You can lock your device by activating the PIN supplied with your SIM or USIM card. 1 2 Open the application list and select and security Configure lock screen Password. Enter a new password (alphanumeric) and select Continue. Enter the password again and select Settings Location Open the application list and select and security Set up SIM card lock Lock SIM card. Enter your PIN and select Settings Location OK. OK. Getting started 33 Once the PIN lock is enabled, you must enter the PIN each time you turn on the device. If you enter an incorrect PIN too many times, your SIM or USIM card will be blocked. You must enter a PIN unlock key (PUK) to unblock the SIM or USIM card. If you block your SIM or USIM card by entering an incorrect PUK, bring the card to your service provider to unblock it. Activate the Find my mobile feature When someone inserts a new SIM or USIM card in your device, the Find my mobile feature will automatically send the contact number to specified recipients to help you locate and recover your device. To use this feature, you need a Samsung account for controlling the device from the web remotely. 1 2 3 4 5 Open the application list and select and security SIM change alert. Read the terms and conditions, select the check box next to I accept all the terms above and select Accept. Select To create a Samsung account, select Sign up. Enter your email address and password for your Samsung account and select Sign in. Select Settings Location SIM change alert. Sign in. Getting started 34 6 7 8 9 10 11 Alert message recipients. Enter the password for your Samsung account and select OK. Select Enter the password for your Samsung account again and select OK. Enter a phone number including a country code (with Enter the text message to be sent to the recipients. Select Done.
+). Enter text You can enter text by selecting characters on the virtual keypad, inputting handwriting on the screen, or speaking words into the microphone. You cannot enter text in some languages. To enter text, you should change the writing language to one of the supported languages. p. 125 Change the keyboard type You can change the keyboard type. Select on the system bar and select a keyboard type (Android keyboard, Samsung keypad or Swype keyboard). You can also enter text with your voice. Select input option, according to the language you want to use. and a voice Getting started 35 Enter text using the Android keyboard Enter text by selecting alphanumeric keys and you can use the following keys:
1 2 3 4 5 6 7 8 Number 1 2 3 4 5 6 7 8 Function Change case. Switch between Number/Symbol mode and ABC mode. Move the cursor to the next text input field. Clear your input. Start a new line or field. Insert an emoticon; Open the emoticon list
(tap and hold). Enter text by voice. This feature may be unavailable depending on the selected input language. Insert a space. Getting started 36 Enter text using the Samsung keypad Enter text by selecting alphanumeric keys and you can use the following keys:
1 2 3 4 5 6 7 8 3 9 10 11 12 Number 1 2 3 4 5 6 7 8 9 Function Minimise the virtual keypad. Move the cursor to the next text input field. Change case. Switch between Number/Symbol mode and ABC mode. Access the keypad settings; Change the keypad type or activate the voice input feature
(tap and hold). Insert a space. Clear your input. Start a new line. Attach an item. Getting started 37 Number Function Enter text by voice. 10 11 12 This feature may be unavailable depending on the selected input language. Switch to the handwriting keypad. Insert an emoticon; Open the emoticon list
(tap and hold). You can activate XT9 predictive text mode by selecting XT9. When you enter the first three letters of a word, the alternate word list appears. You can use a variety of gestures in Handwriting mode to edit text. For more information about gestures, select Handwriting settings Gesture guide. Enter text using the Swype keypad 1 Select the first character of a word and drag your finger to the second character without releasing the finger from the screen. Continue until you have finished the word. 2 3 Release the finger on the last character. Getting started 38 4 5 When the word displays correctly, select to insert a space. If the correct word does not display, select an alternative word from the list that appears. Repeat steps 1-4 to complete your text. You can also tap the keys to enter text. You can tap and hold a key to enter characters on the upper half of the key. When you tap and hold a key until the character list appears, you can enter special characters and symbols. You can also use the following keys:
1 2 3 4 5 6 7 8 3 9 10 11 Number 1 2 3 4 5 6 Function Change the input language. Move the cursor to the next text input field. Change case. Access the swype tip screen; Open the help information (tap and hold). Switch between Symbol mode and ABC mode. Switch between Number mode and Edit mode. Getting started 39 Number 7 8 9 10 11 Function Clear your input. Start a new line. Minimise the virtual keypad. Enter text by voice. This feature may be unavailable depending on the selected input language. Insert a space. Copy and paste text While you are entering text, you can use the copy and paste feature to use text in other applications. 1 2 3 4 5 Tap and hold a word. Drag Select In another application, tap and hold the text input field. Paste to insert the text from the clipboard into the Select text input field. to cut the text onto the clipboard. to select the text you want. to copy, or or Getting started 40 Web Browser Learn to access and bookmark your favourite web pages. You may incur additional charges for accessing the web and downloading media files. For details, contact your service provider. The web browser menu may be labelled differently depending on your region or service provider. Available icons may vary depending on your region or service provider. Browse web pages 1 Browser to launch Open the application list and select your homepage. To access a specific web page, select the URL input field, enter the web address of the web page, and select Navigate web pages with the following keys:
5 6 7 8
. 2 1 2 3 4 The above screen may differ depending on your region or service provider. Web 41 Number 1 2 3 4 5 6 7 8 Function Close the current tab. Move backward or forward to web pages in history. Reload the current web page; While the device is loading web pages, this icon changes to Open a new tab. Search for information. Access a list of web browser options. Open a list of saved bookmarks and recent internet history. Bookmark the current web page. While browsing the web page, use the following options:
To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also double-tap the screen. To open a new tab, select To open a new tab without saving cookies, select New incognito tab. To search for text on the web page, select page. To send the web address of the web page to others, select New tab. Find on Share page. Web 42 To save the current web page and read it offline later, select Save page. Page info. To view page details, select To view the items downloaded from the web, select Downloads. To print the web page using a WLAN or USB connection, select some Samsung printers. To customise browser settings, select Search for information by voice Print. Your device is compatible only with Settings. 1 2 3 This feature may be unavailable depending on your region or service provider. Browser. and say a keyword into your devices Open the application list and select Select Select microphone. The device searches for information and web pages related with the keyword. Open multiple pages You can open multiple pages and switch back and forth between them. 1 2 3 4 Open the application list and select Select Access another web page on the new tab. To switch back and forth between currently open tabs, select the title of a tab. to open a new tab. Browser. Web 43
. to bookmark the current web page. Browser. Bookmark your favourite web pages If you know the web address of the web page, you can manually add a bookmark. Add a bookmark 1 2 3 4 5 To use bookmark options, select Open the application list and select Select You can also select Enter a page title and a web address. Select the bookmark location to add (if necessary). Select OK. Bookmarks drop-down menu and select a Open. Open in new Edit bookmark. To open the web page in the current tab, select To open the web page in a new tab, select tab. To edit the bookmark, select To add the bookmark shortcut to the Home screen, select Add shortcut to home. To send the web address of the web page to others, select Share link. To copy the web address of the web page, select URL. To delete the bookmark, select To use the web page as your homepage of the browser, select Set as homepage. Delete bookmark.
, tap and hold a bookmark:
Copy link Web 44 Browser. New folder. Open the application list and select Select Enter a name for the bookmark folder and select Create a bookmark folder 1 2 3 Access recent history 1 Open the application list and select 2 Select 3 Select a web page to access. History. Browser. Done. Pulse You can use the Pulse reader to add feeds for your favourite news topics and read news articles on your device. Read feeds 1 Open the application list and select 2 If you are launching this application for the first time, select OK and tap the screen to clear the hint. 3 Select To read the feeds you added to your favourite list, select to update feeds. Pulse. 4 5 6 Scroll up or down to select a feed source. Scroll left or right and select a feed. While reading a feed, use the following options:
. To add a feed to your favourite list, select To upload a feed to community websites, select To send a feed to others, select To return to a feed list, select
. or
. Web 45 Manage feed sources 1 Open the application list and select 2 to view the feed source list. Select 3 or Select to add or delete a feed source. Pulse. Market Based on the Android platform, your devices functionality can be extended by installing additional applications. Android Market provides you an easy and quick way to shop for games and mobile applications. This feature may be unavailable depending on your region or service provider. Download and install an application 1 Market. Open the application list and select You can also select Shop at the top right of the application list. If you are launching this application for the first time, select Accept. Search for a file or application and download it. 2 3 Uninstall an application 1 Open the application list and select 2 Select 3 Select the item you want to delete. 4 Select Uninstall. My apps. Market. Web 46 YouTube Learn to view and upload videos via YouTube. This feature may be unavailable depending on your region or service provider. Open the application list and select Select a video from the list. Tap a video screen and select Control playback with the virtual keys. YouTube. to display a full screen. Watch videos 1 2 3 4 Upload videos 1 2 3 YouTube. Your Channel. Open the application list and select Select Select your Google account if it is linked to YouTube. You can also select Add account and set up an account to sign in YouTube. Select Enter details for the upload and select Upload and then select a video. Upload. 4 5 Maps Learn to use Google Maps to find your location, search the map for streets, cities, or countries, and get directions. This feature may be unavailable depending on your region or service provider. Web 47 Maps. Search for a specific location 1 Open the application list and select 2 If you are launching this application for the first time, select OK. The map will display your current location. Select Enter a keyword for the location and select To search for a location by voice, select Select the location you want to view details. Search Maps. 3 4 5
. To view your current location, select To switch to a compass view of the map that changes orientation when you move the device, select To search for a place around you, select To get directions to a specific destination, select To add layers to the map, select To access a list of other options, select To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. To add a star to the location, select the balloon of the location name
. Get directions to a specific destination 1 Open the application list and select 2 Select 3 Enter the addresses of the starting location and the ending location. To enter an address from your contact list or starred places, or point the location on the map, select Contacts or Point on map or My places. Maps. Web 48 4 5 Go. Select a travel method (car, bus, or walk) and select The route is indicated on the map. Depending on the selected travel method, you may see multiple routes. Select a route to view details of your trip and select view the route on the map. When you are finished, select Clear Map. to Latitude Learn to share your location with your friends and view friends locations via Google Latitude. This feature may be unavailable depending on your region or service provider. 1 2 3 4 5 Latitude. Select from Contacts or Add via email Open the application list and select The device automatically joins Latitude. Select address. Select a friend you want to add, or enter an email address and select Add friends. Select When your friend accepts your invitation, you can share locations. Select a friend from the list. Your friends locations are marked with their photos on the map. Yes. Web 49 Places Learn to search for a place around you. 1 2 3 4 This feature may be unavailable depending on your region or service provider. Places. Open the application list and select Select a category. Your device searches for places around your current location that are related to the category. Select a place name to view its details. While viewing information, use the following options:
To view the place on the map, select To view the route to the place, select To view the phone number of the place, select Map. Directions. Call. Navigation Learn to use the GPS navigation system to find and show your destination with voice guidance. Navigation maps, your current location, and other navigational data may differ from actual location information. You should always pay attention to road conditions, traffic, and any other factors that may affect your driving and follow all safety warnings and regulations while driving. This feature may be unavailable depending on your region or service provider. Open the application list and select If you are launching this application for the first time, select Accept. Navigation. 1 2 Web 50 3 4 Enter your destination by using one of the following methods:
: Speak your destination such as Speak Destination Navigate to destination. Type Destination virtual keypad. Contacts your contacts. Starred Places your starred places.
: Enter your destination with the
: Select your destination from addresses of
: Select your destination from the list of Follow the on-screen instructions to use the navigation service. Samsung Apps Samsung Apps allows you to simply and easily download an abundance of applications directly to your device. Featuring a wealth of games, news, reference, social networking, navigation, health related applications and more, Samsung Apps gives you instant access to a huge choice of mobile experience. Your device gets smarter with fully optimised applications from Samsung Apps. Explore amazing applications and make your mobile life even better. This feature may be unavailable depending on your region or service provider. For details, please visit www.samsungapps.com. Samsung Apps. Open the application list and select If you are launching this application for the first time, read the terms and conditions and select Accept. Search for and download applications as desired. 1 2 3 Web 51 Communication Calling Learn to use calling functions, such as making and answering calls, using options available during a call or customising and using call-related features. Make or answer a call You can use the buttons or the touch screen when you make, accept, end or reject calls. Make a call 1 2 3 Open the application list and select enter an area code and a phone number. Select For a video call, select Video call. To end the call, select Call to make a voice call. End. Phone Dialer, and Use the phonebook to save numbers you dial frequently. p. 82 To quickly access the call log to redial the numbers you dialled recently, select Phone Logs. Communication 52 Answer a call 1 When a call comes in, drag reaches the border of the circle. in any direction until it When the device is ringing, press the Volume key to mute the ringtone. End call. To end the call, select 2 Reject a call When a call comes in, drag the border of the circle. To send a message when you reject incoming calls, select Reject call with message. in any direction until it reaches First set a text message to be sent to callers. Open the application list and select Settings Call Set reject messages. Call an international number 1 2 Open the application list and select tap and hold 0 to insert the + character. Enter the complete number you want to dial (country code, area code and phone number), and then select Call to dial the number. Phone Dialer, and Use a headset By plugging a headset into the device, you can answer and control calls hands-free:
To answer a call, press the headset button. To reject a call, press and hold the headset button. To place a call on hold or retrieve a held call during a call, press and hold the headset button. To end a call, press the headset button. Communication 53 Use options during a voice call You can use the following options while a voice call is in progress:
. To retrieve a held call, Add call and then dial a new To adjust the voice volume, press the Volume key up or down. To place a call on hold, select select To dial a second call, select number. in any direction until it To answer a second call, drag reaches the border of the circle when a call waiting tone sounds. The device asks whether to end or hold the first call. You must subscribe to the call waiting service to use this feature. To open the dialling screen, select To activate the speakerphone feature, select Speaker. Dialer. In noisy environments, you may have difficulty hearing some calls while using the speakerphone feature. For better audio performance, use the normal phone mode. To turn off the microphone so that the other party cannot hear you, select Mute. To listen and talk to the other party via a Bluetooth headset, select Headset. To open the phonebook, press To switch between the two calls, select To make a multiparty call (conference call), make or answer a second call and select Merge when connected to the second party. Repeat to add more parties. You must subscribe to the multiparty call service to use this feature. Contacts. Swap. Communication 54 Speaker. Use options during a video call You can use the following options while a video call is in progress:
To switch between the front and rear camera lens, select Switch camera. Keypad. To open the dialling screen, select To activate the speakerphone feature, select To turn off the microphone so that the other party cannot hear you, select Mute. To listen and talk to the other party via a Bluetooth headset, select Headset. To hide your image from the other party, select me. To select an alternative image or video to be shown to the other party, select To use the other partys image, tap and hold the other partys image. You can capture an image of the screen or record the video call by selecting Capture or Record. View and dial missed calls Your device will display calls you have missed on the display. To dial the number of a missed call, open the notifications panel and select the missed call. Use additional features You can use various other call-related features, such as auto rejection, Fixed Dialling Number (FDN) mode or call diverting. Images or Videos. Hide Communication 55 Settings Call Enable auto reject to activate auto rejection. Auto reject list. Add. Set auto rejection Use auto rejection to reject calls from certain numbers automatically. To activate auto rejection and create auto reject lists, 1 Open the application list and select Call rejection. 2 Select 3 Select 4 Press 5 Save. Enter a number to reject and select 6 To add more numbers, repeat steps 4-5. Use Fixed Dialling Number (FDN) mode In FDN mode, your device will restrict outgoing calls, except for the numbers stored in the FDN list. To activate FDN mode, 1 2 3 Open the application list and select Fixed Dialing Numbers Enable FDN. Enter the PIN2 supplied with your SIM or USIM card and select OK. Select FDN list and add contacts to be used in FDN mode. Settings Call Communication 56 Set call forwarding Call diverting is a network feature to send incoming calls to another number that you specify. You can set this feature separately for several conditions when you are not able to answer calls, such as when you are already on the phone or when you are outside of the service area. 1 Open the application list and select Call forwarding a call type. 2 Select a condition. 3 Enter a number to which calls will be forwarded and select Enable. Your setting will be sent to the network. Settings Call Set call waiting Call waiting is a network feature to alert you of an incoming call while you are on a previous call. This feature is available only for voice calls. Open the application list and select Settings Call Additional settings Call waiting. Your setting will be sent to the network. Communication 57 View call logs You can view logs of your calls and messages filtered by their types. 1 2 3 Open the application list and select Press Select a log to view its details. Phone Logs. View by an option to sort the logs. From the detail view, you can dial the number, send a message to the number or add the number to the phonebook or reject list. Messaging Learn to create and send text (SMS) or multimedia (MMS) messages, and view or manage messages you have sent or received. You may incur additional charges for sending or receiving messages while outside your home service area. For details, contact your service provider. Send a text message 1 Open the application list and select Messaging. 2 3 Select Add recipients of your message. 4 5 Enter phone numbers manually, separating them with a semicolon or a comma. Select phone numbers from the lists by selecting
. Select Select Enter message here and enter your message text. Send to send the message. Communication 58 Send a multimedia message 1 Open the application list and select Messaging. 2 3 Select Add recipients of your message. Enter phone numbers or email addresses manually, separating them with a semicolon or a comma. Select phone numbers or email addresses from the lists by selecting When you enter an email address, the device will convert the message as a multimedia message. 4 5 6 and add an item. Add subject and enter a subject for the Enter message here and enter your message text. Press message. Select Select You can select a file from the file list or create a new photo or video. Select Send to send the message. 7 View a text or multimedia message 1 Open the application list and select Messaging. Your messages are grouped into message threads by contact, like a messenger. Select a contact. For a multimedia message, select to view the details. 2 3 Communication 59 Listen to voice mail messages If you have set missed calls to be diverted to the voice mail server, callers can leave voice messages when you do not answer incoming calls. To access your voice mail inbox and listen to your messages, 1 2 Open the application list and select then tap and hold 1. Follow the instructions from the voice mail server. Phone Dialer, and You must save the voice mail server number before accessing the server. Contact your service provider for the number. Google Mail You can retrieve new email messages from Google Mail to your Inbox. When you access this application, the Inbox screen appears. The total number of unread messages displays in the title bar and unread messages display in bold. This feature may be unavailable depending on your region or service provider. This Google Mail menu may be labelled differently depending on your region or service provider. Send an email message 1 Open the application list and select 2 Select 3 Enter a name or address in the recipient field. 4 Enter a subject and message. 5 Select 6 Select a file to attach an image file. Send to send the message. Google Mail. Communication 60 Mark unread. Older or
. Google Mail. View an email message 1 Open the application list and select 2 Select an email message. From the message view, use the following options:
To move to the previous or next message, select Newer. To search for an email message, select To create a new message, select To archive the message, select To delete the message, select To make the message as unread, select To mark the message as important, select important. To mark the message as not important, select as not important. To add a label to a message, select To register the message to the spam list, select Report spam. To hide the message, select message to the inbox folder, select All Mail and drag the message to Inbox. To reload the messages, select To customise the email settings, select To reply to the message, select To reply to the message including all recipients, select To forward the message to other people, select To add a star to the message, select To view an attachment, select device, select Save. Mute. To move the View. To save it to your Change labels. Settings. Mark as Refresh. Mark
. Available options may vary depending on the account. Communication 61 Email Learn to send or view email messages via your personal or company email account. Set up an email account 1 Open the application list and select 2 Enter your email address and password. 3 Select
(for other company email accounts). 4 Follow the on-screen instructions. 5 To add more email accounts, select account and repeat steps 2-4. Next (for general email accounts) or Manual setup Settings Add Email. When you are finished setting up the email account, the email messages are downloaded to your device. If you have created more than two accounts, you can switch between email accounts; Select an account name at the top left of the screen and select the one you want to retrieve messages from. Send an email message 1 Open the application list and select account. 2 Select 3 Add recipients of your message. Enter email addresses manually, separating them with a semicolon or Enter key. Select email addresses from the lists by selecting Email an email
.
+ Cc/Bcc and add more recipients. Select You can also add yourself to the recipient list by selecting
+Me. Communication 62 4 5 6 7 8 Select the subject field and enter a subject. Select the text input field and enter your email text. Select Select Send to send the message. files to attach. If you are offline or outside your service area, the message will be held in the outbox until you are online and in your service area. Email an email to update the message list. Open the application list and select account. Select Select an email message. View an email message When you open an email account, you can view previously retrieved emails offline or connect to the email server to view new messages. After retrieving email messages, you can view them offline. 1 2 3 From the message view, use the following options:
To move to the previous or next message, select To search for an email message, select To reload the messages, select To create a new message, select To reply to the message, select To forward the message to other people, select To delete the message, select To remove Information Rights Management (IRM) protection and allow sending, forwarding, or printing the message, select To make the message as unread, select unread. Remove IRM protection. Mark as or
. Communication 63 Move. List by. View mode. To move the message to another folder, select To view the messages by category, select To change the view mode, select To change the background colour, select Background colour. To print the message using a WLAN or USB connection, Print. Your device is compatible only with select some Samsung printers. To customise the email settngs, select To add a star to the message, select To save an attachment to your device, select the attachment tab Settings. Available options may differ in landscape view and portrait view. Talk Learn to chat with friends and family via Google Talk. This feature may be unavailable depending on your region or service provider. Talk. Set your status 1 Open the application list and select 2 Enter your Google account and password and select in (if necessary). 3 Customise your status, image, and message to display. Add friends to your friend list 1 Open the application list and select The friend list shows all of your Google Talk contacts at a glance. Talk. Sign Communication 64 2 3
. Select Enter an email address of the friend and select invitation. Send When your friend accepts the invitation, the friend is added to your friend list. Start a chat 1 Open the application list and select 2 Select a friend from the friend list. The chat screen opens. 3 Enter your message and select To add a friend to a chat, select 4 To end the chat, select
. Add to chat. Talk. Social Hub Learn to access Social Hub, the integrated communication application for Social Network Service (SNS), email, messages, contacts or calendar information. Visit socialhub.samsungapps.com for more details. 1 2 3 4 Open the application list and select If you are launching this application for the first time, add an account or skip it for a later setup. Select a category at the top left of the screen. Check and use contents delivered from Social Hub. Social Hub. Communication 65 Entertainment Music player Learn to listen to your favourite music while on the go with the music player. The music player supports the following file formats: mp3, aac, ogg, wma, amr, m4a, mp4, flac, wav, mid, mxmf, xmf, rtttl, rtx, ota, imy (Codec: MP3, AAC, AAC+, eAAC+, FLAC, WMA, Vorbis, Midi, AMR NB/WB, AC3(only with Video), WAV). You can also play music files in the following formats if you open them from My files or the web browser:
mid, xmf, rtttl, imy, rtx, ota, amr, wav, mxmf. Some file formats are not supported depending on the software of the device. If the file size exceeds the available memory, an error can occur when you open files. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. Add music files to your device Start by transferring files to your device or memory card:
p. 41 Download from the wireless web. Download from a PC with Samsung Kies. Receive via Bluetooth. Copy to your memory card. Synchronise with Windows Media Player 11. p. 95 p. 88 p. 89 p. 89 Entertainment 66 Music player. a music file. Play music After transferring music files to your device or memory card, 1 2 3 4 While playing music, use the following options:
Open the application list and select Select a music category Tap the music player. Control playback with the virtual keys. Add to playlist. To add a music file to a playlist, select Via To listen to music via a Bluetooth headset, select Bluetooth. You cannot use this option when you connect a headset to your device. To send a music file to others, select To set a music file as various tones, select option. To customise your music player, select Share via. Settings. Set as an You can control the music player with a headset. In Idle mode, press and hold the headset button to launch the music player. Press the headset button to start or pause playback. You can experience virtual 5.1 surround sound when listening to multichannel content, such as DVD movies. Entertainment 67 Create a playlist 1 Open the application list and select 2 Select 3 Enter a title for your new playlist and select 4 To add music files to the playlist, select music files you want to add and select Done. New playlist. Music player. OK. next to the Music player. Settings. Customise music player settings 1 Open the application list and select 2 Select 3 Adjust the following settings to customise your music player:
Option Equaliser Sound effects Function Select a default equaliser type. Select a sound effect. Set the music player to turn off automatically after a specific period of time. Music auto off Camera Learn how to capture and view photos and videos. You can take photos at resolutions up to 2048 x 1536 pixels
(3.2 megapixels) and videos at resolutions up to 1280 x 720 pixels. The camera automatically turns off when you do not use it for a specified period. The memory capacity may differ depending on the shooting scene or shooting conditions. Entertainment 68 Capture a photo 1 Open the application list and select camera. 2 Aim the lens at the subject and make any necessary adjustments. Camera to turn on the 1 2 Number 1 2 3 4 5 6 Function Use camera shortcuts.
: Change the flash settings.
: Switch between the front and rear camera lense.
: Change the shooting mode.
: Select the length of the delay before the camera takes a photo.
: Adjust the exposure value. You can add or remove shortcuts to frequently used options. p. 77 Change the camera settings. Entertainment 69 Number 3 4 5 6 Function View the default storage location. Switch to the camcorder. Capture a photo. Open the image viewer to view photos or videos you captured or recorded. 3 4 Tap where you want to focus on the preview screen. The focus frame moves to the place you tap and changes to green when the subject is in focus. Select The photo is saved automatically. to take a photo. After taking photos, select the image viewer icon to view the captured photos. To view more photos, scroll left or right. You can also tap the screen and scroll through the thumbnails of photos at the bottom of the screen. To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also double-tap the screen. To send a photo to others, select To set a photo as wallpaper or an image for a contact, select Set as. To delete a photo, select To access Gallery, select Delete. Go to gallery. Share via. Entertainment 70 Camera to turn on the Capture a photo by using preset options for various scenes to take a photo. Scene mode a scene. Open the application list and select camera. Select Make any necessary adjustments. Select Your camera provides you with predefined settings for various scenes. You can simply select the proper mode for your shooting condition and subjects. For example, when you take photos at night, select the night mode that uses an extended exposure. 1 2 3 4 Capture a photo in Self shot mode You can take photos of yourself conveniently using the front camera lens. 1 2 3 4 Capture a photo in Smile shot mode Your camera can recognise peoples faces and help you take photos of their smiling faces. 1 2 3 Open the application list and select camera. Select Make any necessary adjustments. Select Open the application list and select camera. Select Make any necessary adjustments. Shooting mode Smile shot. Self portrait. to take a photo. Camera to turn on the Camera to turn on the Entertainment 71 4 Aim the camera lens at your subject and select Your device recognises people in an image and detects their smiles. When the subject smiles, the device automatically takes a photo. Camera to turn on the to take the first photo. Shooting mode Panorama. Capture a panoramic photo You can take wide panoramic photos using Panorama shooting mode. This mode is convenient for photographing landscapes. 1 2 3 4 5 Open the application list and select camera. Select Make any necessary adjustments. Select Slowly move the device in any direction and align the green frame with the viewfinder. When you have aligned the green frame and viewfinder, the camera will automatically take the next photo. Repeat step 5 to complete the panoramic photo. 6 Capture a photo of action You can capture shots of a moving subject and then combine them into a single photo that shows the action. 1 2 3 4 Open the application list and select camera. Select Make any necessary adjustments. Select Shooting mode Action shot. to take the first photo. Camera to turn on the Entertainment 72 5 6 Move the device to follow the moving subject. The device automatically takes the next photos. Continue to follow the subject until the device has captured all the shots necessary for the action photo. Customise camera settings Before taking a photo, select options:
Option Edit shortcuts to access the following Function Edit shortcuts to frequently used options. Switch between the front and rear camera lenses. Change the flash setting; You can manually turn the flash on or off, or set the camera to automatically use the flash when needed. Self portrait Flash Change the shooting mode. Shooting mode Scene mode Exposure value Adjust the exposure value. Change the scene mode. Focus mode Timer Effects Take close-up photos or set the camera to focus on the subject. Select the length of the delay before the camera takes a photo. Apply a special effect, such as sepia or black and white tones. Entertainment 73 Function Change the resolution option. Option Resolution White balance Adjust the colour balance according to Metering Outdoor visibility lighting conditions. Select a type of exposure metre. Activate Outdoor visibility to select an appropriate lighting condition. Display the guidelines on the preview screen. Set the camera to include location information for your photos. Guidelines GPS tag Storage To improve GPS signals, avoid shooting in locations where the signal may be obstructed, such as between buildings or in low-
lying areas, or in poor weather conditions. Your location may appear on your photos when you upload them to the web. To avoid this, deactivate the GPS tag setting. Select a memory location for storing captured photos. Reset menus and shooting options. Reset Record a video 1 Open the application list and select Camera to turn on the 2 camera. Drag the slider to switch to the camcorder. Entertainment 74 3 Aim the lens at the subject and make any necessary adjustments. 1 2 Number 1 2 3 3 8 8 4 5 6 Function Use camera shortcuts.
: Change the flash setting.
: Switch to the front camera lens and record a video of yourself.
: Change the recording mode (for attaching to a message or for saving normally).
: Select the length of the delay before the camera recording a video.
: Adjust the exposure value. You can add or remove shortcuts to frequently used options. p. 77 Change the camcorder settings. Check the camcorder status.
: Length of video that can be recorded (according to available memory)
: Default storage location Entertainment 75 Number 4 5 6 Function Switch to the camera. Record a video. Open the image viewer to view photos or videos you captured or recorded. 4 5 6 Tap where you want to focus on the preview screen. The focus frame moves to the place you tap and changes to green when the subject is in focus. Select Select The video is saved automatically. to start recording. to stop recording. Share via. After recording videos, select the image viewer icon to view the recorded videos. To view more videos, scroll left or right. You can also tap the screen and scroll through the thumbnails of videos at the bottom of the screen. To play a video, select To send a video to others, select Delete. To delete a video, select Go to gallery. To access Gallery, select Customise camcorder settings Before recording a video, select options:
Option Edit shortcuts Function Edit shortcuts to frequently used options. Switch between the front and rear camera lenses. to access the following Self recording Entertainment 76 Option Flash Function Change the flash setting; You can manually turn the flash on or off. Recording mode Exposure value Adjust the exposure value. Change the recording mode. Timer Effects Select the length of the delay before the camera starts recording a video. Apply a special effect, such as sepia or black and white tones. Change the resolution option. Resolution White balance Adjust the colour balance according to lighting conditions. Activate Outdoor visibility to select an Outdoor visibility appropriate lighting condition. Display the guidelines on the preview screen. Select a memory location for storing recorded videos. Reset menus and recording options. Guidelines Storage Reset Edit the shortcut icons You can add or remove shortcuts to frequently-used options. 1 2 From the preview screen, select Tap and hold an icon from the option list and drag it to the shortcut area. To remove shortcuts, tap and hold an icon and drag it to the option list. Tap the screen to return to the preview screen. Edit shortcuts. 3 Entertainment 77 Video player Learn to use the video player to play various kinds of videos. The video player supports the following file formats: MP4, 3GP, AVI, WMV, ASF, MKV, FLV, WEBM. Avoid locking the devices screen while playing a DivX Video-On-Demand. Each time you lock the screen while playing a DivX Video-On-Demand, one of your available rental counts will be decremented. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. Video player. Open the application list and select Select a view mode at the top of the screen. Select a video to play. Control playback with the virtual keys. 1 2 3 4 While playing a video, use the following options:
. Share via. Subtitles. This option To send a video to others, select Bookmarks. To view the list of bookmarks, select This option appears only if you have bookmarked during playback by selecting To display subtitles, select appears only when a video supports a subtitle file. Colour tone. To apply a colour effect, select To activate outdoor visibility to select an appropriate lighting condition, select To set the video player to play the next file automatically, Auto play next. select To view video details, select Outdoor visibility. Details. Entertainment 78 Gallery Learn to view photos and play videos saved in your devices memory. Supported file formats Type Image Format Extension: BMP, GIF, JPG, PNG Extension: 3gp(mp4), avi(divx), wmv(asf), flv, mkv, webm Codec: MPEG4, H.263, H.264, VC-1, DivX/XviD, VP8, WMV7/8, DivX3.11, Sorenson H.263 Video Avoid locking the devices screen while playing a DivX Video-On-Demand. Each time you lock the screen while playing a DivX Video-On-Demand, one of your available rental counts will be decremented. Some file formats are not supported depending on the software of the device. If the file size exceeds the available memory, an error can occur when you open files. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. View a photo 1 Open the application list and select 2 Select a folder. Gallery. To filter photos and videos, select By album or Images and videos an option. Entertainment 79 Select a photo (with no icon) to view. 3 While viewing a photo, use the following options:
To view more photos, scroll left or right. To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also double-tap the screen. If you activated tilting motions, you can zoom in or out by tapping and holding two points with your fingers and then tilting the device back and forth. Tap the screen to To start a slideshow of images, select stop the slideshow. To send a photo to others, select To delete a photo, select
. To view photo details, select To rotate a photo anti-clockwise, select To rotate a photo clockwise, select To set a photo as wallpaper or an image for a contact, select Rotate right. Rotate left. Details. Set picture as. To crop an image from a photo, select To print a photo using a WLAN or USB connection, select Print. Your device is compatible only with some Crop. Samsung printers. Copy. To copy a photo, select To use motion recognition, select Play a video 1 Open the application list and select 2 Select a folder. Motion. Gallery. To filter photos and videos, select By album or Images and videos an option. icon) to play. Select a video (with the Control playback with the virtual keys. 3 4 Entertainment 80 Select picture a folder an image. Photo editor You can edit photos and apply various effects. 1 2 3 Open the application list and select Select You can create a new photo by selecting Capture picture. Select want to select. To change the type of the selection tool, select To add to or subtract from the selection border, select OK and drag your finger over the area you Photo editor.
,
, or
. If you select Grab, you can adjust the selection size by selecting To reverse the selection, select
. 4 5 6 7 8 Done. Select Use the following options to edit the photo:
Option Function Rotate or flip the image. Resize the image by dragging the rectangle or selecting 100% an option. Crop the image by moving or dragging the rectangle. Apply a colour effect. Apply a filter effect. Use additional tools. Select Select to undo your last action. to redo your last action. Adjust the image as desired and select When you are finished, select Enter a name for the photo and select
. OK. Done. Entertainment 81 Personal information
. Contacts. Contacts Learn to create and manage a list of your personal or business contacts. You can save names, mobile phone numbers, home phone numbers, email addresses, birthdays and more for your contacts. Create a contact 1 2 3 Open the application list and select Select Select a memory location. If you have more than one account, select an account to which you want to add the contact. Enter contact information. Select 4 5 You can retrieve contacts by synchronising your assigned account. 1 2 3 4 Open the application list and select Select Select an account. Select contacts An updated contact list is retrieved and saved on your device automatically. Done to add the contact to memory. View SNS friends. Done. Contacts. Personal information 82 Retrieve contacts by your account You can retrieve contacts by synchronising your assigned account. 1 2 3 Open the application list and select Select Select an account. An updated contact list is retrieved and saved on your device automatically. View SNS friends. Contacts. Contacts. Search contacts and enter the first few letter of a Find a contact 1 Open the application list and select 2 Select name. 3 Select the contacts name. Once you find a contact, you can use the following options:
To call the contact, select To send a message, select To send an email message, select an email address. Edit. To edit the contact information, select OK. To delete the contact, select To set the contact as your favourites, select Import or export contacts To import contact files (in vcf format) from a memory card to your device, 1 2 Open the application list and select Select Import/Export Import from SD card. Contacts. or
. Personal information 83 3 OK. Contacts. OK to confirm. Import/Export Export to SD card. Open the application list and select Select Select Select a memory location. If you have more than one account, select an account to which you want to add the contact. Select an option for importing a single contact file, multiple contact files, or all contact files, and select OK. Select contact files to import and select 4 5 To export contacts from your device to a memory card, 1 2 3 Copy or move contacts To copy or move contacts from the SIM or USIM card to your device, 1 2 3 Open the application list and select Select Select a memory location. If you have more than one account, select an account to which you want to add the contact. Select contacts and select 4 To copy or move contacts from your device to the SIM or USIM card, 1 2 3 Open the application list and select Select Select contacts and select Import/Export Import from SIM card. Import/Export Export to SIM card. Copy or Move OK. Copy or Move. Contacts. Contacts. Personal information 84 Create your namecard 1 Open the application list and select 2 Select 3 Select 4 Enter your own personal details. 5 Select My profile. Done. Edit. Contacts. You can send your namecard by attaching it to a message or an email or transferring it via the Bluetooth wireless feature. Groups Create a group of contacts 1 Open the application list and select 2 Select 3 Enter a name for the group. 4 Select 5 Select members from the contact list and select 6 When you are finished, select Edit members. Contacts. Done. Done. Calendar Learn to create and manage daily, weekly, or monthly events, and set alarms to remind yourself of important events. Change the calendar view 1 Open the application list and select 2 Select a view mode from the top of the calendar.
: A list of scheduled appointments for the days in
: Hourly blocks for one full day Calendar. Day Week one full week Personal information 85 Calendar. Month List
: Daily blocks for the current month
: A list of all scheduled appointments
. Done. Create an event 1 Open the application list and select 2 Select 3 Enter the details of the event as required. 4 Select View events To view todays schedule, 1 2 3 To view events of a specific date, 1 2 Open the application list and select Select Select an event to view its details. Today. Calendar.
, Calendar. Go to, enter the date by selecting Open the application list and select Select a date on the calendar. To move to a specific day by entering a date manually, or select and select Set. Select an event to view its details. 3 Stop an event alarm If you set an alarm for a calendar event, the event alarm icon will appear at the specified time. 1 on the system bar. 2 3 Select Select a reminder to view more details about the event. To snooze or dismiss the reminder, select the check box next to events you want and select Snooze or Dismiss. Personal information 86
. Memo. Memo Learn to record important information to save and view at a later date. Create a memo 1 Open the application list and select 2 Select 3 Enter your memo text. 4 Select View memos 1 Open the application list and select 2 Select a memo to view its details. To use additional features with a memo, select Tool Memo. Done. Function Delete the memo. Change the background colour of the memo. Lock the memo. Print the memo using a WLAN or USB connection. Your device is compatible only with some Samsung printers. Upload your memo on community websites. Send the memo to others. Personal information 87 Connectivity PC connections Learn to connect your device to a PC with a USB cable in various USB connection modes. By connecting the device to a PC, you can synchronise files with Windows Media Player, transfer data to and from your device directly, and use the Samsung Kies program. To use PC connections, you must deactivate USB debugging mode. Open the application list and select Settings Applications Development, and then clear the check box next to USB debugging. Connect with Samsung Kies Ensure that Samsung Kies is installed on your PC. You can download the program from the Samsung website
(www.samsung.com/kies). Samsung Kies will work on both Windows and Macintosh computers. Using a USB cable, connect the multifunction jack on your device to a PC. Samsung Kies will launch automatically. If Samsung Kies does not launch automatically, double-
click the Samsung Kies icon on your PC. Copy files from the PC to the device. Refer to the Samsung Kies help for more information. 1 2 Connectivity 88 Synchronise with Windows Media Player Ensure that Windows Media Player is installed on your PC. 1 Using the USB cable, connect the multifunction jack on your device to a PC with Windows Media Player installed. When connected, a pop-up window will appear on the PC. Open Windows Media Player to synchronise music files. Edit or enter your devices name in the pop-up window (if necessary). Select and drag the music files you want to the sync list. Start synchronisation. 2 3 4 5 Connect as a mass storage device You can connect your device to a PC as a removable disk and access the file directory. If you insert a memory card in the device, you can access the file directory of the memory card by using the device as a memory card reader. The file directory of the memory card will appear as a removable disk, separate from the internal memory. If you want to transfer files from or to a memory card, insert a memory card into the device. Using the USB cable, connect the multifunction jack on your device to a PC. Open the folder to view files. Copy files from the PC to your device. 1 2 3 4 To disconnect the device from the PC, click the USB device icon on the Windows task bar and click the option to safely remove the mass storage device. Then remove the USB cable from the PC. Otherwise, you may lose data stored on your device or damage your device. Connectivity 89 Wi-Fi Learn to use your devices wireless networking capabilities to activate and connect to any wireless local area network
(WLAN) compatible with the IEEE 802.11 b/g/n standards. You can connect to the internet or other network devices anywhere an access point or wireless hotspot is available. Your device uses non-harmonised frequency and is intended for use in all European countries. The WLAN can be operated in the EU without restriction indoors, but cannot be operated outdoors in France. Activate the WLAN feature 1 2 Open the application list and select and networks. Select Wi-Fi to activate the WLAN feature. Settings Wireless An active WLAN running in the background will consume battery power. To preserve battery power, activate the WLAN only when needed. Find and connect to a WLAN 1 Open the application list and select and networks Wi-Fi settings. The device will automatically search for available WLANs. Select a network under Enter a password for the network (if necessary). Select Settings Wireless Wi-Fi networks. 2 3 4 OK. Connectivity 90 Add a WLAN manually 1 Settings Wireless Open the application list and select and networks Wi-Fi settings Add Wi-Fi network. 2 Enter the SSID for the network and select the security type. 3 Set the security settings depending on the selected security type. 4 Save. Select Connect to a WLAN using a Wi-Fi Protected Setup (WPS) Settings Wireless WPS push button OK. Open the application list and select and networks Wi-Fi settings. Select a network indicated as WPS available and select the drop-down menu next to Network setup. Select Press a WPS button on the access point within 2 minutes. Using WPS, you can connect to a secured network. To connect to a WLAN with a WPS button, 1 2 3 4 To connect to a WLAN with a WPS PIN, 1 Open the application list and select and networks Wi-Fi settings. 2 Select a network indicated as WPS available and select the drop-down menu next to Network setup. 3 Select device OK. 4 On the access point, enter the PIN and press the start button. WPS pin from access point or WPS pin from this Settings Wireless Connectivity 91 Settings Wireless Set the static IP settings 1 Open the application list and select and networks Wi-Fi settings. 2 Select an access point on the network list. 3 Select the drop-down menu next to 4 Select 5 Change the IP settings for the access point such as IP address, Network prefix length, Gateway, DNS. 6 Select IP settings. Static. OK. Wi-Fi Direct Learn to use the Wi-Fi Direct feature to connect two devices via a Wi-Fi network without requiring an access point. Connect your device to another device 1 Settings Wireless Open the application list and select and networks Wi-Fi Direct settings Wi-Fi Direct. 2 Select 3 Select a device and then select When the owner of the other device accepts the connection, the devices are connected. Scan. Connect. Send data via Wi-Fi 1 Select a file or item, such as a memo, media file, or web address, from an appropriate application or My files. Connectivity 92 2 3 Select an option for sending data via Wi-Fi. The method for selecting an option may vary by data type. Search for and select another device. Bluetooth Bluetooth is a short-range wireless communications technology capable of exchanging information over a distance of about 10 m without requiring a physical connection. You do not need to line up the devices to beam information with Bluetooth. If the devices are within range of one another, you can exchange information between them even if they are located in different rooms. Samsung is not responsible for the loss, interception, or misuse of data sent or received via the Bluetooth wireless feature. Always ensure that you share and receive data with devices that are trusted and properly secured. If there are obstacles between the devices, the operating distance may be reduced. Some devices, especially those that are not tested or approved by Bluetooth SIG, may be incompatible with your device. Connectivity 93 Turn on the Bluetooth wireless feature 1 2 Open the application list and select and networks. Select feature. Bluetooth to turn on the Bluetooth wireless Settings Wireless 2 3 Settings Wireless Find and pair with other Bluetooth-enabled devices 1 Open the application list and select and networks Bluetooth settings Find nearby devices. Select a device. Enter a PIN for the Bluetooth wireless feature or the other devices Bluetooth PIN, if it has one, and select OK. Alternatively, select Accept to match the PIN between your device and the device. When the owner of the other device enters the same PIN or accepts the connection, pairing is complete. If the pairing is successful, the device will automatically search for available services. Some devices, especially headsets or hands-free car kits, may have a fixed Bluetooth PIN, such as 0000. If the other device has a PIN, you must enter it. Connectivity 94 Send data using the Bluetooth wireless feature 1 Select a file or item, such as a contact, calendar event, memo, or media file, from an appropriate application. 2 Select an option for sending data via Bluetooth. The method for selecting an option may vary by data type. 3 Search for and pair with a Bluetooth-enabled device. Receive data using the Bluetooth wireless feature 1 Open the application list and select and networks Bluetooth settings Visible. 2 When prompted, enter the PIN for the Bluetooth wireless feature and select OK (if necessary). 3 Select that you are willing to receive data from the device. on the system bar and select Accept to confirm Settings Wireless Received data is saved to the bluetooth folder. If you receive a contact file, select My files bluetooth a contact file to import it to your contact list. AllShare Learn to use the Digital Living Network Alliance (DLNA) service that enables you to share media files between DLNA-
enabled devices in your home over a WLAN. You must first activate the WLAN feature and add a WLAN profile. p. 90 The supported file formats may vary depending on the software of the device. Some files may not play on the DLNA- enabled devices depending on the devices. Connectivity 95 Customise DLNA settings for sharing media files
. AllShare. To allow other DLNA-enabled devices to access media files on your device, you must activate media sharing. 1 2 3 Open the application list and select Select Adjust the following settings to customise the DLNA feature:
Option Media server name Function Enter a name for your device as a media server. Turn on video, image, and music sharing with other DLNA-enabled devices. Select a connection profile to use for DLNA connections. Set whether or not to accept the upload from other devices. Select the default memory location for saving downloaded media files. Share media Access point network Upload from other devices Default memory Play your files on another DLNA-enabled device 1 Open the application list and select 2 Select 3 Select a media category and a file. My device files. AllShare. Connectivity 96 4 5 Select a playerthe one that will play the media file. Playback begins at the selected player. Control playback using icons of your device. Playback may be buffered, depending on the network connection and the connected server. files. AllShare. Play others files on your device 1 Open the application list and select 2 Select a device as the media serverthe one that contains media files. 3 Select a media category Playback begins at the selected player. 4 Control playback using icons of your device. Play files of one device on the other device 1 Open the application list and select 2 Select a device as the media serverthe one that contains media files. 3 Select a media category Playback begins at the selected player. 4 Select Your device automatically searches for DLNA-enabled devices. Select a playerthe one that will play the media file. Control playback using icons of your device. AllShare. files. 5 6
. Connectivity 97 Mobile network sharing Learn to set your device as a wireless modem or wireless access point for PCs or other devices, and share your devices mobile network connection. Share your devices mobile network via WLAN 1 Settings Wireless 2 3 Open the application list and select and networks Tethering and portable hotspot. Portable Wi-Fi hotspot to activate the WLAN Select tethering feature. Configure portable Wi-Fi hotspot to configure Select network settings to use your device as an access point. Option Network SSID Security Password Function View and edit the device name that will be shown to external devices. Select the security type. View or edit the network key to prevent unauthorised access to the network. 4 5 Save. When you are finished, select From another device, locate your devices name in the available connection list and connect to the network. Your device shares the mobile network connection on another device. Connectivity 98 Share your devices mobile network via USB 1 2 3 Using a USB cable, connect the multifunction jack on your device to a PC. Open the application list and select and networks Tethering and portable hotspot. USB tethering to activate the USB tethering Select feature. Your device shares the mobile network connection on your PC. To stop sharing the network connection, clear the check box next to USB tethering. Settings Wireless The sharing method for the network connection may differ depending on the PCs operating system. Settings Wireless Share your devices mobile network via the Bluetooth wireless feature 1 Open the application list and select and networks Bluetooth settings. 2 Select feature. 3 Find and pair with other Bluetooth-enabled devices to share a network. p. 94 4 Select portable hotspot Bluetooth tethering to activate the Bluetooth tethering feature. Wireless and networks Tethering and Bluetooth to turn on the Bluetooth wireless Connectivity 99 GPS Your device is equipped with a global positioning system
(GPS) receiver. Learn to activate location services. To receive better GPS signals, avoid using your device in the following conditions:
between buildings, in tunnels or underground passages, or inside buildings in poor weather around high voltage or electromagnetic fields in a vehicle with sun protection film Do not touch the internal antenna area or cover this area with your hands or other objects while using the GPS functions. This feature may be unavailable depending on your region or service provider. Activate location services You must activate location services to receive location information and search the map. 1 2 Open the application list and select and security. Adjust the following settings to activate location services:
Option Use wireless networks Use GPS satellites Function Set to use WLAN and/or mobile networks for finding your location. Set to use the GPS satellite for finding your location. Settings Location Connectivity 100 Option Use location for Google Search Function Set the device to use your current location for Google search and other Google services. TV connections You can remotely control a TV with your device to browse your favourite shows and get programming suggestions based on your choices. You can also control other devices connected with the TV. Connect to a TV You must first connect your device to a WLAN to get information of your TV and ensure that the infrared port is facing the TV. 1 2 3 4 5 6 7 Open the application list and select Rotate the device anti-clockwise to landscape orientation. Select an option next to Select Select between your device and TV. Select To add other devices, select Add New Device. Control your TV or other devices with the icons on your device. Choose Brand the brand of your TV. Test Power On/Off Yes to check the connection Set Up Smart Remote Now:
SmartRemote. Done. Customise remote control settings 1 Open the application list and select 2 Select
. SmartRemote. Connectivity 101 Option Television Function Change the code for the command when you have a problem with a specific control. Set up connections with your TVs peripheral devices. Reset the connection settings. Add New Device Reset Peel Send Feedback Report your opinion for application development. VPN connections You can create virtual private networks (VPN) and connect to your private network securely through a public network, such as the internet. Your device should already be configured with internet access. If you have trouble accessing the internet, you need to edit connections. If you are not sure about the connection information to enter, ask your service provider. Set up VPN connections 1 Open the application list and select and networks VPN settings Add VPN. 2 Select a VPN type. 3 Customise the connection information. Settings Wireless Available options may vary depending on the VPN type. Option VPN name Function Enter a name of the VPN server. Connectivity 102 Option Set VPN server Enable Encryption Set IPsec pre-
shared key Enable L2TP secret Set L2TP security Set user certificate Set CA certificate DNS search domains Function Enter the IP address of the VPN server. Set to encrypt the VPN server. Enter a pre-shared key. Set to use the L2TP secret password. Enter the L2TP secret password. Select a user certificate that the VPN server uses to identify you. You can import certificates from the VPN server or download from the web. Select a certificate authority (CA) certificate that the VPN server uses to identify you. You can import certificates from the VPN server or download from the web. Enter the domain name server (DNS) address. Save. When you are finished, select 4 Connect to a private network 1 Open the application list and select and networks VPN settings. 2 Select a private network to connect. 3 Enter the user name and password and select Settings Wireless Connect. Connectivity 103 Tools
. Done. Alarm. Alarm Learn to set and control alarms for important events. Set a new alarm 1 Open the application list and select 2 Select 3 Set alarm details. 4 When you are finished, select Stop an alarm When the alarm sounds, To stop the alarm, drag the border of the circle. To repeat the alarm after a specified length of time, drag in any direction until it reaches the border of the circle. Delete an alarm 1 Open the application list and select 2 Select an alarm to delete. 3 Select Delete OK. in any direction until it reaches Alarm. You can delete or deactivate alarms by tapping and holding an alarm and selecting Delete alarm or Deactivate alarm. Tools 104 Calculator Learn to perform mathematical calculations directly on your device like a typical hand-held or desktop calculator. 1 Calculator. 2 Open the application list and select Use the keys that correspond to the calculator display to perform a basic or scientific calculator. Downloads Learn to manage logs of files you have downloaded from the web and email. 1 2 3 Open the application list and select Select a download folder. To open a downloaded file, select the log. To delete a log, select the check box and then select Downloads. eBook Learn to open and read books and PDF files. Read books 1 Open the application list and select 2 If you are launching this application for the first time, read the disclaimer and select Confirm. 3 Select a book from the bookshelf. 4 To move pages, drag your finger left or right or tap near the left or right margin of a page. eBook. Tools 105 5 6 Tap the screen and use the following options:
. To view the table of contents, bookmarks, or highlights, select To customise the settings for fonts and theme, select To read a book via text-to-speech feature, select Read. To search for text in the book, select To bookmark the current page, select To copy a word, tap and hold a word and select from the pop-up window. To highlight a word, tap and hold a word and select Highlight from the pop-up window. To add a memo, tap and hold a word and select from the pop-up window. To search a word on the web, tap and hold a word and select Search from the pop-up window. Memo Copy
. Create a drawing memo with the following tools:
Tool Function Highlight the text. Draw on the book. Erase the drawing or highlight. Customise the pen and highlight settings. Import book files You can import book files (in epub and pdf format) from the internal memory. Some DRM-protected book files are not supported. You can purchase a book via online bookstore by selecting
. Tools 106 1 2 3 Open the application list and select Select Select book files to import and select Import. eBook. Done. Google Search You can search for applications and files in your device and specific data on the web. 1 2 3 Open the application list and select Enter a letter or a word of the data to search for. To search for information by voice, select Select the items name you want to access. Google Search. My files Learn to quickly and easily access all of your images, videos, music, sound clips, and other types of files stored on your device. Supported file formats Type Image Format Video Music Extension: BMP, GIF, JPG, PNG Extension: 3gp(mp4), avi(divx), wmv(asf), flv, mkv, webm Codec: MPEG4, H.263, H.264, VC-1, DivX/XviD, VP8, WMV7/8, DivX3.11, Sorenson H.263 Extension: mp3, aac, ogg, wma, amr, m4a, mp4, flac, wav, mid, mxmf, xmf, rtttl, rtx, ota, imy Codec: MP3, MP3, AAC, AAC+, eAAC+, FLAC, WMA, Vorbis, Midi, AMR NB/WB, AC3(only with Video), WAV Tools 107 Avoid locking the devices screen while playing a DivX Video-On-Demand. Each time you lock the screen while playing a DivX Video-On-Demand, one of your available rental counts will be decremented. Some file formats are not supported depending on the software of the device. If the file size exceeds the available memory, an error can occur when you open files. Playback quality may vary by content type. Some files may not play properly depending on how they are encoded. Open a file 1 Open the application list and select 2 Select a drop-down menu at the top right of the screen and select an option to sort the file list. 3 Select a folder. To move up one level in the file directory, select To return to the top level of the file directory, select My files. Select a file to open. 4 Create a folder 1 Open the application list and select 2 Select 3 Enter a name and select Done. My files. Tools 108
. or My files. Copy or move files 1 Open the application list and select 2 Select a check box next to folders or files to copy or cut. 3 Select 4 Locate a folder and select Send files 1 Open the application list and select 2 Select a check box next to files to send. 3 Select Delete files 1 Open the application list and select 2 Select a check box next to folders or files to delete. 3 Select an option. My files. My files. Yes. Pen memo Learn to create sketch memos with various tools. 1 2 3 Open the application list and select Select Create a drawing memo with the following tools:
Tool Pen memo. Function Enter your text. Write or draw on the screen. Erase the sketch. Customise the tool settings. Tools 109 You can also use the following options:
To insert a photo, memo or map, select Select Select to undo your last action. to redo your last action. Done. When you are finished, select 4 Insert. Polaris Office. New file a document type. Polaris Office Learn to create or view Microsoft Word, Excel, PowerPoint, and Adobe PDF files on your device. Create a new document 1 Open the application list and select 2 If you are launching this application for the first time, register as an online user or skip the registration. 3 Select 4 Enter contents in the document. 5 When you are finished, select
. 6 Enter a name for the document and select the location to save the document. 7 Select Open a document 1 Open the application list and select 2 Select To open the recent file you have opened, select a file under Recent Files. Local Storage a document file. Polaris Office. Save. Tools 110 3 View the document as desired. Available options may vary depending on a document type. To open the toolbar to edit the document (word, text, or excel file), select To zoom in, place two fingers on the screen and spread them apart. To zoom out, move your fingers closer together. You can also select To search for text on the document, select You can also select To bookmark the current page, select To adjust the document to fit the screen, select Reflow text. To send a file to others, select To read the document via the text-to-speech feature, select To print the file using a WLAN or USB connection, select Bookclip. Text to speech. in landscape view. an option. Print. Your device is compatible only with some Send. Find. Samsung printers. Manage documents online To add an account, 1 2 3 Open the application list and select Select Enter your Email address and password to access your account, and then select OK. Polaris Office. Add account. To manage documents, 1 2 3 Open the application list and select Web Storage an account. Select View and manage your documents on the server as desired. Polaris Office. Tools 111 SIM Toolkit Use a variety of additional services offered by your service provider. Depending on your SIM or USIM card, this menu may be available but labelled differently. Open the application list and select SIM Toolkit. Task Manager With the task manager, you can view currently running applications and memory information. 1 Open the application list and select 2 Use the following options:
Task Manager.
: View the list of all the applications Active applications currently running on your device. Download applications installed on your device. RAM manager Storage device and memory card. Help life.
: View the total amount of memory used for
: Check and manage the RAM memory.
: View the used and available memory on your
: View help information about extending battery Voice Search Learn to use the voice command feature to search for locations and information by voice. This feature may be unavailable depending on your region or service provider. Open the application list and select Say a command into the microphone. Select the items name you want to access. Voice Search. 1 2 3 Tools 112 World clock Learn to view the time in another region. 1 Open the application list and select 2 Select 3 Enter a city name and select a city from the list. You can select a city in the world map view. 4 Select 5 To add more world clocks, repeat steps 2-4. World clock. To apply the summer time to the clocks, tap and hold a clock and select DST settings. Tools 113 Settings Access the Settings menu 1 2 Settings. Open the application list and select Select a setting category and select an option. Wireless and networks Change the settings for wireless network connections. Flight mode Disable all wireless functions on your device. You can use only non-network services. Wi-Fi Turn the WLAN feature on or off. Wi-Fi settings Wi-Fi Network notification open network is available. Wi-Fi sleep policy WLAN feature. Add Wi-Fi networks Wi-Fi Direct settings Wi-Fi Direct two devices via a WLAN without requiring an access point. p. 98 Device name
: Activate the Wi-Fi Direct feature to connect
: Turn the WLAN feature on or off. p. 90
: Set when the device will turn off the
: View or edit your devices name.
: Set the device to notify you when an
: Add WLAN APs manually. Settings 114
: Deactivate the Wi-Fi Direct
: View the connection status.
: Set a Bluetooth name for your device.
: Turn the Bluetooth wireless feature on or off. Status Disconnect Wi-Fi Direct feature. Kies via Wi-Fi Connect your device to Samsung Kies via a WLAN. Bluetooth Turn the Bluetooth wireless feature on or off. Bluetooth settings Bluetooth p. 94 Device name Visible devices. Visible time-out Show received files via the Bluetooth wireless feature. Find nearby devices devices. Tethering and portable hotspot USB tethering
: Activate the USB tethering feature to share your devices mobile network connection with PCs via USB. When connected to a PC, your device is used as a wireless modem for a PC. p. 99 Portable Wi-Fi hotspot
: Activate the Wi-Fi tethering feature to share your devices mobile network connection with PCs or other devices through the WLAN feature. p. 98
: Set your device to be visible to other Bluetooth
: Set duration that your device is visible.
: View files received from other devices
: Search for available Bluetooth Settings 115
: Configure network
: Activate the Bluetooth tethering Configure portable Wi-Fi hotspot settings to use your device as an access point. Bluetooth tethering feature to share your devices mobile network connection with PCs via the Bluetooth wireless feature. p. 99 Help
: Learn more about USB, Bluetooth, and WLAN tethering. VPN settings Set up and connect to virtual private networks (VPNs). p. 102 Mobile networks Use Packet data networks for network services. Data roaming when you are roaming or your home network is not available. Access Point Names Network Mode Network operators select a network for roaming.
: Search for available networks and
: Set up access point names (APNs).
: Set to allow packet switched data
: Select a network type.
: Set the device to connect another network Call Customise the settings for calling features.
: Set to reject calls from specified phone Call rejection numbers automatically. You can add phone numbers to the reject list. Set reject messages sent when you reject a call.
: Add or edit the message that will be Settings 116
].
: Set the device to end a call Call answering/ending
-
-
-
The power key ends calls when you press [
Automatic answering automatically answers calls after a specified period. Automatic answering
: Set to answer automatically after a specified period (available only when a headset is connected).
: Set whether or not the device
: Set to turn on the proximity Turn on proximity sensor sensor during a call. Call forwarding
: Divert incoming calls to another number. Fixed Dialing Numbers
: Activate or deactivate FDN mode to restrict calls to numbers in the FDN list. You must enter the PIN2 supplied with your SIM or USIM card and reboot the device. Voicemail
:
-
-
Voice mail service
: Select or set your service provider. Voice mail numbe r: Enter the number to access the voice mail service. You can obtain this number from your service provider. Additional settings
:
-
-
Caller ID outgoing calls. Call waiting progress.
: Display your caller ID to other parties for
: Allow incoming call alerts when a call is in
: Select an image to be shown to the other Video call image party. Own video in received call image or preset image to the other party. Use call fail options call when a video call fails to connect.
: Set whether to show your live
: Select whether or not to retry a voice Settings 117
: Set up your accounts for IP call services. Accounts Use Internet calling IP call services are provided only via a Wi-Fi connection.
: Set the device to use IP call services. Sound Change the settings for various sounds on your device.
: Activate Silent mode to mute all sounds
: Select a ringtone to alert you to incoming
: Adjust the vibration intensity of the
: Set when the device will vibrate for various events.
: Adjust the volume level for call ringtones, Silent mode except media sounds and alarm ringtones. Vibrate Volume notifications, media sounds, alarm ringtones, and system sounds. Vibration intensity haptic feedback. Phone ringtone calls. Notification ringtone events. Audible touch tones touch the keys on the dialling screen. Audible selection select an application or option on the touch screen. Screen lock sounds lock or unlock the touch screen. Haptic feedback the keys.
: Set the device to sound when you
: Set the device to sound when you
: Set the device to sound when you
: Select a ringtone to alert you to
: Set the device to vibrate when you touch Settings 118
: Activate the automatic brightness or set the Screen Change the settings for the display. Brightness brightness of the display. Screen display
:
-
: Change the font type for the display text. You Font style can download fonts from Android Market by selecting Get fonts online. Home screen
:
Wallpaper: Select a background image for the Home screen. Lock screen
:
Wallpeper: Select an image to display when the screen is locked.
-
-
: Select a display mode.
: Set the device to display animation when you
: Set whether or not to rotate the
: Set the length of time the device waits before Mode Auto-rotate screen content automatically when the device is rotated. Animation switch between windows. Timeout turning off the displays backlight. Quick launch You can launch the application by selecting Auto adjust screen power the brightness of the display. Horizontal calibration
: Calibrate the accelerometer to adjust the horizontal axis of the device for better motion recognition.
: Select an application to create a shortcut.
: Set to save power by adjusting
. Settings 119
: Automatically activate Power
: Select a power level for Power
: Deactivate the Wi-Fi feature when the
: Deactivate the Bluetooth feature
: Deactivate the GPS feature when not in use.
: Turn off sync when the device is not Power saving mode Use Custom power saving saving mode when the battery is low. Custom power saving settings
:
-
-
-
-
-
-
-
-
Power saving mode on saving mode. Turn off Wi-Fi device is not connected with a Wi-Fi AP. Turn off Bluetooth when not in use. Turn off GPS Turn off Sync synchronising with a web server. Brightness saving mode. Brightness mode. Timeout turning off the displays backlight. Learn about power saving consumption.
: Activate the brightness setting for Power
: Set the brightness level for Power saving
: Set the length of time the device waits before
: Learn how to reduce battery Location and security Change the settings for securing your device and GPS functionality.
: Set to use WLANs and/or mobile Use wireless networks networks for finding your location. Use GPS satellites your location.
: Set to use the GPS satellite for finding Settings 120
: Set the device to use
: Disable the screen lock.
: Set how to unlock the screen. Use location for Google Search your current location for Google search and other Google services. Configure lock screen
-
Off
-
Unsecure password, or pattern.
-
Pattern PIN -
-
Password screen.
: Set an unlock pattern to unlock the screen.
: Set a password (alphanumeric) to unlock the
: Set to use the screen lock without a PIN,
: Set a PIN (numeric) to unlock the screen.
: Edit the text you want to display on Owner information the screen in Screen lock mode. Encrypt device
: Set a password to encrypt the device to protect data and information saved on the device. Once the device is encrypted, you must enter the password each time you turn on the device. You must first charge the battery because it may take more than an hour to encrypt your device. Encrypt SD card
:
-
Encrypt SD card encrypting the data on your memory card.
-
Full encryption card.
-
Exclude multimedia files multimedia files on your memory card.
: Set to encrypt all files on your memory
: Protect your personal information by
: Set to encrypt all files except You may not access the encrypted memory card after the factory data reset. First, decode the memory card before the factory data reset. SIM change alert mobile feature which helps you locate your device when it is lost or stolen. p. 34
: Activate or deactivate the Find my Settings 121
: Set up recipients to receive a
: Set to control a lost device remotely via Alert message recipients tracking message from your lost device. Remote controls the web. Set up SIM card lock
:
-
-
Lock SIM card to require the PIN before using the device. Change SIM PIN USIM data.
: Activate or deactivate the PIN lock feature
: Change the PIN used to access SIM or
: Set the device to display your password
: View device administrators Visible passwords as you enter. Device administrators installed on your device. You can activate device administrators to apply new policies to your device. Use secure credentials ensure secure use of various applications. Install from USB storage are stored in the USB storage. Set password credentials. Clear storage device and reset the password.
: Erase the credential contents from the
: Use certificates and credentials to
: Create and confirm a password for accessing
: Install encrypted certificates that Applications Change the settings for managing installed applications.
: Access the list of the applications Manage applications installed on the device and check the application information. Running services access them to manage. Memory usage used by applications.
: View the services you are using and
: View available memory and the memory Settings 122
: Select to download applications
: View the amount of power consumed by your Battery use device. Unknown sources from any source. If you do not select this option, you can download applications only from Android Market. Development
:
-
-
-
USB debugging using a USB cable. This is for application development. Stay awake charging the battery. Allow mock locations
: Allow mock locations and service information to be sent to a Location Manager service for testing. This is for application development.
: Set the devices screen to stay on while
: Select to connect your device to a PC by
: Select a network connection (WLAN or Samsung Apps packet switched data network) to get notifications for new applications from Samsung Apps. This feature may be unavailable depending on your region or service provider. Accounts and sync Change the settings for the auto sync feature or manage accounts for synchronisation. Background data
: Select this setting to use the auto sync feature. The auto sync will run in the background without opening applications and synchronise data. Auto-sync and email data automatically.
: Set the device to synchronise contact, calendar, Settings 123
: Set to use motion recognition. Motion Change the settings that control motion recognition on your device. Motion activation Tilt to zoom
: Set to zoom in or out while viewing images in Gallery or browsing web pages when you tap and hold two points with your fingers and then tilt the device back and forth. Pan to edit
: Set to move an item to another page when you tap and hold the item and then pan the device to the left or right. Privacy Change the settings for managing your settings and data.
: Set to back up your settings and
: Add and view your Google account to Back up my data application data to the Google server. Backup account back up your data. Automatic restore application data when the applications are reinstalled on your device. Factory data reset default values and delete all your data.
: Reset your settings to the factory
: Set to restore your settings and Storage View memory information for your device and memory card. You can also format the memory card. Formatting a memory card will permanently delete all data from the memory card. Settings 124
: Select a language for the Google voice
: Set the device to filter explicit text and/or Language and input Change the settings for text input, the voice recogniser, and the text-to-speech feature. Select language Select a display language for all menus and applications. Voice recognition settings Language recognition. SafeSearch images from voice search results. Block offensive words recognised from voice search results. Text-to-speech settings Listen to example example. Always use my settings
: Set to use the speech rate and language settings you specify over the settings saved in applications. Default engine used for spoken text. Install voice data text-to-speech feature. Speech rate Language Engines
: Select a speed for the text-to-speech feature.
: Select a language for the text-to-speech feature.
: View the text-to-speech engines in your device.
: Download and install voice data for the
: Set the speech synthesis engine to be
: Hide offensive words your device
: Listen to the spoken text for an Settings 125 Current input method View a default keyboard type for text input. Input method selector Set the device to hide or display the text input settings icon
). If you select Automatic, your device will automatically
(
hide or display the icon, based on the keyboard. Configure input methods Swype
-
-
Swype Settings
:
Select Input Method: Change the keyboard type. How to Swype: Learn how to enter text with the Swype keyboard. Personal dictionary: Set up your own dictionary. The words in your dictionary will appear as suggestions for your text inputs. Preferences:
: Set the device to use the Swype keyboard.
: Set the device to vibrate when Audio feedback
: Set to alert you when there are no alternative words for your input if you double-tap a word. Vibrate on keypress you touch a key. Show tips for your actions when available. Auto-spacing space between words. Auto-capitalization
: Set the device to automatically capitalise the first letter after a final punctuation mark, such as a period, question mark, or exclamation mark.
: Set the device to automatically display tips
: Set the device to automatically insert a Settings 126
: Set to display the trace of your
: Set the device to predict words Show complete trace dragging on the keyboard. Word suggestion according to your input and display word suggestions. Speed vs. accuracy
: Set the ratio between the speed and accuracy of Swype suggestions. Reset Swypes dictionary added to the dictionary. Version Language Options: Select languages for text input.
: View version information.
: Delete the words you have Android keyboard
-
-
-
: Select languages for text input.
: Set the device to use the Android Android keyboard keyboard. Active input methods Settings
:
Auto-capitalisation: Set the device to automatically capitalise the first letter after a final punctuation mark, such as a full stop, question mark, or exclamation mark. Vibrate on key-press: Set the device to vibrate when you touch a key. Sound on key-press: Set the device to sound when you touch a key. Show settings key: Set whether to show the settings key. Auto-correction: Set the device to automatically correct the misspelled words. Show correction suggestions: Set the device to predict words according to your input and display word suggestions. Settings 127 Samsung keypad
-
-
: Set the device to use the Samsung Samsung keypad keyboard. Settings
:
Input language: Select languages for text input. XT9: Activate XT9 mode to enter text using Predictive input mode. XT9 advanced settings: Activate the advanced features of XT9 mode, such as auto completion, auto correction, or auto substitution, and set up your own word list. Automatic full stop: Set the device to insert a full stop when you double-tap the space bar. Sound on keypress: Set the device to sound when you touch a key. Auto-capitalization: Set the device to automatically capitalise the first letter after a final punctuation mark, such as a full stop, question mark, or exclamation mark. Voice input: Activate the voice input feature to enter text by voice on the Samsung keypad. Handwriting settings: Customise the settings for Handwriting mode, such as recognition time, pen thickness or pen colour. Tutorial: Learn how to enter text with the Samsung keypad. Settings 128 Accessibility Change the settings for accessibility features.
: Select an accessibility
: Set the device to end a call
: Set to allow downloading of
: Activate an accessibility application you have Accessibility downloaded, such as Talkback or Kickback, which provide voice, melody, or vibration feedback. Accessibility applications application to use. Accessibility scripts accessibility scripts from Google. The power key ends calls
]. when you press [
Tap and hold delay
: Set the recognition time for tapping and holding the screen. Torch light Mono audio with one earbud. Call answering/ending
:
-
-
-
The power key ends call when you press [
Automatic answering incoming call when you press the Home key. Automatic answering waits before answer an incoming call.
: Turn the torch light on or off.
: Enable mono sound when you listen to audio
: Set the length of time the device
: Set the device to answer an
: Set the device to end a call
]. Accessibility shortcut settings on the quick menu that appears when you press and hold [
: Add a shortcut to Accessibility
]. Settings 129 Date and time Access and alter the following settings to control how time and date are displayed on your device:
If the battery remains fully discharged or removed from the device, the time and date will be reset.
: Automatically update the date
: Set the current date manually.
: Set the current time manually. Automatic date and time and time when you move across time zones. Set date Set time Select time zone Use 24-hour format 24-hour format. Select date format
: Set your home time zone.
: Select a date format.
: Set to the time to be displayed in About device Access information about your device, check the devices status, and update the device system. Settings 130 Try this to solve the problem:
Troubleshooting When you turn on your device or while you are using the device, it prompts you to enter one of the following codes:
Code Password When the device lock feature is enabled, you must enter the password you set for the device. When using the device for the first time or when the PIN requirement is enabled, you must enter the PIN supplied with the SIM or USIM card. You can disable this feature by using the Lock SIM card menu. Your SIM or USIM card is blocked, usually as a result of entering your PIN incorrectly several times. You must enter the PUK supplied by your service provider. When you access a menu requiring the PIN2, you must enter the PIN2 supplied with the SIM or USIM card. For details, contact your service provider. PIN2 PUK PIN Your device displays network or service error messages When you are in areas with weak signals or poor reception, you may lose reception. Move to another area and try again. You cannot access some options without a subscription. Contact your service provider for more details. Troubleshooting 131 The touch screen responds slowly or improperly If your device has a touch screen and the touch screen is not responding properly, try the following:
Remove any protective covers from the touch screen. Protective covers may prevent the device from recognising your inputs and are not recommended for touch screen devices. Ensure that your hands are clean and dry when tapping the touch screen. Restart your device to clear any temporary software bugs. Ensure that your device software is upgraded to the latest version. If the touch screen is scratched or damaged, take it to your local Samsung Service Centre. Your device freezes or has fatal errors If your device freezes or hangs, you may need to close programs or reset the device to regain functionality. If your
] for10-
device is frozen and unresponsive, press and hold [
15 seconds. The device will reboot automatically. If this does not solve the problem, perform a factory data reset. Open the application list and select Settings Privacy Factory data reset Reset device Erase everything. Calls are being dropped When you are in areas with weak signals or poor reception, you may lose your connection to the network. Move to another area and try again. Troubleshooting 132 Outgoing calls are not connected Ensure that you have pressed the Dial key. Ensure that you have accessed the right cellular network. Incoming calls are not connected Ensure that your device is turned on. Ensure that you have accessed the right cellular network. Others cannot hear you speaking on a call Ensure that you are not covering the built-in microphone. Ensure that the microphone is close to your mouth. If using a headset, ensure that it is properly connected. Audio quality is poor Ensure that you are not blocking the devices internal antenna. When you are in areas with weak signals or poor reception, you may lose reception. Move to another area and try again. When dialling from contacts, the call is not connected Ensure that the correct number is stored in the contact list. Re-enter and save the number, if necessary. The device beeps and the battery icon is empty Your battery is low. Recharge the battery to continue using the device. Troubleshooting 133 The battery does not charge properly or the device turns off If the battery will no longer charge completely, you need to replace it with a new battery. Take your device to your local Samsung Service Centre. Your device is hot to the touch When you use applications that require more power or use applications on your device for an extended period of time, your device may feel hot to the touch. This is normal and should not affect your devices lifespan or performance. Error messages appear when launching the camera Your Samsung mobile device must have sufficient available memory and battery power to operate the camera application. If you receive error messages when launching the camera, try the following:
Charge the battery. Free some memory by transferring files to a PC or deleting files from your device. Restart the device. If you are still having trouble with the camera application after trying these tips, contact a Samsung Service Centre. Error messages appear when opening music files Some music files may not play on your Samsung mobile device for a variety of reasons. If you receive error messages when opening music files on your device, try the following:
Free some memory by transferring files to a PC or deleting files from your device. Ensure that the music file is not Digital Rights Management
(DRM)-protected. If the file is DRM-protected, ensure that you have the appropriate license or key to play the file. Ensure that your device supports the file type. Troubleshooting 134 Another Bluetooth device is not located Ensure that the Bluetooth wireless feature is activated on your device. Ensure that the Bluetooth wireless feature is activated on the device you wish to connect to, if necessary. Ensure that your device and the other Bluetooth device are within the maximum Bluetooth range (10 m). If the tips above do not solve the problem, contact a Samsung Service Centre. A connection is not established when you connect the device to a PC Ensure that the USB cable you are using is compatible with your device. Ensure that you have the proper drivers installed and updated on your PC. Troubleshooting 135 Safety precautions To prevent injury to yourself and others or damage to your device, read all of the following information before using your device. Warning: Prevent electric shock, fire, and explosion Do not use damaged power cords or plugs, or loose electrical sockets Do not touch the power cord with wet hands, or disconnect the charger by pulling on the cord Do not bend or damage the power cord Do not use your device while charging or touch your device with wet hands Do not short-circuit the charger Do not drop or cause an impact to the charger or the device Do not charge the battery with chargers that are not approved by the manufacturer Do not use your device during a thunderstorm Your device may malfunction and your risk of electric shock is increased. Handle and dispose of the device and chargers with care Use only Samsung-approved batteries and chargers specifically designed for your device. Incompatible chargers can cause serious injuries or damage to your device. Never dispose of devices in a fire. Follow all local regulations when disposing of used devices. Safety precautions 136 Never place devices on or in heating devices, such as microwave ovens, stoves, or radiators. Batteries may explode when overheated. Never crush or puncture the device. Avoid exposing the device to high external pressure, which can lead to an internal short circuit and overheating. Protect the device and chargers from damage Avoid exposing your device to very cold or very hot temperatures. Extreme temperatures can cause the deformation of the device and reduce the charging capacity and life of your device and batteries. Never use a damaged charger. Caution: Follow all safety warnings and regulations when using your device in restricted areas Turn off your device where prohibited Comply with all regulations that restrict the use of a mobile device in a particular area. Do not use your device near other electronic devices Most electronic devices use radio frequency signals. Your device may interfere with other electronic devices. Do not use your device near a pacemaker Avoid using your device within a 15 cm range of a pacemaker if possible, as your device can interfere with the pacemaker. If you must use your device, keep at least 15 cm away from the pacemaker. To minimise the possible interference with a pacemaker, use your device on the opposite side of your body from the pacemaker. Do not use your device in a hospital or near medical equipment that can be interfered with by radio frequency If you personally use any medical equipment, contact the manufacturer of the equipment to ensure the safety of your equipment from radio frequency. Safety precautions 137 If you are using a hearing aid, contact the manufacturer for information about radio interference Some hearing aids may be interfered with by the radio frequency of your device. Contact the manufacturer to ensure the safety of your hearing aid. Turn off the device in potentially explosive environments Always comply with regulations, instructions and signs in potentially explosive environments. Do not use your device at refuelling points (service stations), near fuels or chemicals, and at blasting areas. Do not store or carry flammable liquids, gases, or explosive materials in the same compartment as the device, its parts, or accessories. Turn off your device when in an aircraft Using your device in an aircraft is illegal. Your device may interfere with the electronic navigation instruments of the aircraft. Electronic devices in a motor vehicle may malfunction due to the radio frequency of your device Electronic devices in your car may malfunction due to radio frequency of your device. Contact the manufacturer for more information. Comply with all safety warnings and regulations regarding mobile device usage while operating a vehicle While driving, safely operating the vehicle is your first responsibility. Never use your mobile device while driving, if it is prohibited by law. For your safety and the safety of others, practice good common sense and remember the following tips:
Use a hands-free device. Get to know your device and its convenience features, such as speed dial and redial. These features help you reduce the time needed to place or receive calls on your mobile device. Position your device within easy reach. Be able to access your wireless device without removing your eyes from the road. If you receive an incoming call at an inconvenient time, let your voice mail answer it for you. Safety precautions 138 Let the person you are speaking with know you are driving. Suspend calls in heavy traffic or hazardous weather conditions. Rain, sleet, snow, ice, and heavy traffic can be hazardous. Do not take notes or look up phone numbers. Jotting down a to do list or flipping through your address book takes attention away from your primary responsibility of driving safely. Dial sensibly and assess the traffic. Place calls when you are not moving or before pulling into traffic. Try to plan calls when your car will be stationary. If you need to make a call, dial only a few numbers, check the road and your mirrors, then continue. Do not engage in stressful or emotional conversations that may be distracting. Make people you are talking with aware you are driving and suspend conversations that have the potential to divert your attention from the road. Use your device to call for help. Dial a local emergency number in the case of fire, traffic accident, or medical emergencies. Use your device to help others in emergencies. If you see an auto accident, a crime in progress, or a serious emergency where lives are in danger, call a local emergency number. Call roadside assistance or a special, non-emergency assistance number when necessary. If you see a broken-down vehicle posing no serious hazard, a broken traffic signal, a minor traffic accident where no one appears injured, or a vehicle you know to be stolen, call roadside assistance or another special, non-emergency number. Proper care and use of your mobile device Keep your device dry Humidity and all types of liquids may damage device parts or electronic circuits. Do not turn on your device if it is wet. If your device is already on, turn it off and remove the battery immediately (if the device will not turn off or you cannot remove the battery, leave it as-is). Then, dry the device with a towel and take it to a service centre. Liquids will change the colour of the label that indicates water damage inside the device. Water damage to your device can void your manufacturers warranty. Safety precautions 139 Do not use or store your device in dusty, dirty areas Dust can cause your device to malfunction. Do not store your device on slopes If your device falls, it can be damaged. Do not store your device in hot or cold areas. Use your device at
-20 C to 45 C Your device can explode if left inside a closed vehicle, as the inside temperature can reach up to 80 C. Do not expose your device to direct sunlight for extended periods of time
(such as on the dashboard of a car). Store the battery at -20 C to 45 C. Do not store your device with such metal objects as coins, keys and necklaces Your device may become deformed or malfunction. Do not store your device near magnetic fields Your device may malfunction or the battery may discharge from exposure to magnetic fields. Magnetic stripe cards, including credit cards, phone cards, passbooks, and boarding passes, may be damaged by magnetic fields. Do not use carrying cases or accessories with magnetic closures or allow your device to come in contact with magnetic fields for extended periods of time. Do not store your device near or in heaters, microwaves, hot cooking equipment, or high pressure containers The battery may leak. Your device may overheat and cause a fire. Do not drop your device or cause impacts to your device The screen of your device may be damaged. If bent or deformed, your device may be damaged or parts may malfunction. Do not use your device or applications for a while if the device is overheated Prolonged exposure of your skin to an overheated device may cause low temperature burn symptoms, such as red spots and pigmentation. Safety precautions 140 If your device has a camera flash or light, do not use a flash close to the eyes of people or pets Using a flash close to the eyes may cause temporary loss of vision or damage to the eyes. Use caution when exposed to flashing lights While using your device, leave some lights on in the room and do not hold the screen too close to your eyes. Seizures or blackouts can occur when you are exposed to flashing lights while watching videos or playing Flash-based games for extended periods. If you feel any discomfort, stop using the device immediately. Reduce the risk of repetitive motion injuries When you repetitively perform actions, such as pressing keys, drawing characters on a touch screen with your fingers, or playing games, you may experience occasional discomfort in your hands, neck, shoulders, or other parts of your body. When using your device for extended periods, hold the device with a relaxed grip, press the keys lightly, and take frequent breaks. If you continue to have discomfort during or after such use, stop use and see a physician. Ensure maximum battery and charger life Avoid charging batteries for more than a week, as overcharging may shorten battery life. Over time, unused batteries will discharge and must be recharged before use. Disconnect chargers from power sources when not in use. Use manufacturer-approved batteries, chargers, accessories and supplies Using generic batteries or chargers may shorten the life of your device or cause the device to malfunction. Samsung cannot be responsible for the users safety when using accessories or supplies that are not approved by Samsung. Do not bite or suck on the device Doing so may damage the device or cause explosion. If children use the device, make sure that they use the device properly. When using the device:
Hold the device upright, as you would with a traditional phone. Speak directly into the mouthpiece. Safety precautions 141 Avoid contact with your devices internal antenna. Protect your hearing and ears when using a headset Excessive exposure to loud sounds can cause hearing damage. Exposure to loud sounds while driving may distract your attention and cause an accident. Always turn the volume down before plugging the earphones into an audio source and use only the minimum volume setting necessary to hear your conversation or music. In dry environments, static electricity can build up in the headset. Avoid using headsets in dry environments or touch a metal object to discharge static electricity before connecting a headset to the device. Use caution when using the device while walking or moving Always be aware of your surroundings to avoid injury to yourself or others. Do not carry your device in your back pockets or around your waist You can be injured or damage the device if you fall. Do not disassemble, modify, or repair your device Any changes or modifications to your device can void your manufacturers warranty. For service, take your device to a Samsung Service Centre. Do not paint or put stickers on your device Paint and stickers can clog moving parts and prevent proper operation. If you are allergic to paint or metal parts of the product, you may experience itching, eczema, or swelling of the skin. When this happens, stop using the product and consult your physician. When cleaning your device:
Wipe your device or charger with a towel or a rubber. Do not use chemicals or detergents. Do not use the device if the screen is cracked or broken Broken glass or acrylic could cause injury to your hands and face. Take the device to a Samsung Service Centre to have it repaired. Safety precautions 142 Do not use the device for anything other than its intended use Avoid disturbing others when using the device in public Do not allow children to use your device Your device is not a toy. Do not allow children to play with it as they could hurt themselves and others, or damage the device. Install mobile devices and equipment with caution Ensure that any mobile devices or related equipment installed in your vehicle are securely mounted. Avoid placing your device and accessories near or in an air bag deployment area. Improperly installed wireless equipment can cause serious injury when air bags inflate rapidly. Allow only qualified personnel to service your device Allowing unqualified personnel to service your device may result in damage to your device and will void your manufacturers warranty. Handle SIM cards or memory cards with care Do not remove a card while the device is transferring or accessing information, as this could result in loss of data and/or damage to the card or device. Protect cards from strong shocks, static electricity, and electrical noise from other devices. Do not touch gold-coloured contacts or terminals with your fingers or metal objects. If dirty, wipe the card with a soft cloth. Ensure access to emergency services Emergency calls from your device may not be possible in some areas or circumstances. Before travelling in remote or undeveloped areas, plan an alternate method of contacting emergency services personnel. Safety precautions 143 Correct disposal of this product
(Waste Electrical & Electronic Equipment)
(Applicable in the European Union and other European countries with separate collection systems) This marking on the product, accessories or literature indicates that the product and its electronic accessories (e.g. charger, headset, USB cable) should not be disposed of with other household waste at the end of their working life. To prevent possible harm to the environment or human health from uncontrolled waste disposal, please separate these items from other types of waste and recycle them responsibly to promote the sustainable reuse of material resources. Household users should contact either the retailer where they purchased this product, or their local government office, for details of where and how they can take these items for environmentally safe recycling. Business users should contact their supplier and check the terms and conditions of the purchase contract. This product and its electronic accessories should not be mixed with other commercial wastes for disposal. This EEE is compliant with RoHS. Correct disposal of batteries in this product
(Applicable in the European Union and other European countries with separate battery return systems) The marking on the battery, manual or packaging indicates that the battery in this product should not be disposed of with other household waste. Where marked, the chemical symbols Hg, Cd or Pb indicate that the battery contains mercury, cadmium or lead above the reference levels in EC Directive 2006/66. The battery incorporated in this product is not user replaceable. For information on its replacement, please contact your service provider. Do not attempt to remove the battery or dispose it in a fire. Do not disassemble, crush, or puncture the battery. If you intend to discard the product, the waste collection site will take the appropriate measures for the recycling and treatment of the product, including the battery. Safety precautions 145 Disclaimer Some content and services accessible through this device belong to third parties and are protected by copyright, patent, trademark and/or other intellectual property laws. Such content and services are provided solely for your personal noncommercial use. You may not use any content or services in a manner that has not been authorised by the content owner or service provider. Without limiting the foregoing, unless expressly authorised by the applicable content owner or service provider, you may not modify, copy, republish, upload, post, transmit, translate, sell, create derivative works, exploit, or distribute in any manner or medium any content or services displayed through this device. THIRD PARTY CONTENT AND SERVICES ARE PROVIDED AS IS. SAMSUNG DOES NOT WARRANT CONTENT OR SERVICES SO PROVIDED, EITHER EXPRESSLY OR IMPLIEDLY, FOR ANY PURPOSE. SAMSUNG EXPRESSLY DISCLAIMS ANY IMPLIED WARRANTIES, INCLUDING BUT NOT LIMITED TO, WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. SAMSUNG DOES NOT GUARANTEE THE ACCURACY, VALIDITY, TIMELINESS, LEGALITY, OR COMPLETENESS OF ANY CONTENT OR SERVICE MADE AVAILABLE THROUGH THIS DEVICE AND UNDER NO CIRCUMSTANCES, INCLUDING NEGLIGENCE, SHALL SAMSUNG BE LIABLE, WHETHER IN CONTRACT OR TORT, FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL OR CONSEQUENTIAL DAMAGES, ATTORNEY FEES, EXPENSES, OR ANY OTHER DAMAGES ARISING OUT OF, OR IN CONNECTION WITH, ANY INFORMATION CONTAINED IN, OR AS A RESULT OF THE USE OF ANY CONTENT OR SERVICE BY YOU OR ANY THIRD PARTY, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. Third party services may be terminated or interrupted at any time, and Samsung makes no representation or warranty that any content or service will remain available for any period of time. Content and services are transmitted by third parties by means of networks and transmission facilities over which Samsung has no control. Without limiting the generality of this disclaimer, Samsung expressly disclaims any responsibility or liability for any interruption or suspension of any content or service made available through this device. Samsung is neither responsible nor liable for customer service related to the content and services. Any question or request for service relating to the content or services should be made directly to the respective content and service providers. Safety precautions 146 Index access codes 131 alarms creating 104 deactivating 104 stopping 104 AllShare 96 application list accessing 29 auto rejection 56 battery charging 12 Bluetooth activating 94 finding and pairing with devices 94 receiving data 95 sending data 95 brightness, display 32 calendar creating events 86 viewing events 86 call forwarding 57 call log 58 calls answering 53 forwarding 57 international numbers 53 multiparty 54 rejecting 53 using headset 53 using options during voice 54 viewing missed 55 waiting 57 call waiting 57 camera customising camcorder 76 customising camera 73 recording videos 74 connections Bluetooth 93 PC 88 TV 101 VPN 102 WLAN 90 contacts copying 84 creating 82 importing or exporting 83 retrieving 83 device customising 30 indicator icons 21 keys 20 layout 18 notification panel 28 settings 114 turning on or off 17 download manager 105 eBook 105 importing 106 Index 147 email sending 62 viewing 63 file manager copying or cutting files 109 deleting files 109 opening files 108 supported file formats 107 find my mobile 34 fixed dialling number mode 56 Google Mail 60 Google Maps 47 Google Talk 64 home screen adding items 27 moving items 27 removing items 28 internet see web browser language 125 market 46 memory card formatting 16 inserting 14 removing 16 memos creating 87 viewing 87 messages sending email 62 sending multimedia 59 sending text 58 setting email accounts 62 multimedia messages sending 59 viewing 59 music player adding files 66 creating playlists 68 playing music 67 PC connections mass storage 89 Samsung Kies 88 Windows Media Player 89 phonebook creating contacts 82 finding contacts 83 photo editor 81 photos capturing 69 capturing by scene 71 viewing 79 PIN lock 33 Polaris Office 110 Pulse 45 Samsung Apps 51 Samsung Kies 88 settings about device 130 accessibility 129 accounts and sync 123 applications 122 call 116 date and time 130 language and input 125 Index 148 videos capturing 74 playing 78, 80 voice calls answering 53 making 52 using options 54 voice search 112 VPN connections connecting to 103 creating 102 web browser adding bookmarks 44 browsing web pages 41 opening multiple pages 43 searching for information by voice 43 WLAN activating 90 finding and connecting to networks 90 using WPS 91 world clock 113 YouTube 47 uploading videos 47 watching videos 47 location and security 120 motion 124 power saving mode 120 privacy 124 screen 119 sound 118 storage 124 wireless and networks 114 silent mode 30 SIM card installing 12 locking 33 sketch memo 109 SmartRemote 101 task manager 112 text input 35 text memos 87 text messages sending 58 viewing 59 time and date, set 30 touch screen locking 25 using 23 unpack 11 USIM card installing 12 locking 33 vedio player 78 video calls answering 53 using options 55 Index 149 Health and safety information Exposure to Radio Frequency (RF) Signals Certification Information (SAR)
<RXUZLUHOHVVSKRQHLVDUDGLRWUDQVPLWWHUDQGUHFHLYHU,WLVGHVLJQHGDQG
PDQXIDFWXUHGQRWWRH[FHHGWKHH[SRVXUHOLPLWVIRUUDGLRIUHTXHQF\5)
HQHUJ\VHWE\WKH)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&RIWKH86
JRYHUQPHQW7KHVH)&&H[SRVXUHOLPLWVDUHGHULYHGIURPWKH
UHFRPPHQGDWLRQVRIWZRH[SHUWRUJDQL]DWLRQVWKH1DWLRQDO&RXQVHORQ
5DGLDWLRQ3URWHFWLRQDQG0HDVXUHPHQW1&53DQGWKH,QVWLWXWHRI
(OHFWULFDODQG(OHFWURQLFV(QJLQHHUV,(((,QERWKFDVHVWKH
UHFRPPHQGDWLRQVZHUHGHYHORSHGE\VFLHQWLILFDQGHQJLQHHULQJH[SHUWV
GUDZQIURPLQGXVWU\JRYHUQPHQWDQGDFDGHPLDDIWHUH[WHQVLYHUHYLHZV
RIWKHVFLHQWLILFOLWHUDWXUHUHODWHGWRWKHELRORJLFDOHIIHFWVRI5)HQHUJ\
7KHH[SRVXUHOLPLWVHWE\WKH)&&IRUZLUHOHVVPRELOHSKRQHVHPSOR\VD
XQLWRIPHDVXUHPHQWNQRZQDVWKH6SHFLILF$EVRUSWLRQ5DWH6$57KH
6$5LVDPHDVXUHRIWKHUDWHRIDEVRUSWLRQRI5)HQHUJ\E\WKHKXPDQ
ERG\H[SUHVVHGLQXQLWVRIZDWWVSHUNLORJUDP:NJ7KH)&&UHTXLUHV
ZLUHOHVVSKRQHVWRFRPSO\ZLWKDVDIHW\OLPLWRIZDWWVSHUNLORJUDP
:NJ7KH)&&H[SRVXUHOLPLWLQFRUSRUDWHVDVXEVWDQWLDOPDUJLQRI
VDIHW\WRJLYHDGGLWLRQDOSURWHFWLRQWRWKHSXEOLFDQGWRDFFRXQWIRUDQ\
YDULDWLRQVLQPHDVXUHPHQWV
6$5WHVWVDUHFRQGXFWHGXVLQJVWDQGDUGRSHUDWLQJSRVLWLRQVDFFHSWHGE\
WKH)&&ZLWKWKHSKRQHWUDQVPLWWLQJDWLWVKLJKHVWFHUWLILHGSRZHUOHYHOLQ
DOOWHVWHGIUHTXHQF\EDQGV$OWKRXJKWKH6$5LVGHWHUPLQHGDWWKHKLJKHVW
FHUWLILHGSRZHUOHYHOWKHDFWXDO6$5OHYHORIWKHSKRQHZKLOHRSHUDWLQJ
FDQEHZHOOEHORZWKHPD[LPXPYDOXH7KLVLVEHFDXVHWKHSKRQHLV
GHVLJQHGWRRSHUDWHDWPXOWLSOHSRZHUOHYHOVVRDVWRXVHRQO\WKHSRZHU
UHTXLUHGWRUHDFKWKHQHWZRUN,QJHQHUDOWKHFORVHU\RXDUHWRDZLUHOHVV
EDVHVWDWLRQDQWHQQDWKHORZHUWKHSRZHURXWSXW
%HIRUHDQHZPRGHOSKRQHLVDYDLODEOHIRUVDOHWRWKHSXEOLFLWPXVWEH
WHVWHGDQGFHUWLILHGWRWKH)&&WKDWLWGRHVQRWH[FHHGWKHH[SRVXUHOLPLW
HVWDEOLVKHGE\WKH)&&7HVWVIRUHDFKPRGHOSKRQHDUHSHUIRUPHGLQ
SRVLWLRQVDQGORFDWLRQVHJDWWKHHDUDQGZRUQRQWKHERG\DVUHTXLUHG
E\WKH)&&
)RUERG\ZRUQRSHUDWLRQWKLVPRGHOSKRQHKDVEHHQWHVWHGDQGPHHWV
WKH)&&5)H[SRVXUHJXLGHOLQHVZKHQXVHGZLWKD6DPVXQJDFFHVVRU\
GHVLJQDWHGIRUWKLVSURGXFWRUZKHQXVHGZLWKDQDFFHVVRU\WKDWFRQWDLQV
QRPHWDODQGWKDWSRVLWLRQVWKHKDQGVHWDPLQLPXPRIFPIURPWKH
ERG\
1RQFRPSOLDQFHZLWKWKHDERYHUHVWULFWLRQVPD\UHVXOWLQYLRODWLRQRI)&&
5)H[SRVXUHJXLGHOLQHV
6$5LQIRUPDWLRQRQWKLVDQGRWKHUPRGHOSKRQHVFDQEHYLHZHGRQOLQHDW
3OHDVHXVHWKHSKRQH)&&,'QXPEHUIRU
VHDUFK$/*73%6RPHWLPHVLWPD\EHQHFHVVDU\WRUHPRYHWKH
EDWWHU\SDFNWRILQGWKHQXPEHU2QFH\RXKDYHWKH)&&,'QXPEHUIRUD
SDUWLFXODUSKRQHIROORZWKHLQVWUXFWLRQVRQWKHZHEVLWHDQGLWVKRXOG
SURYLGHYDOXHVIRUW\SLFDORUPD[LPXP6$5IRUDSDUWLFXODUSKRQH
$GGLWLRQDOSURGXFWVSHFLILF6$5LQIRUPDWLRQFDQDOVREHREWDLQHGDW
ZZZIFFJRYFJEVDU
FCC Notice and Cautions
FCC Notice
7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&5XOHV2SHUDWLRQLV
VXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQVWKLVGHYLFHPD\QRWFDXVH
KDUPIXOLQWHUIHUHQFHDQGWKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFH
UHFHLYHGLQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ
z 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKH
OLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQWWRSDUWRIWKH)&&
5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOHSURWHFWLRQ
DJDLQVWKDUPIXOLQWHUIHUHQFHLQDUHVLGHQWLDOLQVWDOODWLRQ7KLV
HTXLSPHQWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLRIUHTXHQF\HQHUJ\
DQGLIQRWLQVWDOOHGDQGXVHGLQDFFRUGDQFHZLWKWKHLQVWUXFWLRQV
PD\FDXVHKDUPIXOLQWHUIHUHQFHWRUDGLRFRPPXQLFDWLRQV+RZHYHU
WKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFHZLOOQRWRFFXULQDSDUWLFXODU
LQVWDOODWLRQ,IWKLVHTXLSPHQWGRHVFDXVHKDUPIXOLQWHUIHUHQFHWR
UDGLRRUWHOHYLVLRQUHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\WXUQLQJ
WKHHTXLSPHQWRIIDQGRQWKHXVHULVHQFRXUDJHGWRWU\WRFRUUHFW
WKHLQWHUIHUHQFHE\RQHRUPRUHRIWKHIROORZLQJPHDVXUHV
5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD
,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQGUHFHLYHU
&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLWGLIIHUHQWIURPWKDWWR
ZKLFKWKHUHFHLYHULVFRQQHFWHG
&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79WHFKQLFLDQIRUKHOS
7KHSKRQHPD\FDXVH79RUUDGLRLQWHUIHUHQFHLIXVHGLQFORVHSUR[LPLW\
WRUHFHLYLQJHTXLSPHQW7KH)&&FDQUHTXLUH\RXWRVWRSXVLQJWKHSKRQH
LIVXFKLQWHUIHUHQFHFDQQRWEHHOLPLQDWHG
9HKLFOHVXVLQJOLTXHILHGSHWUROHXPJDVVXFKDVSURSDQHRUEXWDQHPXVW
FRPSO\ZLWKWKH1DWLRQDO)LUH3URWHFWLRQ6WDQGDUG1)3$)RUDFRS\
RIWKLVVWDQGDUGFRQWDFWWKH1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ2QH
%DWWHU\PDUFK3DUN4XLQF\0$$WWQ3XEOLFDWLRQ6DOHV'LYLVLRQ
Cautions
&KDQJHVRUPRGLILFDWLRQVPDGHLQWKHUDGLRSKRQHQRWH[SUHVVO\
DSSURYHGE\6DPVXQJZLOOYRLGWKHXVHUVDXWKRULW\WRRSHUDWHWKH
HTXLSPHQW
7KHXVHRIDQ\XQDXWKRUL]HGDFFHVVRULHVPD\EHGDQJHURXVDQGYRLGWKH
SKRQHZDUUDQW\LIVDLGDFFHVVRULHVFDXVHGDPDJHRUDGHIHFWWRWKHSKRQH
$OWKRXJK\RXUSKRQHLVTXLWHVWXUG\LWLVDFRPSOH[SLHFHRIHTXLSPHQW
DQGFDQEHEURNHQ$YRLGGURSSLQJKLWWLQJEHQGLQJRUVLWWLQJRQLW
Declaration of Conformity (R&TTE) We, declare under our sole responsibility that the product Samsung Electronics Portable GSM WCDMA Wi-Fi Device : GT-P00 to which this declaration relates, is in conformity with the following standards and/or other normative documents. SAFETY SAR EMC RADIO
We hereby declare that [all essential radio test suites have been carried out and that] the above named product is in conformity to all the essential requirements of Directive 1999/5/EC. The conformity assessment procedure referred to in Article 10 and detailed in Annex[IV] of Directive 1999/5/EC has been followed with the involvement of the following Notified Body(ies):
BABT, Forsyth House, Churchfield Road, Walton-on-Thames, Surrey, KT12 2TD, UK*
Identification mark: 0168 The technical documentation kept at :
Samsung Electronics QA Lab. which will be made available upon request.
(Representative in the EU) Samsung Electronics Euro QA Lab. Blackbushe Business Park, Saxony Way, Yateley, Hampshire, GU46 6GG, UK*
2011. 10.11
(place and date of issue) Joong-Hoon Choi / Lab Manager
(name and signature of authorised person)
* It is not the address of Samsung Service Centre. For the address or the phone number of Samsung Service Centre, see the warranty card or contact the retailer where you purchased your product.
frequency | equipment class | purpose | ||
---|---|---|---|---|
1 | 2012-05-08 | 2412 ~ 2462 | DTS - Digital Transmission System | Original Equipment |
2 | 1852.4 ~ 1907.6 | PCE - PCS Licensed Transmitter held to ear | ||
3 | 2402 ~ 2480 | DSS - Part 15 Spread Spectrum Transmitter | ||
4 | JBP - Part 15 Class B Computing Device Peripheral |
app s | Applicant Information | |||||
---|---|---|---|---|---|---|
1 2 3 4 | Effective |
2012-05-08
|
||||
1 2 3 4 | Applicant's complete, legal business name |
Samsung Electronics Co Ltd
|
||||
1 2 3 4 | FCC Registration Number (FRN) |
0027908797
|
||||
1 2 3 4 | Physical Address |
19 Chapin Rd., Building D
|
||||
1 2 3 4 |
Pine Brook, NJ
|
|||||
1 2 3 4 |
United States
|
|||||
app s | TCB Information | |||||
1 2 3 4 | TCB Application Email Address |
c******@ccsemc.com
|
||||
1 2 3 4 | TCB Scope |
A4: UNII devices & low power transmitters using spread spectrum techniques
|
||||
1 2 3 4 |
B1: Commercial mobile radio services equipment in the following 47 CFR Parts 20, 22 (cellular), 24,25 (below 3 GHz) & 27
|
|||||
1 2 3 4 |
A1: Low Power Transmitters below 1 GHz (except Spread Spectrum), Unintentional Radiators, EAS (Part 11) & Consumer ISM devices
|
|||||
app s | FCC ID | |||||
1 2 3 4 | Grantee Code |
A3L
|
||||
1 2 3 4 | Equipment Product Code |
GTP3100B
|
||||
app s | Person at the applicant's address to receive grant or for contact | |||||
1 2 3 4 | Name |
J******** C********
|
||||
1 2 3 4 | Title |
General Manager
|
||||
1 2 3 4 | Telephone Number |
973-8********
|
||||
1 2 3 4 | Fax Number |
973-8********
|
||||
1 2 3 4 |
j******@samsung.com
|
|||||
app s | Technical Contact | |||||
1 2 3 4 | Firm Name |
Compliance Certification Services
|
||||
1 2 3 4 | Name |
A****** Z****
|
||||
1 2 3 4 | Physical Address |
47173 Benicia Street
|
||||
1 2 3 4 |
Fremont, California 94538
|
|||||
1 2 3 4 | Telephone Number |
(510)********
|
||||
1 2 3 4 | Fax Number |
(510)********
|
||||
1 2 3 4 |
a******@ccsemc.com
|
|||||
app s | Non Technical Contact | |||||
1 2 3 4 | Firm Name |
Compliance Certification Services
|
||||
1 2 3 4 | Name |
A******** Z******
|
||||
1 2 3 4 | Physical Address |
47173 Benicia Street
|
||||
1 2 3 4 |
Fremont, California 94538
|
|||||
1 2 3 4 | Telephone Number |
(510)********
|
||||
1 2 3 4 | Fax Number |
(510)********
|
||||
1 2 3 4 |
a******@ccsemc.com
|
|||||
app s | Confidentiality (long or short term) | |||||
1 2 3 4 | Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 4 | Long-Term Confidentiality Does this application include a request for confidentiality for any portion(s) of the data contained in this application pursuant to 47 CFR § 0.459 of the Commission Rules?: | Yes | ||||
1 2 3 4 | If so, specify the short-term confidentiality release date (MM/DD/YYYY format) | 10/20/2012 | ||||
if no date is supplied, the release date will be set to 45 calendar days past the date of grant. | ||||||
app s | Cognitive Radio & Software Defined Radio, Class, etc | |||||
1 2 3 4 | Is this application for software defined/cognitive radio authorization? | No | ||||
1 2 3 4 | Equipment Class | DTS - Digital Transmission System | ||||
1 2 3 4 | PCE - PCS Licensed Transmitter held to ear | |||||
1 2 3 4 | DSS - Part 15 Spread Spectrum Transmitter | |||||
1 2 3 4 | JBP - Part 15 Class B Computing Device Peripheral | |||||
1 2 3 4 | Description of product as it is marketed: (NOTE: This text will appear below the equipment class on the grant) | Tablet with GSM/GPRS/EDGE/WCDMA,802.11bgn,BT3.0 | ||||
1 2 3 4 | Related OET KnowledgeDataBase Inquiry: Is there a KDB inquiry associated with this application? | No | ||||
1 2 3 4 | Yes | |||||
1 2 3 4 | Modular Equipment Type | Does not apply | ||||
1 2 3 4 | Purpose / Application is for | Original Equipment | ||||
1 2 3 4 | Composite Equipment: Is the equipment in this application a composite device subject to an additional equipment authorization? | Yes | ||||
1 2 3 4 | Related Equipment: Is the equipment in this application part of a system that operates with, or is marketed with, another device that requires an equipment authorization? | No | ||||
1 2 3 4 | Grant Comments | Power output is conducted. This device is authorized to operate with the specific tablet described in this filing, and must not operate in conjunction with any other antenna or transmitter except as documented in filings under this FCC ID and/or in accordance with FCC multi-transmitter product guidelines. End-users must be provided with operating conditions for satisfying RF exposure compliance. The highest reported SAR values for head, body, device specific (wireless hotspot) and simultaneous transmission use conditions are 0.05 W/kg, 0.56 W/kg, 0.56 W/kg, and 1.32 W/kg, respectively. | ||||
1 2 3 4 | Power output listed is ERP for Part 22 and EIRP for Part 24. This device is authorized to operate with the specific tablet described in this filing, and must not operate in conjunction with any other antenna or transmitter except as documented in filings under this FCC ID and/or in accordance with FCC multi-transmitter product guidelines. End-users must be provided with operating conditions for satisfying RF exposure compliance. The highest reported SAR values for head, body, device specific (wireless hotspot), and simultaneous transmission use conditions are 0.69 W/kg, 0.79 W/kg, 0.79 W/kg, and 1.32 W/kg, respectively. This device also contains functions that are not operational in U.S. Territories. This filing is only applicable for US operations. Note: Device must operate with the power reduction mechanisms tested in this filing. | |||||
1 2 3 4 | Output power listed is conducted. | |||||
1 2 3 4 | Is there an equipment authorization waiver associated with this application? | No | ||||
1 2 3 4 | If there is an equipment authorization waiver associated with this application, has the associated waiver been approved and all information uploaded? | No | ||||
app s | Test Firm Name and Contact Information | |||||
1 2 3 4 | Firm Name |
Compliance Certification Services (UL CCS)
|
||||
1 2 3 4 | Name |
B****** J****
|
||||
1 2 3 4 | Telephone Number |
510-7********
|
||||
1 2 3 4 | Fax Number |
510-6********
|
||||
1 2 3 4 |
b******@ccsemc.com
|
|||||
Equipment Specifications | |||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
1 | 1 | 15C | CC | 2412 | 2462 | 0.0743 | |||||||||||||||||||||||||||||||||||
1 | 2 | 15C | CC | 2412 | 2462 | 0.06839 | |||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
2 | 1 | 22H | 824.2 | 848.8 | 0.6887 | 2.5 ppm | 248KGXW | ||||||||||||||||||||||||||||||||||
2 | 2 | 22H | 826.4 | 846.6 | 0.2767 | 2.5 ppm | 4M16F9W | ||||||||||||||||||||||||||||||||||
2 | 3 | 24E | 1850.2 | 1909.8 | 1.3213 | 2.5 ppm | 247KGXW | ||||||||||||||||||||||||||||||||||
2 | 4 | 24E | 1852.4 | 1907.6 | 0.9616 | 2.5 ppm | 4M13F9W | ||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
3 | 1 | 15C | CC | 2402.00000000 | 2480.00000000 | 0.0165600 | |||||||||||||||||||||||||||||||||||
Line | Rule Parts | Grant Notes | Lower Frequency | Upper Frequency | Power Output | Tolerance | Emission Designator | Microprocessor Number | |||||||||||||||||||||||||||||||||
4 | 1 | 15B |
some individual PII (Personally Identifiable Information) available on the public forms may be redacted, original source may include additional details
This product uses the FCC Data API but is not endorsed or certified by the FCC