FCC ID: A3LSPHL710T Portable Handset with Multi-Band CDMA/LTE, WLAN, Bluetooth and RFID

 

Sprint_H_IIB_.book Page 1 Friday, September 6, 2013 5:08 PM Sprint_H_IIB_.book Page 2 Friday, September 6, 2013 5:08 PM rights secured by the Intellectual Property. Moreover, you agree that you will not (and will not attempt to) modify, prepare derivative works of, reverse engineer, decompile, disassemble, or otherwise attempt to create source code from the software. No title to or ownership in the Intellectual Property is transferred to you. All applicable rights of the Intellectual Property shall remain with SAMSUNG and its suppliers. Intellectual Property All Intellectual Property, as defined below, owned by or which is otherwise the property of Samsung or its respective suppliers relating to the SAMSUNG Phone, including but not limited to, accessories, parts, or software relating there to (the Phone System), is proprietary to Samsung and protected under federal laws, state laws, and international treaty provisions. Intellectual Property includes, but is not limited to, inventions (patentable or unpatentable), patents, trade secrets, copyrights, software, computer programs, and related documentation and other works of authorship. You may not infringe or otherwise violate the 2 Sprint_H_IIB_.book Page 3 Friday, September 6, 2013 5:08 PM Open Source Software Some software components of this product incorporate source code covered under GNU General Public License (GPL), GNU Lesser General Public License (LGPL), OpenSSL License, BSD License and other open source licenses. To obtain the source code covered under the open source licenses, please visit:

http://opensource.samsung.com. Disclaimer of Warranties; Exclusion of Liability EXCEPT AS SET FORTH IN THE EXPRESS WARRANTY CONTAINED ON THE WARRANTY PAGE ENCLOSED WITH THE PRODUCT, THE PURCHASER TAKES THE PRODUCT "AS IS", AND SAMSUNG MAKES NO EXPRESS OR IMPLIED WARRANTY OF ANY KIND WHATSOEVER WITH RESPECT TO THE PRODUCT, INCLUDING BUT NOT LIMITED TO THE MERCHANTABILITY OF THE PRODUCT OR ITS FITNESS FOR ANY PARTICULAR PURPOSE OR USE; THE DESIGN, CONDITION OR QUALITY OF THE PRODUCT; THE PERFORMANCE OF THE 3 Sprint_H_IIB_.book Page 4 Friday, September 6, 2013 5:08 PM PRODUCT; THE WORKMANSHIP OF THE PRODUCT OR THE COMPONENTS CONTAINED THEREIN; OR COMPLIANCE OF THE PRODUCT WITH THE REQUIREMENTS OF ANY LAW, RULE, SPECIFICATION OR CONTRACT PERTAINING THERETO. NOTHING CONTAINED IN THE INSTRUCTION MANUAL SHALL BE CONSTRUED TO CREATE AN EXPRESS OR IMPLIED WARRANTY OF ANY KIND WHATSOEVER WITH RESPECT TO THE PRODUCT. IN ADDITION, SAMSUNG SHALL NOT BE LIABLE FOR ANY DAMAGES OF ANY KIND RESULTING FROM THE PURCHASE OR USE OF THE PRODUCT OR ARISING FROM THE BREACH OF THE EXPRESS WARRANTY, INCLUDING INCIDENTAL, SPECIAL OR CONSEQUENTIAL DAMAGES, OR LOSS OF ANTICIPATED PROFITS OR BENEFITS. Modification of Software SAMSUNG IS NOT LIABLE FOR PERFORMANCE ISSUES OR INCOMPATIBILITIES CAUSED BY YOUR EDITING OF REGISTRY SETTINGS, OR YOUR MODIFICATION OF OPERATING SYSTEM SOFTWARE. USING CUSTOM OPERATING SYSTEM SOFTWARE MAY CAUSE YOUR DEVICE AND APPLICATIONS TO WORK IMPROPERLY. YOUR CARRIER MAY NOT PERMIT USERS TO DOWNLOAD CERTAIN SOFTWARE, SUCH AS CUSTOM OS. 4 Sprint_H_IIB_.book Page 5 Friday, September 6, 2013 5:08 PM SAFE (Samsung Approved For Enterprise) SAFE: "SAFE" (Samsung for Enterprise) is a mark for a Samsung device which has been tested against Samsung's own internal criteria for interoperability with certain third party security-related solutions for MDM and VPN. The testing includes field testing with local network connection and menu tree testing which tests functionality of the solutions in conjunction with the Samsung device. During the testing, the device is tested with the security solutions to see if the solutions work with the device as described by the third party security solution providers. The testing, for example, includes field testing with local network connection and menu tree testing which tests functionality of the solutions in conjunction with the Samsung device. For more information about Samsung's SAFE program, please refer to www.samsung.com/us/safe. Disclaimer of Warranties: EXCEPT AS OTHERWISE PROVIDED IN THEIR STANDARD END USER LICENSE AND WARRANTY, TO THE FULL EXTENT PERMITTED BY LAW SAMSUNG ELECTRONICS CO., LTD., SAMSUNG TELECOMMUNICATIONS AMERICA, LLC, AND THEIR AFFILIATES

(COLLECTIVELY REFERRED TO HEREIN AS THE "SAMSUNG ENTITIES") EXPRESSLY DISCLAIM ANY AND ALL WARRANTIES, EXPRESS OR IMPLIED, INCLUDING ANY 5 Sprint_H_IIB_.book Page 6 Friday, September 6, 2013 5:08 PM WARRANTY OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE, INTEROPERABILITY OR NON-INFRINGEMENT, WITH RESPECT TO INFORMATION TECHNOLOGY SECURITY PROTECTION, SAFE DEVICES AND APPLICATIONS TESTED WITH SAFE DEVICES. IN NO EVENT SHALL THE SAMSUNG ENTITIES BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, PUNITIVE, OR CONSEQUENTIAL DAMAGES OF ANY KIND WHATSOEVER WITH RESPECT TO INFORMATION TECHNOLOGY SECURITY PROTECTION, SAFE DEVICES OR APPLICATIONS TESTED WITH SAFE DEVICES. In addition, information technology security protection will be affected by features or functionality associated with, among other things the e-mail platform, master data management, and virtual private network solutions selected by the software provider, solution provider or user. Choice of an e-mail, master data management, and virtual private network solution is at the sole discretion of the software provider, solution provider or user and any associated effect on information technology security protection is solely the responsibility of the software provider, solution provider or user. For complete statement of limited warranty, please refer to www.samsung.com/us/safe, available on the web and where Samsung smartphone and Galaxy Tab devices are sold.

[101212]

6 Sprint_H_IIB_.book Page 7 Friday, September 6, 2013 5:08 PM 2013 Samsung Telecommunications America, LLC. Samsung is a registered trademark of Samsung Electronics Co., Ltd. Do you have questions about your Samsung Mobile Device?

For 24 hour information and assistance, we offer a new FAQ/ARS System (Automated Response System) at:

www.samsung.com/us/support Samsung Telecommunications America

(STA), LLC Headquarters:

1301 E. Lookout Drive Richardson, TX 75082 Customer Care Center:

1000 Klein Rd. Plano, TX 75074 Toll Free Tel: 1.888.987.HELP (4357) Internet Address:

http://www.samsung.com 7 Sprint_H_IIB_.book Page 8 Friday, September 6, 2013 5:08 PM Important Safety Information This device is capable of operating in Wi-Fi mode in the 2.4 and 5 GHz bands. The FCC requires that devices operating within 5.15-

5.25 GHz may only be used indoors, not outside, in order to avoid interference with Mobile Satellite Services (MSS). Therefore, this device is restricted from being used outdoors when operating in frequencies between 5.15-

5.25 GHz. This section outlines the safety precautions associated with using your phone. The terms mobile device or cell phone are used in this section to refer to your phone. Read this information before using your mobile device. Exposure to Radio Frequency (RF) Signals The U.S. Food and Drug Administration (FDA) has published information for consumers relating to Radio Frequency (RF) exposure from wireless phones. The FDA publication includes the following information:

Do cell phones pose a health hazard?

Many people are concerned that cell phone radiation will cause cancer or other serious health hazards. The weight of scientific 8 Important Safety Information Sprint_H_IIB_.book Page 9 Friday, September 6, 2013 5:08 PM evidence has not linked cell phones with any health problems. Cell phones emit low levels of Radio Frequency

(RF) energy. Over the past 15 years, scientists have conducted hundreds of studies looking at the biological effects of the radio frequency energy emitted by cell phones. While some researchers have reported biological changes associated with RF energy, these studies have failed to be replicated. The majority of studies published have failed to show an association between exposure to radio frequency from a cell phone and health problems. The low levels of RF cell phones emit while in use are in the microwave frequency range. They also emit RF at substantially reduced time intervals when in the stand-by mode. Whereas high levels of RF can produce health effects (by heating tissue), exposure to low level RF that does not produce heating effects causes no known adverse health effects. The biological effects of radio frequency energy should not be confused with the effects from other types of electromagnetic energy. Very high levels of electromagnetic energy, such as is found in X-rays and gamma rays, can ionize biological tissues. Ionization is a process where electrons are stripped away from their normal locations in atoms and molecules. Important Safety Information 9 Sprint_H_IIB_.book Page 10 Friday, September 6, 2013 5:08 PM It can permanently damage biological tissues including DNA, the genetic material. The energy levels associated with radio frequency energy, including both radio waves and microwaves, are not great enough to cause ionization of atoms and molecules. Therefore, RF energy is a type of non-ionizing radiation. Other types of non-ionizing radiation include visible light, infrared radiation (heat), and other forms of electromagnetic radiation with relatively low frequencies. While RF energy does not ionize particles, large amounts can increase body temperatures and cause tissue damage. Two areas of the body, the eyes and the testes, are particularly vulnerable to RF heating because there is relatively little blood flow in them to carry away excess heat. Research Results to Date: Is there a connection between RF and certain health problems?

The results of most studies conducted to date say no. In addition, attempts to replicate and confirm the few studies that have shown a connection have failed. The scientific community at large therefore believes that the weight of scientific evidence does not show an association between exposure to Radio Frequency (RF) from cell phones and adverse health outcomes. Still the scientific community has supported additional 10 Important Safety Information Sprint_H_IIB_.book Page 11 Friday, September 6, 2013 5:08 PM research to address gaps in knowledge. Some of these studies are described below. Interphone Study Interphone is a large international study designed to determine whether cell phones increase the risk of head and neck cancer. A report published in the International Journal of Epidemiology (June, 2010) compared cell phone usage for more than 5,000 people with brain tumors (glioma and meningioma) and a similar number of healthy controls. Results of this study did NOT show that cell phones caused brain cancer. In this study, most people had no increased risk of brain cancer from using cell phones. For people with the heaviest use of cell phones (an average of more than hour per day, every day, for over 10 years) the study suggested a slight increase in brain cancer. However, the authors determined that biases and errors prevented any conclusions being drawn from this data. Additional information about Interphone can be found at http://www.iarc.fr/en/media-centre/pr/2010/pdfs/

pr200_E.pdf. Interphone is the largest cell phone study to date, but it did not answer all questions about cell phone safety. Additional research is being conducted around the world, and the FDA continues to monitor developments in this field. Important Safety Information 11 Sprint_H_IIB_.book Page 12 Friday, September 6, 2013 5:08 PM International Cohort Study on Mobile Phone Users

(COSMOS) The COSMOS study aims to conduct long-term health monitoring of a large group of people to determine if there are any health issues linked to long-term exposure to radio frequency energy from cell phone use. The COSMOS study will follow approximately 300,000 adult cell phone users in Europe for 20 to 30 years. Additional information about the COSMOS study can be found at http://www.ukcosmos.org/index.html. Risk of Brain Cancer from Exposure to Radio Frequency Fields in Childhood and Adolescence

(MOBI-KIDS) MOBI-KIDS is an international study investigating the relationship between exposure to radio frequency energy from communication technologies including cell phones and brain cancer in young people. This is an international multi-center study involving 14 European and non-European countries. Additional information about MOBI-KIDS can be found at http://www.creal.cat/programes-recerca/

en_projectes-creal/view.php?ID=39. 12 Important Safety Information Sprint_H_IIB_.book Page 13 Friday, September 6, 2013 5:08 PM Surveillance, Epidemiology, and End Results (SEER) Program of the National Cancer Institute The National Cancer Institute (NCI) actively follows cancer statistics in the United States to detect any change in rates of new cases for brain cancer. If cell phones play a role in risk for brain cancer, rates should go up, because heavy cell phone use has been common for quite some time in the U.S. Between 1987 and 2005, the overall age-adjusted incidence of brain cancer did not increase. Additional information about SEER can be found at http://seer.cancer.gov/. Cell Phone Industry Actions Although the existing scientific data do not justify FDA regulatory actions, the FDA has urged the cell phone industry to take a number of steps, including the following:

Support-needed research on possible biological effects of RF for the type of signal emitted by cell phones;

Design cell phones in a way that minimizes any RF exposure to the user; and Cooperate in providing users of cell phones with the current information on cell phone use and human health concerns. The FDA also is working with voluntary standard-setting bodies such as the Institute of Important Safety Information 13 Sprint_H_IIB_.book Page 14 Friday, September 6, 2013 5:08 PM Electrical and Electronics Engineers (IEEE), the International Commission on Non-Ionizing Radiation Protection (ICNIRP), and others to assure that safety standards continue to adequately protect the public. Reducing Exposure: Hands-Free Kits and Other Accessories Steps to Reduce Exposure to Radio Frequency Energy If there is a risk from being exposed to radio frequency energy (RF) from cell phones - and at this point we do not know that there is - it is probably very small. But, if you are concerned about avoiding even potential risks, you can take a few simple steps to minimize your RF exposure. Reduce the amount of time spent using your cell phone;

Use speaker mode or a headset to place more distance between your head and the cell phone. Hands-Free Kits Hands-free kits may include audio or Bluetooth headsets and various types of body-worn accessories such as belt-clips and holsters. Combinations of these can be used to reduce RF energy absorption from cell phones. Headsets can substantially reduce exposure because the phone is held away from the head 14 Important Safety Information Sprint_H_IIB_.book Page 15 Friday, September 6, 2013 5:08 PM in the user's hand or in approved body-worn accessories. Cell phones marketed in the U.S. are required to meet RF exposure compliance requirements when used against the head and against the body. Because there are no known risks from exposure to RF emissions from cell phones, there is no reason to believe that hands-free kits reduce risks. Hands-free kits can be used for convenience and comfort. They are also required by law in many states if you want to use your phone while driving. Cell Phone Accessories that Claim to Shield the Head from RF Radiation Because there are no known risks from exposure to RF emissions from cell phones, there is no reason to believe that accessories which claim to shield the head from those emissions reduce risks. Some products that claim to shield the user from RF absorption use special phone cases, while others involve nothing more than a metallic accessory attached to the phone. Studies have shown that these products generally do not work as advertised. Unlike hands-free kits, these so-called shields may interfere with proper operation of the phone. Important Safety Information 15 Sprint_H_IIB_.book Page 16 Friday, September 6, 2013 5:08 PM The phone may be forced to boost its power to compensate, leading to an increase in RF absorption. Children and Cell Phones The scientific evidence does not show a danger to any users of cell phones from RF exposure, including children and teenagers. The steps adults can take to reduce RF exposure apply to children and teenagers as well. Reduce the amount of time spent on the cell phone;

Use speaker mode or a headset to place more distance between the head and the cell phone. Some groups sponsored by other national governments have advised that children be discouraged from using cell phones at all. For example, The Stewart Report from the United Kingdom made such a recommendation in December 2000. In this report, a group of independent experts noted that no evidence exists that using a cell phone causes brain tumors or other ill effects. Their recommendation to limit cell phone use by children was strictly precautionary; it was not based on scientific evidence that any health hazard exists. Additional information on the safety of RF exposures from various sources can be 16 Important Safety Information Sprint_H_IIB_.book Page 17 Friday, September 6, 2013 5:08 PM obtained from the following organizations

(updated 10/1/2010):

FCC RF Safety Program:

http://www.fcc.gov/oet/rfsafety/. Environmental Protection Agency (EPA):

http://www.epa.gov/radtown/wireless-

tech.html. Occupational Safety and Health Administration (OSHA):

http://www.osha.gov/SLTC/

radiofrequencyradiation/.

(Note: This web address is case sensitive.) National Institute for Occupational Safety and Health (NIOSH):

http://www.cdc.gov/niosh/. World Health Organization (WHO):

http://www.who.int/peh-emf/en/. International Commission on Non-Ionizing Radiation Protection:

http://www.icnirp.de. Health Protection Agency:

http://www.hpa.org.uk/Topics/Radiation/. US Food and Drug Administration:

http://www.fda.gov/Radiation-

EmittingProducts/

RadiationEmittingProductsandProcedures/

HomeBusinessandEntertainment/CellPhones/

default.htm. Important Safety Information 17 Sprint_H_IIB_.book Page 18 Friday, September 6, 2013 5:08 PM Specific Absorption Rate (SAR) Certification Information Your wireless phone is a radio transmitter and receiver. It is designed and manufactured not to exceed the exposure limits for Radio Frequency

(RF) energy set by the Federal Communications Commission (FCC) of the U.S. Government. These FCC RF exposure limits are derived from the recommendations of two expert organizations: the National Council on Radiation Protection and Measurement (NCRP) and the Institute of Electrical and Electronics Engineers (IEEE). In both cases, the recommendations were developed by scientific and engineering experts drawn from industry, government, and academia after extensive reviews of the scientific literature related to the biological effects of RF energy. The RF exposure limit set by the FCC for wireless mobile phones employs a unit of measurement known as the Specific Absorption Rate (SAR). The SAR is a measure of the rate of absorption of RF energy by the human body expressed in units of watts per kilogram (W/kg). The FCC requires wireless phones to comply with a safety limit of 1.6 watts per kilogram (1.6 W/kg). The FCC SAR limit incorporates a substantial margin of safety to give additional protection to 18 Important Safety Information Sprint_H_IIB_.book Page 19 Friday, September 6, 2013 5:08 PM the public and to account for any variations in measurements. SAR tests are conducted using standard operating positions accepted by the FCC with the phone transmitting at its highest certified power level in all tested frequency bands. Although the SAR is determined at the highest certified power level, the actual SAR level of the phone while operating can be well below the maximum reported value. This is because the phone is designed to operate at multiple power levels so as to use only the power required to reach the network. In general, the closer you are to a wireless base station antenna, the lower the power output of the phone. Before a new model phone is available for sale to the public, it must be tested and certified to the FCC that it does not exceed the SAR limit established by the FCC. Tests for each model phone are performed in positions and locations

(e.g. at the ear and worn on the body) as required by the FCC. For body-worn operation, this phone has been tested and meets FCC RF exposure guidelines when used with an accessory that contains no metal and that positions the mobile device a minimum of 1.0 cm from the body. Use of other accessories may not ensure compliance with FCC RF exposure guidelines. The FCC has granted an Equipment Authorization for this mobile phone with all Important Safety Information 19 Sprint_H_IIB_.book Page 20 Friday, September 6, 2013 5:08 PM reported SAR levels evaluated as in compliance with the FCC RF exposure guidelines. The maximum SAR values for this model phone as reported to the FCC are:

Head (Simultaneous transmission):

0.98 W/Kg Body-worn (Simultaneous transmission) 1.50 W/Kg SAR information on this and other model phones can be accessed online on the FCC's website through http://transition.fcc.gov/oet/

rfsafety/sar.html. To find information that pertains to a particular model phone, this site uses the phone FCC ID number which is usually printed somewhere on the case of the phone. Sometimes it may be necessary to remove the battery pack to find the number. Once you have the FCC ID number for a particular phone, follow the instructions on the website and it should provide values for typical or maximum SAR for a particular phone. Additional SAR information can also be obtained at http://www.fcc.gov/encyclopedia/specific-

absorption-rate-sar-cellular-telephones. FCC Part 15 Information to User Pursuant to part 15.21 of the FCC Rules, you are cautioned that changes or modifications not expressly approved by Samsung could void your authority to operate the device. 20 Important Safety Information Sprint_H_IIB_.book Page 21 Friday, September 6, 2013 5:08 PM This device complies with part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. Note: This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:

Reorient or relocate the receiving antenna. Increase the separation between the equipment and receiver. Important Safety Information 21 Sprint_H_IIB_.book Page 22 Friday, September 6, 2013 5:08 PM Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. Consult the dealer or an experienced radio/

TV technician for help. Commercial Mobile Alerting System

("CMAS") This device is also designed to receive CMAS alerts, known as Personal Localized Alerting Network ("PLAN") alerts. If your wireless provider has chosen to participate in CMAS/

PLAN, alerts may be available while in the provider's coverage area. If you travel outside your provider's coverage area, alerts may not be available. For more information, please contact your wireless provider. Smart Practices While Driving On the Road - Off the Phone The primary responsibility of every driver is the safe operation of his or her vehicle. Responsible drivers understand that no secondary task should be performed while driving whether it be eating, drinking, talking to passengers, or talking on a mobile phone -

unless the driver has assessed the driving conditions and is confident that the secondary task will not interfere with their primary responsibility. Do not engage in any activity while driving a moving vehicle which may 22 Important Safety Information Sprint_H_IIB_.book Page 23 Friday, September 6, 2013 5:08 PM cause you to take your eyes off the road or become so absorbed in the activity that your ability to concentrate on the act of driving becomes impaired. Samsung is committed to promoting responsible driving and giving drivers the tools they need to understand and address distractions. Check the laws and regulations on the use of mobile devices and their accessories in the areas where you drive. Always obey them. The use of these devices may be prohibited or restricted in certain areas. For example, only hands-free use may be permitted in certain areas. Before answering calls, consider your circumstances. Let the call go to voicemail when driving conditions require. Remember, driving comes first, not the call!

If you consider a call necessary and appropriate, follow these tips:

Use a hands-free device;

Secure your phone within easy reach;

Place calls when you are not moving;

Plan calls when your car will be stationary;

Do not engage in stressful or emotional conversations;

Let the person with whom you are speaking know that you are driving and will suspend the call if necessary;

Important Safety Information 23 Sprint_H_IIB_.book Page 24 Friday, September 6, 2013 5:08 PM Do not take notes or look up phone numbers while driving;

Notice regarding legal restrictions on mounting this device in an automobile:

Laws in some states may prohibit mounting this device on or near the windshield of an automobile. In other states, the law may permit mounting this device only in specific locations in the automobile. Be sure to consult the state and local laws or ordinances where you drive before mounting this device in an automobile. Failure to comply with these restrictions could result in fines, penalties, or other damages. Never mount this device in a manner that will obstruct the driver's clear view of the street and traffic. Never use wireless data services such as text messaging, Web browsing, or e-mail while operating a vehicle. Never watch videos, such as a movie or clip, or play video games while operating a vehicle. For more information, go to http://www.ctia.org. 24 Important Safety Information Sprint_H_IIB_.book Page 25 Friday, September 6, 2013 5:08 PM Battery Use and Safety Important! Handle and store batteries properly to avoid injury or damage. Most battery issues arise from improper handling of batteries and, particularly, from the continued use of damaged batteries. Do not disassemble, crush, puncture, shred, or otherwise attempt to change the form of your battery. Do not put a high degree of pressure on the battery. This can cause leakage or an internal short-circuit, resulting in overheating. Do not let the phone or battery come in contact with liquids. Liquids can get into the phone's circuits, leading to corrosion. Even when the phone appears to be dry and appears to operate normally, the circuitry could slowly corrode and pose a safety hazard. If the phone and/or battery get wet, have them checked by your service provider or contact Samsung, even if they appear to be working properly. Do not place your battery in or near a heat source. Excessive heating can damage the phone or the battery and could cause the phone or the battery to explode. Do not dry a wet or damp battery with an appliance or heat source such as a microwave oven, hair dryer, iron, or radiator. Avoid leaving your phone in your car in high temperatures. Important Safety Information 25 Sprint_H_IIB_.book Page 26 Friday, September 6, 2013 5:08 PM Do not dispose of the phone or the battery Never use any charger or battery that is in a fire. The phone or the battery may explode when overheated. Do not handle a damaged or leaking battery. Do not let leaking battery fluid come in contact with your eyes, skin or clothing. For safe disposal options, contact your nearest Samsung-authorized service center. Avoid dropping the cell phone. Dropping the phone or the battery, especially on a hard surface, can potentially cause damage to the phone and battery. If you suspect damage to the phone or battery, take it to a service center for inspection. damaged in any way. Do not allow the battery to touch metal objects. Accidental short-circuiting can occur when a metallic object (coin, key, jewelry, clip, or pen) causes a direct connection between the +

and - terminals of the battery (metal strips on the battery), for example when you carry a spare battery in a pocket or bag. Short-circuiting the terminals may damage the battery or the object causing the short-circuiting. 26 Important Safety Information Sprint_H_IIB_.book Page 27 Friday, September 6, 2013 5:08 PM Important! Use only Samsung-approved batteries, and recharge your battery only with Samsung-approved chargers which are specifically designed for your phone. WARNING!

Use of a non-Samsung-approved battery or charger may present a risk of fire, explosion, leakage, or other hazard. Samsung's warranty does not cover damage to the phone caused by nonSamsung-approved batteries and/or chargers. Do not use incompatible cell phone batteries and chargers. Some websites and second-hand dealers not associated with reputable manufacturers and carriers, might be selling incompatible or even counterfeit batteries and chargers. Consumers should purchase manufacturer or carrier-recommended products and accessories. If unsure about whether a replacement battery or charger is compatible, contact the manufacturer of the battery or charger. Misuse or use of incompatible phones, batteries, and charging devices could result in damage to the equipment and a possible risk of fire, explosion, or leakage, leading to serious injuries, damages to your phone, or other serious hazard. Important Safety Information 27 Sprint_H_IIB_.book Page 28 Friday, September 6, 2013 5:08 PM Samsung Mobile Products and Recycling Samsung cares for the environment and encourages its customers to recycle Samsung mobile devices and genuine Samsung accessories. Proper disposal of your mobile device and its battery is not only important for safety, it benefits the environment. Batteries must be recycled or disposed of properly. Recycling programs for your mobile device, batteries, and accessories may not be available in your area. We've made it easy for you to recycle your old Samsung mobile device by working with respected take-back companies in every state in the country. Drop It Off You can drop off your Samsung-branded mobile device and batteries for recycling at one of our numerous Samsung Recycling Direct (SM) locations. A list of these locations may be found at:

http://pages.samsung.com/us/recyclingdirect/

usactivities_environment_samsungrecyclingdir ect_locations.jsp. Samsung-branded devices and batteries will be accepted at these locations for no fee. Consumers may also recycle their used mobile device or batteries at many retail or 28 Important Safety Information Sprint_H_IIB_.book Page 29 Friday, September 6, 2013 5:08 PM carrier-provided locations where mobile devices and batteries are sold. Additional information regarding specific locations may be found at:

http://www.epa.gov/epawaste/partnerships/

plugin/cellphone/index.htm or at http://

www.call2recycle.org/. Mail It In The Samsung Mobile Take-Back Program will provide Samsung customers with a free recycling mailing label. Just go to http://fun.samsungmobileusa.com/

recycling/index.jsp and follow the instructions to print out a free pre-paid postage label and then send your old mobile device or battery to the address listed, via U.S. Mail, for recycling. Dispose of unwanted electronics through an approved recycler. To find the nearest recycling location, go to our website:

www.samsung.com/recyclingdirect Or call, (877) 278-0799. Follow local regulations regarding disposal of mobile devices and batteries Dispose of your mobile device and batteries in accordance with local regulations. In some areas, the disposal of these items in household or business trash may be prohibited. Help us protect the environment - recycle!

Important Safety Information 29 Sprint_H_IIB_.book Page 30 Friday, September 6, 2013 5:08 PM Warning! Never dispose of batteries in a fire because they may explode. UL Certified Travel Charger The Travel Charger for this phone has met applicable UL safety requirements. Please adhere to the following safety instructions per UL guidelines:

FAILURE TO FOLLOW THE INSTRUCTIONS OUTLINED MAY LEAD TO SERIOUS PERSONAL INJURY AND POSSIBLE PROPERTY DAMAGE. IMPORTANT SAFETY INSTRUCTIONS -

SAVE THESE INSTRUCTIONS. DANGER - TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, CAREFULLY FOLLOW THESE INSTRUCTIONS. FOR CONNECTION TO A SUPPLY NOT IN NORTH AMERICA, USE AN ATTACHMENT PLUG ADAPTOR OF THE PROPER CONFIGURATION FOR THE POWER OUTLET. THIS POWER UNIT IS INTENDED TO BE CORRECTLY ORIENTED IN A VERTICAL OR HORIZONTAL OR FLOOR MOUNT POSITION. 30 Important Safety Information Sprint_H_IIB_.book Page 31 Friday, September 6, 2013 5:08 PM Display / Touch-Screen Please note the following information when using your mobile device:

WARNING REGARDING DISPLAY The display on your mobile device is made of glass or acrylic and could break if your mobile device is dropped or if it receives significant impact. Do not use if screen is broken or cracked as this could cause injury to you. WARRANTY DISCLAIMER: PROPER USE OF A TOUCH-SCREEN MOBILE DEVICE If your mobile device has a touch-screen display, please note that a touch-screen responds best to a light touch from the pad of your finger or a non-metallic stylus. Using excessive force or a metallic object when pressing on the touch-screen may damage the tempered glass surface and void the warranty. For more information, please refer to the Standard Limited Warranty. GPS & AGPS Certain Samsung mobile devices can use a Global Positioning System (GPS) signal for location-based applications. A GPS uses satellites controlled by the U.S. Government that are subject to changes implemented in accordance with the Department of Defense Important Safety Information 31 Sprint_H_IIB_.book Page 32 Friday, September 6, 2013 5:08 PM policy and the 2008 Federal Radio navigation Plan (FRP). Changes may affect the performance of location-based technology on your mobile device. Certain Samsung mobile devices can also use an Assisted Global Positioning System (AGPS), which obtains information from the cellular network to improve GPS performance. AGPS uses your wireless service provider's network and therefore airtime, data charges, and/or additional charges may apply in accordance with your service plan. Contact your wireless service provider for details. Your Location Location-based information includes information that can be used to determine the approximate location of a mobile device. Mobile devices which are connected to a wireless network transmit location-based information. Additionally, if you use applications that require location-based information (e.g. driving directions), such applications transmit location-based information. The location-based information may be shared with third-parties, including your wireless service provider, applications providers, Samsung, and other third-parties providing services. 32 Important Safety Information Sprint_H_IIB_.book Page 33 Friday, September 6, 2013 5:08 PM Use of AGPS in Emergency Calls When you make an emergency call, the cellular network may activate AGPS technology in your mobile device to tell the emergency responders your approximate location. AGPS has limitations and might not work in your area. Therefore:

Always tell the emergency responder your location to the best of your ability; and Remain on the mobile device for as long as the emergency responder instructs you. Navigation Maps, directions, and other navigation-data, including data relating to your current location, may contain inaccurate or incomplete data, and circumstances can and do change over time. In some areas, complete information may not be available. Therefore, you should always visually confirm that the navigational instructions are consistent with what you see before following them. All users should pay attention to road conditions, closures, traffic, and all other factors that may impact safe driving or walking. Always obey posted road signs. Emergency Calls This mobile device, like any wireless mobile device, operates using radio signals, wireless and landline networks, as well as user-programmed functions, which cannot Important Safety Information 33 Sprint_H_IIB_.book Page 34 Friday, September 6, 2013 5:08 PM guarantee connection in all conditions, areas, or circumstances. Therefore, you should never rely solely on any wireless mobile device for essential communications (medical emergencies, for example). Before traveling in remote or underdeveloped areas, plan an alternate method of contacting emergency services personnel. Remember, to make or receive any calls, the mobile device must be switched on and in a service area with adequate signal strength. Emergency calls may not be possible on all wireless mobile device networks or when certain network services and/or mobile device features are in use. Check with local service providers. To make an emergency call:

Phone. and tap 1. Press 2. Tap the keys for the the emergency number for your present location (for example, 911 or other official emergency number). Emergency numbers vary by location. 3. Tap to dial the number. If certain features are in use (call blocking, for example), you may first need to deactivate those features before you can make an emergency call. Consult your User Manual and your local cellular service 34 Important Safety Information Sprint_H_IIB_.book Page 35 Friday, September 6, 2013 5:08 PM provider. When making an emergency call, remember to give all the necessary information as accurately as possible. Remember that your mobile device may be the only means of communication at the scene of an accident; do not cut off the call until given permission to do so. Care and Maintenance Your mobile device is a product of superior design and craftsmanship and should be treated with care. The suggestions below will help you fulfill any warranty obligations and allow you to enjoy this product for many years:

Keep your Samsung Mobile Device away from:

Liquids of any kind Keep the mobile device dry. Precipitation, humidity, and liquids contain minerals that will corrode electronic circuits. If the mobile device does get wet, do not accelerate drying with the use of an oven, microwave, or dryer, because this may damage the mobile device and could cause a fire or explosion. Do not use the mobile device with a wet hand. Doing so may cause an electric shock to you or damage to the mobile device. Extreme heat or cold Avoid temperatures below 0C / 32F or above 45C / 113F. Important Safety Information 35 Sprint_H_IIB_.book Page 36 Friday, September 6, 2013 5:08 PM Microwaves Do not try to dry your mobile device in a microwave oven. Doing so may cause a fire or explosion. Dust and dirt Do not expose your mobile device to dust, dirt, or sand. Cleaning solutions Do not use harsh chemicals, cleaning solvents, or strong detergents to clean the mobile device. Wipe it with a soft cloth slightly dampened in a mild soap-and-water solution. Shock or vibration Do not drop, knock, or shake the mobile device. Rough handling can break internal circuit boards. Paint Do not paint the mobile device. Paint can clog the devices moving parts or ventilation openings and prevent proper operation. Responsible Listening Caution! Avoid potential hearing loss. Damage to hearing occurs when a person is exposed to loud sounds over time. The risk of hearing loss increases as sound is played louder and for longer durations. Prolonged 36 Important Safety Information Sprint_H_IIB_.book Page 37 Friday, September 6, 2013 5:08 PM exposure to loud sounds (including music) is the most common cause of preventable hearing loss. Some scientific research suggests that using portable audio devices, such as portable music players and cell phones, at high volume settings for long durations may lead to permanent noise-induced hearing loss. This includes the use of headphones (including headsets, earbuds, and Bluetooth or other wireless devices). Exposure to very loud sound has also been associated in some studies with tinnitus (a ringing in the ear), hypersensitivity to sound, and distorted hearing. Individual susceptibility to noise-induced hearing loss and potential hearing problem varies. Additionally, the amount of sound produced by a portable audio device varies depending on the nature of the sound, the device settings, and the headphones that are used. As a result, there is no single volume setting that is appropriate for everyone or for every combination of sound, settings, and equipment. You should follow some common sense recommendations when using any portable audio device:

Always turn the volume down before plugging the earphones into an audio source. Set the volume in a quiet environment and select the lowest volume at which you can hear adequately. Important Safety Information 37 Sprint_H_IIB_.book Page 38 Friday, September 6, 2013 5:08 PM Be aware that you can adapt to higher volume settings over time, not realizing that the higher volume may be harmful to your hearing. When using headphones, turn the volume down if you cannot hear the people speaking near you or if the person sitting next to you can hear what you are listening to. Do not turn the volume up to block out noisy surroundings. If you choose to listen to your portable device in a noisy environment, use noise-cancelling headphones to block out background environmental noise. By blocking background environment noise, noise cancelling headphones should allow you to hear the music at lower volumes than when using earbuds. Limit the amount of time you listen. As the volume increases, less time is required before you hearing could be affected. Avoid using headphones after exposure to extremely loud noises, such as rock concerts, that might cause temporary hearing loss. Temporary hearing loss might cause unsafe volumes to sound normal. Do not listen at any volume that causes you discomfort. If you experience ringing in your ears, hear muffled speech, or experience any temporary hearing difficulty after listening to 38 Important Safety Information Sprint_H_IIB_.book Page 39 Friday, September 6, 2013 5:08 PM your portable audio device, discontinue use and consult your doctor. You can obtain additional information on this subject from the following sources:

American Academy of Audiology 11730 Plaza American Drive, Suite 300 Reston, VA 20190 Voice: (800) 222-2336 Email: info@audiology.org Internet:

http://www.audiology.org/Pages/

default.aspx National Institute on Deafness and Other Communication Disorders National Institutes of Health 31 Center Drive, MSC 2320 Bethesda, MD 20892-2320 Email: nidcdinfo@nih.gov Internet:

http://www.nidcd.nih.gov/

Important Safety Information 39 Sprint_H_IIB_.book Page 40 Friday, September 6, 2013 5:08 PM National Institute for Occupational Safety and Health (NIOSH) 395 E Street, S.W., Suite 9200 Patriots Plaza Building Washington, DC 20201 Voice: 1-800-35-NIOSH

(1-800-356-4674) 1-800-CDC-INFO (1-800-232-4636) Outside the U.S. 513-533-8328 Email: cdcinfo@cdc.gov Internet:

http://www.cdc.gov/niosh/topics/

noise/default.html 1-888-232-6348 TTY Operating Environment Remember to follow any special regulations in force in any area, and always switch your mobile device off whenever it is forbidden to use it, or when it may cause interference or danger. When connecting the mobile device or any accessory to another device, read its user's guide for detailed safety instructions. Do not connect incompatible products. Using Your Mobile Device Near Other Electronic Devices Most modern electronic equipment is shielded from Radio Frequency (RF) signals. However, certain electronic equipment may not be shielded against the RF signals from your 40 Important Safety Information Sprint_H_IIB_.book Page 41 Friday, September 6, 2013 5:08 PM wireless mobile device. Consult the manufacturer to discuss alternatives. Implantable Medical Devices A minimum separation of six (6) inches should be maintained between a handheld wireless mobile device and an implantable medical device, such as a pacemaker or implantable cardioverter defibrillator, to avoid potential interference with the device. Persons who have such devices:

Should ALWAYS keep the mobile device more than six (6) inches from their implantable medical device when the mobile device is turned ON;

Should not carry the mobile device in a breast pocket;

Should use the ear opposite the implantable medical device to minimize the potential for interference;

Should turn the mobile device OFF immediately if there is any reason to suspect that interference is taking place;

Should read and follow the directions from the manufacturer of your implantable medical device. If you have any questions about using your wireless mobile device with an implantable medical device, consult your health care provider. Important Safety Information 41 Sprint_H_IIB_.book Page 42 Friday, September 6, 2013 5:08 PM For more information see: http://www.fcc.gov/

oet/rfsafety/rf-faqs.html#. Other Medical Devices If you use any other personal medical devices, consult the manufacturer of your device to determine if it is adequately shielded from external RF energy. Your physician may be able to assist you in obtaining this information. Switch your mobile device off in health care facilities when any regulations posted in these areas instruct you to do so. Hospitals or health care facilities may be using equipment that could be sensitive to external RF energy. Vehicles RF signals may affect improperly installed or inadequately shielded electronic systems in motor vehicles. Check with the manufacturer or its representative regarding your vehicle before using your mobile device in a motor vehicle. You should also consult the manufacturer of any equipment that has been added to your vehicle. Posted Facilities Switch your mobile device off in any facility where posted notices require you to do so. Potentially Explosive Environments Switch your mobile device off when in any area with a potentially explosive atmosphere and 42 Important Safety Information Sprint_H_IIB_.book Page 43 Friday, September 6, 2013 5:08 PM obey all signs and instructions. Sparks in such areas could cause an explosion or fire resulting in bodily injury or even death. Users are advised to switch the mobile device off while at a refueling point (service station). Users are reminded of the need to observe restrictions on the use of radio equipment in fuel depots (fuel storage and distribution areas), chemical plants, or where blasting operations are in progress. Areas with a potentially explosive atmosphere are often, but not always, clearly marked. They include below deck on boats, chemical transfer or storage facilities, vehicles using liquefied petroleum gas (such as propane or butane), areas where the air contains chemicals or particles, such as grain, dust, or metal powders, and any other area where you would normally be advised to turn off your vehicle engine. Vehicles using liquefied petroleum gas (such as propane or butane) must comply with the National Fire Protection Standard (NFPA-58). For a copy of this standard, contact the National Fire Protection Association. When your Device is Wet Do not turn on your device if it is wet. If your device is already on, turn it off and remove the battery immediately (if the device will not turn off or you cannot remove the battery, leave it as-is). Then, dry the device with a towel and take it to a service center. Important Safety Information 43 Sprint_H_IIB_.book Page 44 Friday, September 6, 2013 5:08 PM FCC Hearing Aid Compatibility (HAC) Regulations for Wireless Devices The U.S. Federal Communications Commission

(FCC) has established requirements for digital wireless mobile devices to be compatible with hearing aids and other assistive hearing devices. When individuals employing some assistive hearing devices (hearing aids and cochlear implants) use wireless mobile devices, they may detect a buzzing, humming, or whining noise. Some hearing devices are more immune than others to this interference noise, and mobile devices also vary in the amount of interference they generate. The wireless telephone industry has developed a rating system for wireless mobile devices to assist hearing device users find mobile devices that may be compatible with their hearing devices. Not all mobile devices have been rated. Mobile devices that are rated have the rating on their box or a label located on the box. The ratings are not guarantees. Results will vary depending on the user's hearing device and hearing loss. If your hearing device happens to be vulnerable to interference, you may not be able to use a rated mobile device successfully. Trying out the mobile device with your hearing device is the best way to evaluate it for your personal needs. 44 Important Safety Information Sprint_H_IIB_.book Page 45 Friday, September 6, 2013 5:08 PM M-Ratings: Wireless mobile devices rated M3 or M4 meet FCC requirements and are likely to generate less interference to hearing devices than mobile devices that are not labeled. M4 is the better/higher of the two ratings. M-ratings refer to enabling acoustic coupling with hearing aids that do not operate in telecoil mode. T-Ratings: Mobile devices rated T3 or T4 meet FCC requirements and are likely to generate less interference to hearing devices than mobile devices that are not labeled. T4 is the better/

higher of the two ratings. T-ratings refer to enabling inductive coupling with hearing aids operating in telecoil mode. Hearing devices may also be rated. Your hearing aid manufacturer or hearing health professional may help you find this rating. Higher ratings mean that the hearing device is relatively immune to interference noise. Under the current industry standard, American National Standards Institute (ANSI) C63.19, the hearing aid and wireless mobile device rating values are added together to indicate how usable they are together. For example, if a hearing aid meets the M2 level rating and the wireless mobile device meets the M3 level rating, the sum of the two values equals M5. Under the standard, this should provide the hearing aid user with normal use while using Important Safety Information 45 Sprint_H_IIB_.book Page 46 Friday, September 6, 2013 5:08 PM the hearing aid with the particular wireless mobile device. A sum of 6 or more would indicate excellent performance. However, these are not guarantees that all users will be satisfied. T ratings work similarly. M3 + M2 = 5 T3 + T2 = 5 46 Important Safety Information Sprint_H_IIB_.book Page 47 Friday, September 6, 2013 5:08 PM The HAC rating and measurement procedure are described in the American National Standards Institute (ANSI) C63.19 standard. HAC for Newer Technologies This phone has been tested and rated for use with hearing aids for some of the wireless technologies that it uses. However, there may be some newer wireless technologies used in this phone that have not been tested yet for use with hearing aids. It is important to try the different features of this phone thoroughly and in different locations, using your hearing aid or cochlear implant, to determine if you hear any interfering noise. Consult your service provider or the manufacturer of this phone for information on hearing aid compatibility. If you have questions about return or exchange policies, consult your service provider or phone retailer. Restricting Children's Access to Your Mobile Device Your mobile device is not a toy. Do not allow children to play with it because they could hurt themselves and others, damage the mobile device, or make calls that increase your mobile device bill. Keep the mobile device and all its parts and accessories out of the reach of small children. Important Safety Information 47 Sprint_H_IIB_.book Page 48 Friday, September 6, 2013 5:08 PM FCC Notice and Cautions FCC Notice The mobile device may cause TV or radio interference if used in close proximity to receiving equipment. The FCC can require you to stop using the mobile device if such interference cannot be eliminated. Cautions Any changes or modifications to your mobile device not expressly approved by Samsung could void your warranty for this equipment and void your authority to operate this equipment. Only use approved batteries, antennas, and chargers. The use of any unauthorized accessories may be dangerous and void the mobile device warranty if said accessories cause damage or a defect to the mobile device. Although your mobile device is quite sturdy, it is a complex piece of equipment and can be broken. Avoid dropping, hitting, bending, or sitting on it. Other Important Safety Information Only qualified personnel should service the mobile device or install the mobile device in a vehicle. Faulty installation or service may be dangerous and may invalidate any warranty applicable to the device. Ensure that any mobile devices or related equipment installed in your vehicle are securely mounted. 48 Important Safety Information Sprint_H_IIB_.book Page 49 Friday, September 6, 2013 5:08 PM Check regularly that all wireless mobile device equipment in your vehicle is mounted and operating properly. When using a headset in dry environments, static electricity can build up in the headset and cause a small quick static electrical shock. To minimize the risk of electrostatic discharge from the headset avoid using the headset in extremely dry environments or touch a grounded unpainted metal object to discharge static electricity before inserting the headset. Do not store or carry flammable liquids, gases, or explosive materials in the same compartment as the mobile device, its parts, or accessories. For vehicles equipped with an air bag, remember that an air bag inflates with great force. Do not place objects, including installed or portable wireless equipment near or in the area over the air bag or in the air bag deployment area. If wireless equipment is improperly installed and the air bag inflates, serious injury could result. Switch your mobile device off before boarding an aircraft. The use of wireless mobile devices in aircraft is illegal and may be dangerous to the aircraft's operation. Check with appropriate authorities before Important Safety Information 49 Sprint_H_IIB_.book Page 50 Friday, September 6, 2013 5:08 PM using any function of a mobile device while on an aircraft. Failure to observe these instructions may lead to the suspension or denial of cell phone services to the offender, or legal action, or both. While using your device, leave some lights on in the room and do not hold the screen too close to your eyes. Seizures or blackouts can occur when you are exposed to flashing lights while watching videos or playing games for extended periods. If you feel any discomfort, stop using the device immediately. Reduce risk of repetitive motion injuries. When you repetitively perform actions, such as pressing keys, drawing characters on a touch screen with your fingers, or playing games, you may experience occasional discomfort in your hands, neck, shoulders, or other parts of your body. When using your device for extended periods, hold the device with a relaxed grip, press the keys lightly, and take frequent breaks. If you continue to have discomfort during or after such use, stop use and see a physician. If your device has a camera flash or light, do not use the flash or light close to the eyes of people or pets. [122011]

50 Important Safety Information Sprint_H_IIB_.book Page 51 Friday, September 6, 2013 5:08 PM Important Safety Information 51 Sprint_H_IIB_.book Page 52 Friday, September 6, 2013 5:08 PM Manufacturers Warranty Your device has been designed to provide you with reliable, worry-free service. If for any reason you have a problem with your equipment, please refer to the manufacturers warranty in this section. For information regarding the terms and conditions of service for your device, please visit sprint.com or call Sprint Customer Service at 1-

888-211-4727. Standard Limited Warranty What is covered and for how long?

SAMSUNG TELECOMMUNICATIONS AMERICA, LLC (SAMSUNG) warrants that SAMSUNGs handsets and accessories

(Products) are free from defects in material and workmanship under normal use and service for the period commencing upon the date of purchase by the first consumer purchaser and continuing for the following specified period of time after that date:

Phone Batteries 1 Year 1 Year Case/Pouch/Holster 90 Days 52 Manufacturers Warranty Sprint_H_IIB_.book Page 53 Friday, September 6, 2013 5:08 PM Other Phone Accessories 1 Year What is not covered?

This Limited Warranty is conditioned upon proper use of the Product. This Limited Warranty does not cover: (a) defects or damage resulting from accident, misuse, abnormal use, abnormal conditions, improper storage, exposure to liquid, moisture, dampness, sand or dirt, neglect, or unusual physical, electrical or electromechanical stress;

(b) scratches, dents and cosmetic damage, unless caused by SAMSUNG; (c) defects or damage resulting from excessive force or use of a metallic object when pressing on a touch screen; (d) equipment that has the serial number or the enhancement data code removed, defaced, damaged, altered or made illegible; (e) ordinary wear and tear; (f) defects or damage resulting from the use of Product in conjunction or connection with accessories, products, or ancillary/peripheral equipment not furnished or approved by SAMSUNG;

(g) defects or damage resulting from improper testing, operation, maintenance, installation, service, or adjustment not furnished or approved by SAMSUNG; (h) defects or damage resulting from external causes such as collision with an object, fire, flooding, dirt, windstorm, lightning, earthquake, exposure to Manufacturers Warranty 53 Sprint_H_IIB_.book Page 54 Friday, September 6, 2013 5:08 PM weather conditions, theft, blown fuse, or improper use of any electrical source; (i) defects or damage resulting from cellular signal reception or transmission, or viruses or other software problems introduced into the Product;

or (j) Product used or purchased outside the United States. This Limited Warranty covers batteries only if battery capacity falls below 80%

of rated capacity or the battery leaks, and this Limited Warranty does not cover any battery if

(i) the battery has been charged by a battery charger not specified or approved by SAMSUNG for charging the battery; (ii) any of the seals on the battery are broken or show evidence of tampering; or (iii) the battery has been used in equipment other than the SAMSUNG phone for which it is specified. What are SAMSUNGs obligations?

During the applicable warranty period, provided the Product is returned in accordance with the terms of this Limited Warranty, SAMSUNG will repair or replace the Product, at SAMSUNGs sole option, without charge. SAMSUNG may, at SAMSUNGs sole option, use rebuilt, reconditioned, or new parts or components when repairing any Product, or may replace the Product with a rebuilt, reconditioned or new Product. Repaired/replaced cases, pouches and holsters will be warranted for a period of ninety 54 Manufacturers Warranty Sprint_H_IIB_.book Page 55 Friday, September 6, 2013 5:08 PM

(90) days. All other repaired/replaced Products will be warranted for a period equal to the remainder of the original Limited Warranty on the original Product or for ninety (90) days, whichever is longer. All replaced Products, parts, components, boards and equipment shall become the property of SAMSUNG. Except to any extent expressly allowed by applicable law, transfer or assignment of this Limited Warranty is prohibited. What must you do to obtain warranty service?

To obtain service under this Limited Warranty, you must return the Product to an authorized phone service facility in an adequate container for shipping, accompanied by the sales receipt or comparable proof of sale showing the original date of purchase, the serial number of the Product and the sellers name and address. To obtain assistance on where to deliver the Product, please call SAMSUNG Customer Care at 1-888-987-4357. If SAMSUNG determines that any Product is not covered by this Limited Warranty, you must pay all parts, shipping, and labor charges for the repair or return of such Product. You should keep a separate backup copy of any contents of the Product before delivering the Product to SAMSUNG for warranty service, as some or all of the contents may be deleted Manufacturers Warranty 55 Sprint_H_IIB_.book Page 56 Friday, September 6, 2013 5:08 PM or reformatted during the course of warranty service. What are the limits on SAMSUNGs liability?

THIS LIMITED WARRANTY SETS OUT THE FULL EXTENT OF SAMSUNGS RESPONSIBILITIES, AND THE EXCLUSIVE REMEDY REGARDING THE PRODUCTS. ALL IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE LIMITED TO THE DURATION OF THIS LIMITED WARRANTY. IN NO EVENT SHALL SAMSUNG BE LIABLE FOR DAMAGES IN EXCESS OF THE PURCHASE PRICE OF THE PRODUCT OR FOR, WITHOUT LIMITATION, COMMERCIAL LOSS OF ANY SORT; LOSS OF USE, TIME, DATA, REPUTATION, OPPORTUNITY, GOODWILL, PROFITS OR SAVINGS; INCONVENIENCE;

INCIDENTAL, SPECIAL, CONSEQUENTIAL OR PUNITIVE DAMAGES; OR DAMAGES ARISING FROM THE USE OR INABILITY TO USE THE PRODUCT. SOME STATES AND JURISDICTIONS DO NOT ALLOW LIMITATIONS ON HOW LONG AN IMPLIED WARRANTY LASTS, OR THE DISCLAIMER OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES, SO THE ABOVE LIMITATIONS AND DISCLAIMERS MAY NOT APPLY TO YOU. 56 Manufacturers Warranty Sprint_H_IIB_.book Page 57 Friday, September 6, 2013 5:08 PM SAMSUNG MAKES NO WARRANTIES OR REPRESENTATIONS, EXPRESS OR IMPLIED, STATUTORY OR OTHERWISE, AS TO THE QUALITY, CAPABILITIES, OPERATIONS, PERFORMANCE OR SUITABILITY OF ANY THIRD-PARTY SOFTWARE OR EQUIPMENT USED IN CONJUNCTION WITH THE PRODUCT, OR THE ABILITY TO INTEGRATE ANY SUCH SOFTWARE OR EQUIPMENT WITH THE PRODUCT, WHETHER SUCH THIRD-PARTY SOFTWARE OR EQUIPMENT IS INCLUDED WITH THE PRODUCT DISTRIBUTED BY SAMSUNG OR OTHERWISE. RESPONSIBILITY FOR THE QUALITY, CAPABILITIES, OPERATIONS, PERFORMANCE AND SUITABILITY OF ANY SUCH THIRD-PARTY SOFTWARE OR EQUIPMENT RESTS SOLELY WITH THE USER AND THE DIRECT VENDOR, OWNER OR SUPPLIER OF SUCH THIRD-PARTY SOFTWARE OR EQUIPMENT. Nothing in the Product instructions or information shall be construed to create an express warranty of any kind with respect to the Products. No agent, employee, dealer, representative or reseller is authorized to modify or extend this Limited Warranty or to make binding representations or claims, whether in advertising, presentations or otherwise, on behalf of SAMSUNG regarding the Products or this Limited Warranty. Manufacturers Warranty 57 Sprint_H_IIB_.book Page 58 Friday, September 6, 2013 5:08 PM This Limited Warranty gives you specific legal rights, and you may also have other rights that vary from state to state. What is the procedure for resolving disputes?

ALL DISPUTES WITH SAMSUNG ARISING IN ANY WAY FROM THIS LIMITED WARRANTY OR THE SALE, CONDITION OR PERFORMANCE OF THE PRODUCTS SHALL BE RESOLVED EXCLUSIVELY THROUGH FINAL AND BINDING ARBITRATION, AND NOT BY A COURT OR JURY. Any such dispute shall not be combined or consolidated with a dispute involving any other persons or entitys Product or claim, and specifically, without limitation of the foregoing, shall not under any circumstances proceed as part of a class action. The arbitration shall be conducted before a single arbitrator, whose award may not exceed, in form or amount, the relief allowed by the applicable law. The arbitration shall be conducted according to the American Arbitration Association (AAA) Commercial Arbitration Rules applicable to consumer disputes. This arbitration provision is entered pursuant to the Federal Arbitration Act. The laws of the State of Texas, without reference to its choice of laws principles, shall govern the interpretation of the Limited Warranty and all disputes that are subject to this arbitration provision. The arbitrator shall decide all issues 58 Manufacturers Warranty Sprint_H_IIB_.book Page 59 Friday, September 6, 2013 5:08 PM of interpretation and application of this arbitration provision and the Limited Warranty. For any arbitration in which your total damage claims, exclusive of attorney fees and expert witness fees, are $5,000.00 or less (Small Claim), the arbitrator may, if you prevail, award your reasonable attorney fees, expert witness fees and costs as part of any award, but may not grant SAMSUNG its attorney fees, expert witness fees or costs unless it is determined that the claim was brought in bad faith. In a Small Claim case, you shall be required to pay no more than half of the total administrative, facility and arbitrator fees, or $50.00 of such fees, whichever is less, and SAMSUNG shall pay the remainder of such fees. Administrative, facility and arbitrator fees for arbitrations in which your total damage claims, exclusive of attorney fees and expert witness fees, exceed $5,000.00

(Large Claim) shall be determined according to AAA rules. In a Large Claim case, the arbitrator may grant to the prevailing party, or apportion among the parties, reasonable attorney fees, expert witness fees and costs. Judgment may be entered on the arbitrators award in any court of competent jurisdiction. This arbitration provision also applies to claims against SAMSUNGs employees, representatives and affiliates if any such claim arises from the Products sale, condition or performance. Manufacturers Warranty 59 Sprint_H_IIB_.book Page 60 Friday, September 6, 2013 5:08 PM You may opt out of this dispute resolution procedure by providing notice to SAMSUNG no later than 30 calendar days from the date of the first consumer purchasers purchase of the Product. To opt out, you must send notice by e-mail to optout@sta.samsung.com, with the subject line: Arbitration Opt Out. You must include in the opt out e-mail (a) your name and address; (b) the date on which the Product was purchased; (c) the Product model name or model number; and (d) the IMEI or MEID or Serial Number, as applicable, if you have it (the IMEI or MEID or Serial Number can be found (i) on the Product box; (ii) on the Product information screen, which can be found under Settings; (iii) on a label on the back of the Product beneath the battery, if the battery is removable; and (iv) on the outside of the Product if the battery is not removable). Alternatively, you may opt out by calling 1-888-987-4357 no later than 30 calendar days from the date of the first consumer purchasers purchase of the Product and providing the same information. These are the only two forms of notice that will be effective to opt out of this dispute resolution procedure. Opting out of this dispute resolution procedure will not affect the coverage of the Limited Warranty in 60 Manufacturers Warranty Sprint_H_IIB_.book Page 61 Friday, September 6, 2013 5:08 PM any way, and you will continue to enjoy the benefits of the Limited Warranty. Severability If any portion of this Limited Warranty is held to be illegal or unenforceable, such partial illegality or unenforceability shall not affect the enforceability of the remainder of the Limited Warranty. Precautions for Transfer and Disposal If data stored on this device is deleted or reformatted using the standard methods, the data only appears to be removed on a superficial level, and it may be possible for someone to retrieve and reuse the data by means of special software. To avoid unintended information leaks and other problems of this sort, it is recommended that the device be returned to Samsungs Customer Care Center for an Extended File System (EFS) Clear which will eliminate all user memory and return all settings to default settings. Please contact the Samsung Customer Care Center for details. Important! Please provide warranty information

(proof of purchase) to Samsungs Customer Care Center in order to provide this service at no charge. If the warranty has expired on the device, charges may apply. Manufacturers Warranty 61 Sprint_H_IIB_.book Page 62 Friday, September 6, 2013 5:08 PM Samsung Telecommunications America, LLC 1301 E. Lookout Drive Richardson, Texas 75082 Phone: 1-800-SAMSUNG Phone: 1-888-987-HELP (4357) No reproduction in whole or in part allowed without prior written approval. Specifications and availability subject to change without notice. [111611]

End User License Agreement for Software IMPORTANT. READ CAREFULLY: This End User License Agreement ("EULA") is a legal agreement between you (either an individual or a single entity) and Samsung Electronics Co., Ltd. ("Samsung") for software, owned by Samsung and its affiliated companies and its third party suppliers and licensors, that accompanies this EULA, which includes computer software and may include associated media, printed materials, "online" or electronic documentation in connection with your use of this device ("Software"). This device requires the use of preloaded software in its normal operation. BY USING THE DEVICE OR ITS PRELOADED SOFTWARE, YOU ACCEPT THE TERMS OF THIS EULA. IF YOU DO NOT ACCEPT THESE TERMS, DO NOT USE THE DEVICE OR THE SOFTWARE. 1. GRANT OF LICENSE. Samsung grants you the following rights provided that you comply 62 Manufacturers Warranty Sprint_H_IIB_.book Page 63 Friday, September 6, 2013 5:08 PM with all terms and conditions of this EULA: You may install, use, access, display and run one copy of the Software on the local hard disk(s) or other permanent storage media of one computer and use the Software on a single computer or a mobile device at a time, and you may not make the Software available over a network where it could be used by multiple computers at the same time. You may make one copy of the Software in machine readable form for backup purposes only; provided that the backup copy must include all copyright or other proprietary notices contained on the original. Certain items of the Software may be subject to open source licenses. The open source license provisions may override some of the terms of this EULA. We make the applicable open source licenses available to you on the Legal Notices section of the Settings menu of your device. 2. RESERVATION OF RIGHTS AND OWNERSHIP. Samsung reserves all rights not expressly granted to you in this EULA. The Software is protected by copyright and other intellectual property laws and treaties. Samsung or its suppliers own the title, copyright and other intellectual property rights in the Software. The Software is licensed, not sold. 3. LIMITATIONS ON END USER RIGHTS. You may not reverse engineer, decompile, Manufacturers Warranty 63 Sprint_H_IIB_.book Page 64 Friday, September 6, 2013 5:08 PM disassemble, or otherwise attempt to discover the source code or algorithms of, the Software

(except and only to the extent that such activity is expressly permitted by applicable law not withstanding this limitation), or modify, or disable any features of, the Software, or create derivative works based on the Software. You may not rent, lease, lend, sublicense or provide commercial hosting services with the Software. 4. CONSENT TO USE OF DATA. You agree that Samsung and its affiliates may collect and use technical information gathered as part of the product support services related to the Software provided to you, if any, such as IMEI(your device's unique identification number), device number, model name, customer code, access recording, your device's current SW version, MCC (Mobile Country Code), MNC (Mobile Network Code). Samsung and its affiliates may use this information solely to improve their products or to provide customized services or technologies to you and will not disclose this information in a form that personally identifies you. At all times your information will be treated in accordance with Samsung's Privacy Policy, which can be viewed at:

http://account.samsung.com/membership/

pp. 5. SOFTWARE UPDATES. Samsung may provide to you or make available to you updates, upgrades, supplements and add-on 64 Manufacturers Warranty Sprint_H_IIB_.book Page 65 Friday, September 6, 2013 5:08 PM components (if any) of the Software, including bug fixes, service upgrades (parts or whole), products or devices, and updates and enhancements to any software for security previously installed (including entirely new versions), (collectively Update) after the date you obtain your initial copy of the Software to improve the Software and ultimately enhance your user experience with your device. This EULA applies to all and any component of the Update that Samsung may provide to you or make available to you after the date you obtain your initial copy of the Software, unless we provide other terms along with such Update. To use Software provided through Update, you must first be licensed for the Software identified by Samsung as eligible for the Update. After the Update, you may no longer use the Software that formed the basis for your Update eligibility. The updated Software version may add new functions and, in some limited cases, may delete existing functions. While the Update will be generally available, in some limited circumstances, the Software updates will only be offered by your network carrier, and such Software updates will be governed by your contractual relationship with your network carrier. With the Automatic Update function enabled

(as in the default setting in the System Update menu or Security menu in the Setting), your Manufacturers Warranty 65 Sprint_H_IIB_.book Page 66 Friday, September 6, 2013 5:08 PM device downloads some Updates automatically from time to time. Your device will, in most cases, ask for your consent before installing any Update. However, given the importance of receiving timely Updates for security software to defend against new threats, such Update may be automatically downloaded and installed. We recommend that you check availability of any new Updates periodically for optimal use of your device. If you want to avoid any use of network data for the Update downloads, then you should choose the Wi-Fi Only option in the Setting. 6. Some features of the Software may require your device to have access to the internet and may be subject to restrictions imposed by your network or internet provider. Unless your device is connected to the internet through Wi-Fi connection, the Software will access through your mobile network, which may result in additional charges depending on your payment plan. In addition, your enjoyment of some features of the Software may be affected by the suitability and performance of your device hardware or data access. 7. SOFTWARE TRANSFER. You may not transfer this EULA or the rights to the Software granted herein to any third party unless it is in connection with the sale of the mobile device which the Software accompanied. In such event, the transfer must include all of the Software (including all component parts, the 66 Manufacturers Warranty Sprint_H_IIB_.book Page 67 Friday, September 6, 2013 5:08 PM media and printed materials, any upgrades, this EULA) and you may not retain any copies of the Software. The transfer may not be an indirect transfer, such as a consignment. Prior to the transfer, the end user receiving the Software must agree to all the EULA terms. 8. EXPORT RESTRICTIONS. You acknowledge that the Software is subject to export restrictions of various countries. You agree to comply with all applicable international and national laws that apply to the Software, including all the applicable export restriction laws and regulations. 9. TERMINATION. This EULA is effective until terminated. Your rights under this License will terminate automatically without notice from Samsung if you fail to comply with any of the terms and conditions of this EULA. Upon termination of this EULA, you must cease all use of the Software and destroy all copies, full or partial, of the Software. 10. DISCLAIMER OF WARRANTY. UNLESS SEPARATELY STATED IN A WRITTEN EXPRESS LIMITED WARRANTY ACCOMPANYING YOUR DEVICE, ALL SOFTWARE PROVIDED BY SAMSUNG WITH THIS MOBILE DEVICE (WHETHER INCLUDED WITH THE DEVICE, DOWNLOADED, OR OTHERWISE OBTAINED) IS PROVIDED "AS IS" AND ON AN "AS AVAILABLE" BASIS, WITHOUT WARRANTIES OF ANY KIND FROM Manufacturers Warranty 67 Sprint_H_IIB_.book Page 68 Friday, September 6, 2013 5:08 PM SAMSUNG, EITHER EXPRESS OR IMPLIED. TO THE FULLEST EXTENT POSSIBLE PURSUANT TO APPLICABLE LAW, SAMSUNG DISCLAIMS ALL WARRANTIES EXPRESS, IMPLIED, OR STATUTORY, INCLUDING, BUT NOT LIMITED TO, IMPLIED WARRANTIES OF MERCHANTABILITY, SATISFACTORY QUALITY OR WORKMANLIKE EFFORT, FITNESS FOR A PARTICULAR PURPOSE, RELIABILITY OR AVAILABILITY, ACCURACY, LACK OF VIRUSES, QUIET ENJOYMENT, NON INFRINGEMENT OF THIRD PARTY RIGHTS OR OTHER VIOLATION OF RIGHTS. SOME JURISDICTIONS DO NOT ALLOW EXCLUSIONS OR LIMITATIONS OF IMPLIED WARRANTIES, SO THE ABOVE EXCLUSIONS OR LIMITATIONS MAY NOT APPLY TO YOU. NO ADVICE OR INFORMATION, WHETHER ORAL OR WRITTEN, OBTAINED BY YOU FROM SAMSUNG OR ITS AFFILIATES SHALL BE DEEMED TO ALTER THIS DISCLAIMER BY SAMSUNG OF WARRANTY REGARDING THE SOFTWARE, OR TO CREATE ANY WARRANTY OF ANY SORT FROM SAMSUNG. 11. THIRD-PARTY APPLICATIONS. Certain third party applications may be included with, or downloaded to this mobile device. Samsung makes no representations whatsoever about any of these applications. Since Samsung has no control over such applications, you acknowledge and agree that Samsung is not 68 Manufacturers Warranty Sprint_H_IIB_.book Page 69 Friday, September 6, 2013 5:08 PM responsible for the availability of such applications and is not responsible or liable for any content, advertising, products, services, or other materials on or available from such applications. You expressly acknowledge and agree that use of third party applications is at your sole risk and that the entire risk of unsatisfactory quality, performance, accuracy and effort is with you. It is up to you to take precautions to ensure that whatever you select to use is free of such items as viruses, worms, Trojan horses, and other items of a destructive nature. References on this mobile device to any names, marks, products, or services of any third-parties are provided solely as a convenience to you, and do not constitute or imply an endorsement, sponsorship, or recommendation of, or affiliation with the third party or its products and services. You agree that Samsung shall not be responsible or liable, directly or indirectly, for any damage or loss, including but not limited to any damage to the mobile device or loss of data, caused or alleged to be caused by, or in connection with, use of or reliance on any such third party content, products, or services available on or through any such application. You acknowledge and agree that the use of any third-party application is governed by such third party application provider's Terms of Use, License Agreement, Privacy Policy, or other such agreement and that any information or Manufacturers Warranty 69 Sprint_H_IIB_.book Page 70 Friday, September 6, 2013 5:08 PM personal data you provide, whether knowingly or unknowingly, to such third-party application provider, will be subject to such third party application provider's privacy policy, if such a policy exists. SAMSUNG DISCLAIMS ANY RESPONSIBILITY FOR ANY DISCLOSURE OF INFORMATION OR ANY OTHER PRACTICES OF ANY THIRD PARTY APPLICATION PROVIDER. SAMSUNG EXPRESSLY DISCLAIMS ANY WARRANTY REGARDING WHETHER YOUR PERSONAL INFORMATION IS CAPTURED BY ANY THIRD PARTY APPLICATION PROVIDER OR THE USE TO WHICH SUCH PERSONAL INFORMATION MAY BE PUT BY SUCH THIRD PARTY APPLICATION PROVIDER. 12. SAMSUNG APPLICATIONS. Certain Samsung applications and services may be included with, or downloaded to, this mobile device. Many of them require Samsung Services membership registration ("Samsung Account"), and your rights and obligations will be set forth in separate Samsung Account terms and conditions and privacy policies. There are non-Samsung Account applications and services that require your consent to their separate terms and conditions and privacy policies. You expressly acknowledge and agree that your use of such applications and services will be subject to the applicable terms and conditions and privacy policies. 70 Manufacturers Warranty Sprint_H_IIB_.book Page 71 Friday, September 6, 2013 5:08 PM 13. LIMITATION OF LIABILITY. SAMSUNG WILL NOT BE LIABLE FOR ANY DAMAGES OF ANY KIND ARISING OUT OF OR RELATING TO THE USE OR THE INABILITY TO USE THE SOFTWARE OR ANY THIRD PARTY APPLICATION, ITS CONTENT OR FUNCTIONALITY, INCLUDING BUT NOT LIMITED TO DAMAGES CAUSED BY OR RELATED TO ERRORS, OMISSIONS, INTERRUPTIONS, DEFECTS, DELAY IN OPERATION OR TRANSMISSION, COMPUTER VIRUS, FAILURE TO CONNECT, NETWORK CHARGES, IN-APP PURCHASES, AND ALL OTHER DIRECT, INDIRECT, SPECIAL, INCIDENTAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES EVEN IF SAMSUNG HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. SOME JURISDICTIONS DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES, SO THE ABOVE EXCLUSIONS OR LIMITATIONS MAY NOT APPLY TO YOU. NOTWITHSTANDING THE FOREGOING, SAMSUNG ELECTRONIC CO.'S TOTAL LIABILITY TO YOU FOR ALL LOSSES, DAMAGES, CAUSES OF ACTION, INCLUDING BUT NOT LIMITED TO THOSE BASED ON CONTRACT, TORT, OR OTHERWISE, ARISING OUT OF YOUR USE OF THE SOFTWARE OR THIRD PARTY APPLICATIONS ON THIS MOBILE DEVICE, OR ANY OTHER PROVISION OF THIS EULA, SHALL NOT EXCEED THE Manufacturers Warranty 71 Sprint_H_IIB_.book Page 72 Friday, September 6, 2013 5:08 PM AMOUNT PURCHASER PAID SPECIFICALLY FOR THIS MOBILE DEVICE OR ANY SUCH THIRD PARTY APPLICATION THAT WAS INCLUDED WITH THIS MOBILE DEVICE. THE FOREGOING LIMITATIONS, EXCLUSIONS, AND DISCLAIMERS (INCLUDING SECTIONS 10, 11, 12 AND 13) SHALL APPLY TO THE MAXIMUM EXTENT PERMITTED BY APPLICABLE LAW, EVEN IF ANY REMEDY FAILS ITS ESSENTIAL PURPOSE. 14. U.S. GOVERNMENT END USERS RESTRICTED RIGHTS. The Software is licensed only with "restricted rights" and as

"commercial items" consisting of "commercial software" and "commercial software documentation" with only those rights as are granted to all other end users pursuant to the terms and conditions herein. All Products are provided only with "restricted rights" with only those rights as are granted to all other end users pursuant to the terms and conditions herein. All Software and Products are provided subject to Federal Acquisition Regulation (FAR) 52.227.19. 15. APPLICABLE LAW. This EULA is governed by the laws of the jurisdiction where you are a resident or, if a resident of the United States, by the laws of the state of Texas, without regard to its conflict of law provisions. This EULA shall not be governed by the UN Convention on Contracts for the International Sale of Goods, the application of which is expressly excluded. 72 Manufacturers Warranty Sprint_H_IIB_.book Page 73 Friday, September 6, 2013 5:08 PM 16. DISPUTE RESOLUTION.

(a) Non-United States residents. If a dispute, controversy or difference arising in any way from this EULA or your use of the Software is not amicably settled, it shall be subject to the non-exclusive jurisdiction of the courts of the jurisdiction where you are a resident. Notwithstanding the foregoing, Samsung may apply for injunctive remedies (or an equivalent type of urgent legal relief) in any jurisdiction.

(b) United States residents. ALL DISPUTES WITH SAMSUNG ARISING IN ANY WAY FROM THIS EULA OR YOUR USE OF THE SOFTWARE SHALL BE RESOLVED EXCLUSIVELY THROUGH FINAL AND BINDING ARBITRATION, AND NOT BY A COURT OR JURY. Any such dispute shall not be combined or consolidated with any other person's or entity's claim or dispute, and specifically, without limitation of the foregoing, shall not under any circumstances proceed as part of a class action. The arbitration shall be conducted before a single arbitrator, whose award may not exceed, in form or amount, the relief allowed by the applicable law. The arbitration shall be conducted according to the American Arbitration Association (AAA) Commercial Arbitration Rules applicable to consumer disputes. This arbitration provision is entered pursuant to the Federal Arbitration Act. The laws of the State of Texas, without reference Manufacturers Warranty 73 Sprint_H_IIB_.book Page 74 Friday, September 6, 2013 5:08 PM to its choice of laws principles, shall govern the interpretation of the EULA and all disputes that are subject to this arbitration provision. The arbitrator shall decide all issues of interpretation and application of this arbitration provision and the EULA. For any arbitration in which your total damage claims, exclusive of attorney fees and expert witness fees, are $5,000.00 or less

("Small Claim"), the arbitrator may, if you prevail, award your reasonable attorney fees, expert witness fees and costs as part of any award, but may not grant Samsung its attorney fees, expert witness fees or costs unless it is determined that the claim was brought in bad faith. In a Small Claim case, you shall be required to pay no more than half of the total administrative, facility and arbitrator fees, or $50.00 of such fees, whichever is less, and Samsung shall pay the remainder of such fees. Administrative, facility and arbitrator fees for arbitrations in which your total damage claims, exclusive of attorney fees and expert witness fees, exceed $5,000.00

("Large Claim") shall be determined according to AAA rules. In a Large Claim case, the arbitrator may grant to the prevailing party, or apportion among the parties, reasonable attorney fees, expert witness fees and costs. Judgment may be entered on the arbitrator's award in any court of competent jurisdiction. This arbitration provision also applies to claims against Samsung's employees, representatives and affiliates if any such claim arises from the 74 Manufacturers Warranty Sprint_H_IIB_.book Page 75 Friday, September 6, 2013 5:08 PM licensing or use of the Software. You may opt out of this dispute resolution procedure by providing notice to Samsung no later than 30 calendar days from the date of the first consumer purchaser's purchase of this device. To opt out, you must send notice by e-mail to optout@sta.samsung.com, with the subject line:

"Arbitration Opt Out." You must include in the opt out e-mail (a) your name and address; (b) the date on which the device was purchased;

(c) the device model name or model number;

and (d) the IMEI or MEID or Serial Number, as applicable, if you have it (the IMEI or MEID or Serial Number can be found (i) on the device box; (ii) on the device information screen, which can be found under "Settings;" (iii) on a label on the back of the device beneath the battery, if the battery is removable; and (iv) on the outside of the device if the battery is not removable). Alternatively, you may opt out by calling 1-888-987-4357 no later than 30 calendar days from the date of the first consumer purchaser's purchase of the device and providing the same information. These are the only two forms of notice that will be effective to opt out of this dispute resolution procedure. Opting out of this dispute resolution procedure will not affect your use of the device or its preloaded Software, and you will continue to enjoy the benefits of this license. 17. ENTIRE AGREEMENT; SEVERABILITY. This EULA is the entire agreement between you Manufacturers Warranty 75 Sprint_H_IIB_.book Page 76 Friday, September 6, 2013 5:08 PM and Samsung relating to the Software and supersedes all prior or contemporaneous oral or written communications, proposals and representations with respect to the Software or any other subject matter covered by this EULA. If any provision of this EULA is held to be void, invalid, unenforceable or illegal, the other provisions shall continue in full force and effect.

[090413]

76 Manufacturers Warranty Sprint_H_IIB_.book Page 77 Friday, September 6, 2013 5:08 PM General Terms and Conditions of Service Please note that these terms may not be the most current version. A current version of the terms is available at our website at sprint.com/termsandconditions or upon request. Para solicitar esta literatura en espaol, por favor contactar a 1-800-777-4681 o visitar a sprint.com/espanol. Basic Definitions In this document: (1) we, us, our, and Sprint mean Sprint Solutions, Inc., as contracting agent on behalf of the applicable Sprint affiliated entities providing the products and Services; (2) you, your, customer, and user mean an account holder with us or any user of our Devices or Services; (3) Device means any phone, aircard, mobile broadband device, any other device, accessory, or other product that we provide you, we sell to you, or is active on your account with us; and (4) Service means Sprint-branded offers, rate plans, options, wireless services, billing services, applications, programs, products, software, or Devices on your account with us. Service(s) v.7-1-13 General Terms and Conditions of Service 77 Sprint_H_IIB_.book Page 78 Friday, September 6, 2013 5:08 PM also includes any other product or service that we offer or provide to you that references these General Terms and Conditions of Service

(Ts&Cs). The Service Agreement These Ts&Cs are part of your service agreement with us (the Agreement) and constitute a contract under which we provide you Services under terms and conditions that you accept. THIS AGREEMENT CONTAINS A MANDATORY ARBITRATION PROVISION WITH A CLASS WAIVER, A REPRESENTATIVE ACTION WAIVER, AND A JURY WAIVER PROVISION. In addition to these Ts&Cs, there are several parts of the Agreement, which includes but is not limited to the following: (i) the subscriber agreement and transaction materials that you receive and accept; (ii) the plan(s) that you chose as set forth in our written services and transaction materials that we provide or refer you to during the sales transaction, including on-line and telephone transactions (if your service plan is not specifically set forth in any in-store brochure or printed materials, the requirements and terms set forth in the current written Agreement and transaction materials apply); (iii) any confirmation materials and invoices that we may provide to you; and (iv) the terms set forth in the coverage map brochures. It is important 78 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 79 Friday, September 6, 2013 5:08 PM that you carefully read all of the terms of the Agreement. Additional Terms Additional terms will apply when you use certain applications, programs, Devices, and services, and these terms will be provided to you prior to your use of the items. Depending on who provides the items, the terms may come from Sprint or a third party. You are subject to any terms provided by the third party, and the terms are directly between you and that third party. Sprint is not responsible for these third-party items and associated terms. Additional terms will also apply if you activate Services as part of a bundle with another companys services (for example, cable services, home phone services, etc.). The additional terms for bundled Services may either modify or replace certain provisions in these Ts&Cs, including terms relating to activation, invoicing, payment, and disputing charges. Also, a different dispute resolution provision may apply to services provided by another company (the dispute resolution provisions in this Agreement will still apply to our Services). You will be provided details on any additional terms with your selection of any bundled Service. For employee and organization discounts, the discount percentage may vary from month-to-month based on the terms of the agreement between your employer, v.7-1-13 General Terms and Conditions of Service 79 Sprint_H_IIB_.book Page 80 Friday, September 6, 2013 5:08 PM association, or organization and Sprint. The discount will be zero after your agreement or your organizations agreement with Sprint ends. Additional terms and eligibility requirements regarding organization discounts will be provided to you. Our Policies Services are subject to our business policies, practices, and procedures (Policies). You agree to adhere to all of our Policies when you use our Services. Our Policies are subject to change at anytime with or without notice. When You Accept The Agreement You must have the legal capacity to accept the Agreement. You accept the Agreement when you do any of the following: (a) accept the Agreement through any printed, oral, or electronic statement, including on the Web by electronically marking that you have reviewed and accepted; (b) attempt to or in any way use the Services; (c) pay for the Services; or (d) open any package or start any program that says you are accepting the Agreement when doing so. If you dont want to accept the Agreement, dont do any of these things. 80 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 81 Friday, September 6, 2013 5:08 PM Term Commitments & Early Termination Fees Sprint provides a variety of Services, some of which require you to maintain Your Services on a month to month basis or for a minimum term, usually 1 or 2 years (Term Commitment). If your Agreement contains a Term Commitment, you will be charged a fee (Early Termination Fee) for each line of Service that you terminate early (i.e., prior to satisfying the Term Commitment) or for each line of Service that we terminate early for good reason (for example, violating the payment or other terms of the Agreement) but such Early Termination Fee will be prorated based on your remaining Term Commitment. Early Termination Fees are a part of our rates. Any Term Commitment, the length of the Term Commitment, and the applicable Early Termination Fee amounts and proration will be disclosed to you during the sales transaction. Carefully review any Term Commitment and Early Termination Fee requirements prior to selecting Services. After you have satisfied your Term Commitment, your Services continue on a month-to-month basis under the then-

current Terms and Conditions and Service policies. Services offered on a subscription basis, as described in the Account & Service Charges section, may not require a Term Commitment and may not automatically renew. v.7-1-13 General Terms and Conditions of Service 81 Sprint_H_IIB_.book Page 82 Friday, September 6, 2013 5:08 PM As explained directly below, there are instances when you will not be responsible for an Early Termination Fee for terminating Services early. When You Dont Have To Pay An Early Termination Fee You arent responsible for paying an Early Termination Fee when terminating Services: (a) provided on a month-to-month basis; (b) provided on a subscription basis that do not include a Term Commitment; (c) consistent with our published trial period return policy; or (d) in response to a materially adverse change that we make to the Agreement as described directly below. Our Right To Change The Agreement &

Your Related Rights We may change any part of the Agreement at any time, including, but not limited to, rates, charges, how we calculate charges, discounts, coverage, technologies used to provide services, or your terms of Service. If you lose your eligibility for a particular rate plan or if a particular rate plan is no longer supported or available, we may change your rate plan to one for which you qualify. We will provide you notice of material changesand we may provide you notice of non-material changesin a manner consistent with this Agreement

(see Providing Notice To Each Other 82 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 83 Friday, September 6, 2013 5:08 PM Under The Agreement section). If a change we make to the Agreement is material and has a material adverse effect on Services under your Term Commitment, you may terminate each line of Service materially adversely affected without incurring an Early Termination Fee only if:

(a) you call us within 30 days after the effective date of the change; (b) you specifically advise us that you wish to cancel Services because of a material change to the Agreement that we have made; and (c) we fail to negate the change after you notify us of your objection to it. If you do not notify us and cancel Service within 30 days of the change, an Early Termination Fee will apply if you terminate Services before the end of any applicable Term Commitment. Our Right To Suspend Or Terminate Services We can, without notice, suspend or terminate any Service at any time for any reason. For example, we can suspend or terminate any Service for the following: (a) late payment; (b) exceeding an Account Spending Limit; (c) harassing/threatening/abusing/

offending our employees or agents; (d) providing false or inaccurate information; (e) interfering with our operations; (f) using/

suspicion of using Services in any manner restricted by or inconsistent with the Agreement v.7-1-13 General Terms and Conditions of Service 83 Sprint_H_IIB_.book Page 84 Friday, September 6, 2013 5:08 PM and Policies; (g) breaching, failing to follow, or abusing the Agreement or Policies; (h) providing false, inaccurate, dated, or unverifiable identification or credit information or becoming insolvent or bankrupt; (i) modifying a Device from its manufacturer specifications (for example, rooting the device); (j) failing to use our Services for an extended period of time; (k) failing to maintain an active Device in connection with our Services; or (l) if we believe the action protects our interests, any customers interests, or our networks. Your Right To Change Services & When Changes Are Effective The account holder can typically change Services upon request. In some instances, changes may be conditioned on payment of an Early Termination Fee or certain other charges, or they may require a new Term Commitment. Changes to Services are usually effective at the start of the next full invoicing cycle. If the changes take place sooner, your invoice may reflect pro-rated charges for your old and new Services. We may, but are not obligated to, provide you the opportunity to authorize someone else to make changes to your Services, which will include the authority to make changes that will extend your Term 84 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 85 Friday, September 6, 2013 5:08 PM Commitment. You are responsible for any changes to your Services made by a person you authorize, and those changes will be treated as modifications to this Agreement. Your Right To Terminate Services You can terminate Services at any time by calling us and requesting that we deactivate all Services. In addition, if you return or provide your Device to Sprint and fail to either deactivate service on the Device or activate another Device in connection with your Service, we reserve the right to terminate your Service, and if you are subject to a Term Commitment, you may be charged all or part of an Early Termination Fee. You are responsible for all charges billed or incurred prior to deactivation. If Services are terminated before the end of your invoicing cycle, we wont prorate charges to the date of termination and you wont receive a credit or refund for any unused Services. Except as provided above, if you are subject to an Early Termination Fee, you must also pay the invoiced Early Termination Fee for each line of Service that you terminate early. Credit Checks & Credit Information We agree to provide you Services on the condition that you have and maintain satisfactory credit according to our standards and policies. You agree to provide information v.7-1-13 General Terms and Conditions of Service 85 Sprint_H_IIB_.book Page 86 Friday, September 6, 2013 5:08 PM that we may request or complete any applications that we may provide you to facilitate our review. We rely on the credit information you furnish, credit bureau reports or other data available from commercial credit reference services, and other information (such as payment history with us) to determine whether to provide or continue to provide you Services. The Services we offer you can vary based on your credit history. We may at any time, based on your credit history, withdraw or change Services or place limits or conditions on the use of our Services. You agree to provide us updated credit information upon request. We may provide your payment history and other account billing/charge information to any credit reporting agency or industry clearinghouse. Account Spending Limits (ASL) An ASL is a temporary or permanent limit

(typically based on credit history, payment history, or to prevent fraud) that we place on the amount of unpaid charges you can accumulate on your account, regardless of when payment on those charges is due. We reserve the right to determine which charges count toward an ASL. If you have an ASL, we may suspend your Services without prior notice if your account balance reaches the ASL, even if your account is not past due. We may impose or increase an ASL at any time with notice. An ASL is for our 86 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 87 Friday, September 6, 2013 5:08 PM benefit only and should not be relied on by you to manage usage. Deposits & Returning Deposits We may at any time require a deposit as a guarantee of payment for you to establish or maintain Service (Deposit). By providing us a Deposit, you grant us a security interest for all current or future amounts owed to us. We may change the Deposit at any time with notice. You cant use a Deposit to make or delay payments. The Deposit, the length of time we hold the Deposit, and changes to the Deposit are determined based on your credit history, payment history, and other factors. Unless prohibited by law, we may mix Deposits with our other funds and it wont earn interest, and we reserve the right to return the Deposit as a credit on your invoice at anytime. If your Services are terminated for any reason, we may keep and apply your Deposit to any outstanding charges. Well send any remaining portion of the Deposit to your last known address within 90 days after your final invoiceif it is returned to us, we will forward it on to the appropriate state authorities to the extent required by law. Restrictions On Using Services You cant use our Services: (a) in a way that could cause damage or adversely affect any of our other customers or our reputation, networks, v.7-1-13 General Terms and Conditions of Service 87 Sprint_H_IIB_.book Page 88 Friday, September 6, 2013 5:08 PM property, or Services; or (b) in any way prohibited by the terms of our Services, the Agreement, or our Policies. You cannot in any manner resell the Services to another party. For additional restrictions on the use of our Services, see our Acceptable Use Policy and Visitors Agreement, which are available on our website, and the detailed plan or other information on Services that we provide or refer you to during the sales transaction. Your Device, Number & Email Address We dont manufacture any Device that we might sell to you or that is associated with our Services, and we arent responsible for any defects, acts, or omissions of the manufacturer. The only warranties on your Device are the limited warranties given to you by the manufacturer directly or that we pass through. Device performance may vary based on device specifications (for example, a devices software, memory, and storage), and device performance may impact access to all of our Services. Your Device is designed to be activated on our networks and in other coverage areas that we may make available to you. As programmed, it will not accept wireless service from another carrier. Except for any legal right you may have to port/transfer your phone number to another carrier, you have noand cannot gain any (for example, through publication, use, etc.) 88 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 89 Friday, September 6, 2013 5:08 PM proprietary, ownership, or other rights to any phone number, identification number, email address, or other identifier that we assign to you, your Device, or your account. Well notify you if we decide to change or reassign them. Your CDMA Sprint PCS phone may have software programming lock that protects certain of the handsets operating parameters against unauthorized reprogramming. If your device has a software programming lock, and you wish to obtain the software program lock code for your CDMA Sprint PCS phone, please visit sprint.com or call 1-888-211-4727 for information and eligibility requirements. Porting/Transferring Phone Numbers We dont guarantee that number transfers to or from us will be successful. If you authorize another carrier to transfer a number away from us, then that is considered a request by you to us to terminate all of the Services associated with that number. Youre responsible for all charges billed or incurred prior to deactivation and for any applicable Early Termination Fees. Coverage; Where Your Device Will Work;

Service Speeds Our coverage maps are available at our authorized retail locations and on sprint.com. The specific network coverage you get will v.7-1-13 General Terms and Conditions of Service 89 Sprint_H_IIB_.book Page 90 Friday, September 6, 2013 5:08 PM depend on the radio transmissions your Device can pick up and Services youve chosen. Our coverage maps provide high level estimates of our coverage areas when using Services outdoors under optimal conditions. Coverage isnt available everywhere. Coverage and Service speeds are not guaranteed. Coverage is subject to change without notice. Service speeds may depend on the Service purchased. Actual speeds will vary. Estimating wireless coverage, signal strength, and Service speed is not an exact science. There are gaps in coverage within our estimated coverage areas that-along with other factors both within and beyond our control (for example, network problems, network or Internet congestion, software, signal strength, your Device, structures, buildings, weather, geography, topography, server speeds of the websites you access, actions of third parties, etc.)-

may result in dropped and blocked connections, slower Service speeds, or otherwise impact the quality of Service. Services that rely on location information, such as E911 and GPS navigation, depend on your Devices ability to acquire satellite signals (typically not available indoors) and network coverage. While your Device is receiving a software update, you may be 90 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 91 Friday, September 6, 2013 5:08 PM unable to use your Device in any manner until the software update is complete. Roaming The term roaming typically refers to coverage on another carriers network that we may make available to you based on our agreements with other carriers. These agreements may change from time to time, and roaming coverage is subject to change without notice. Your ability to receive roaming coverage depends on the radio transmissions your Device can pick up and the availability of roaming coverage. We make no guarantee that roaming coverage will be available. Roaming coverage may exist both within and outside our network coverage areas. Your Device will generally indicate when youre roaming. Depending on your Services, separate charges or limits on the amount of minutes used while roaming may apply. Certain Services may not be available or work the same when roaming (for example, data Services, voicemail, call waiting, etc.). For information on whether roaming applies, see your service plan details. About Data Services & Content Our data Services and your Device may allow you to access the Internet, text, pictures, video, games, graphics, music, email, applications, sound, and other materials (Data Content) or send Data Content elsewhere. Some Data v.7-1-13 General Terms and Conditions of Service 91 Sprint_H_IIB_.book Page 92 Friday, September 6, 2013 5:08 PM Content is available from us or our vendors, while other Data Content can be accessed from others (for example, third party websites, games, ringers, applications, etc.). We make absolutely no guarantees about the Data Content that you access on your Device. Data Content may be: (1) unsuitable for children/minors; (2) unreliable or inaccurate; or (3) offensive, indecent, or objectionable. Youre solely responsible for evaluating the Data Content accessed by you or anyone through your Services. We strongly recommend that you monitor data usage by children/minors. Data Content from third parties may also harm your Device or its software. We are not responsible for any Data Content. We are not responsible for any damage caused by any Data Content that you access through your Services, that you load on your Device, or that you request that our representatives access or load on your Device. To protect our networks and Services or for other reasons, we may place restrictions on accessing certain Data Content (such as certain websites, applications, etc.); impose separate charges; limit throughput or the amount of data that you can transfer; or otherwise limit or terminate Services. If we provide you storage for Data Content that you have purchased, then we may delete the Data Content without notice or place restrictions/limits on the use of storage areas. Data Content stored on a Device, 92 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 93 Friday, September 6, 2013 5:08 PM transmitted over our networks, or stored by Sprint may be deleted, modified, or damaged. You may not be able to make or receive voice calls while using data Services. Data Content provided by our vendors or third parties is subject to cancellation or termination at any time without notice to you, and you may not receive a refund for any unused portion of the Data Content. Specific Terms & Restrictions On Using Data Services In addition to the rules for using all of our other Services, unless we identify the Service or Device that you have selected as specifically intended for that purpose (for example, wireless routers, Data Link, etc.), you cant use our data Services: (1) with server devices or host computer applications or other systems that drive continuous, heavy traffic or data sessions;

(2) as a substitute or backup for private lines or frame relay connections; or (3) for any other unintended use as we determine in our sole discretion. We reserve the right to limit, suspend, or constrain any heavy, continuous data usage that adversely impacts our networks performance or hinders access to our networks. If your Services include Web or data access, you also cant use your Device as a modem for computers or other equipment, unless we identify the Service or Device you have selected as specifically intended for that v.7-1-13 General Terms and Conditions of Service 93 Sprint_H_IIB_.book Page 94 Friday, September 6, 2013 5:08 PM purpose (for example, with phone as modem plans, Sprint Mobile Broadband card plans, wireless router plans, etc.). Software License If Sprint provides you software as part of the Service and there are not software license terms provided with the software (by Sprint or by a third party), then Sprint grants you a limited, revocable, non-exclusive, non-transferable license to use the software to access the Services for your own individual use. You will not sell, resell, transfer, copy, translate, publish, create derivative works of, make any commercial use of, modify, reverse engineer, decompile, or disassemble the software. Sprint may revoke this license at any time. Fees, Activation & Miscellaneous Charges Based on our Policies, we may charge activation, prepayment, reactivation, program, or other fees to establish, change, or maintain Services. Certain transactions may also be subject to a charge (for example, convenience payment, changing phone numbers, handset upgrades, etc.). You will be provided notice of these types of fees before we complete the requested transaction. 94 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 95 Friday, September 6, 2013 5:08 PM Account & Service Charges You are responsible for all charges associated with your account and the Services on your account, no matter who adds or uses the Services. Charges include, but are not limited to, the monthly recurring charges, usage charges, charges for additional services, taxes, surcharges, and fees associated with your Services. These charges are described or referred to during the sales transaction, in our marketing materials, and in confirmation materials that we may send to you. Depending on your Services, charges for additional services may include operator and directory assistance, voicemail, call forwarding, data calls, texts, and Web access. If you (the account holder) allow end users to access or use your Devices, you authorize end users to access, download, and use Services. You may have the opportunity to purchase Services on a subscription basis where we assess subscription charges that allow you access to the Services and/or provide you a certain amount of use of the Services for a defined period of time. Depending on your Service, certain types of subscription charges may be assessed automatically upon activation and automatically assessed for subsequent subscription periods. Subscription Services offered on a recurring basis do not end until terminated by you or us. Subscription charges for recurring Services occur at the beginning of v.7-1-13 General Terms and Conditions of Service 95 Sprint_H_IIB_.book Page 96 Friday, September 6, 2013 5:08 PM each bill cycle. Information regarding your bill cycle for subscription Services will be provided when you order the Services. For Services offered on a per-day basis, you will generally be charged for use before or at the time of use. In certain instances, we may charge you at some point after you use the Services. Unless otherwise disclosed, Services offered on a per-

day basis end 24 hours after Service is initiated. How We Calculate Your Charges For Billing Purposes Regular Voice Calls: We round up partial minutes of use to the next full minute. Time starts when you press Talk or your Device connects to the network and stops when you press End or the network connection otherwise breaks. Youre charged for all calls that connect, even to answering machines, voicemail, or voice transcription services. You wont be charged for unanswered calls or if you get a busy signal. For incoming calls answered, youre charged from the time shortly before the Device starts ringing until you press End or the network connection otherwise breaks. If charges vary depending on the time of day that you place or receive calls (for example, Nights and Weekend plans), youre charged for the entire call based on the rate that applies to the time period in which the call starts. Call time for a single call may be subject to a maximum duration and may be automatically terminated if 96 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 97 Friday, September 6, 2013 5:08 PM the maximum duration is exceeded. Rates that vary based on the time of access will be determined based on the location of the network equipment providing service and not the location of your Device or your Devices area code (if applicable). Push-to-Talk Charges: Charges for push-to-

talk calls are billed to the person who starts the call and calculated by multiplying the duration of the call by the applicable rate and number of participants. Youre charged at least 6 seconds of airtime for each call you start; subsequent communications in the same call are rounded up to and billed to the next second. Time begins when you press any button to start a push-to-talk call and ends approximately 6 seconds after completion of a communication to which no participant responds. Subsequent push-to-talk communications are considered new calls. Charges apply for the entire period of time the push-to-talk call is connected to our network. Depending on your plan, nationwide, international, or group push-to-talk calls may use the local push-to-talk minutes in your plan and result in additional or different charges. Responses to call alert transmissions are treated as new push-to-talk transmissions even when responding within 6 seconds of receiving the alert. Push-to-talk billing methods are subject to change as we introduce new push-

to-talk Services. v.7-1-13 General Terms and Conditions of Service 97 Sprint_H_IIB_.book Page 98 Friday, September 6, 2013 5:08 PM Data Usage: Unless we specifically tell you otherwise, data usage is measured in bytes, kilobytes, megabytes, and gigabytesnot in minutes/time. 1024 bytes equals 1 kilobyte

(KB), 1024 KB equals 1 megabyte, and 1024 megabytes equals 1 gigabyte. Bytes are rounded up to KB, so you will be charged at least 1 KB for each data usage session (data session). Rounding occurs at the end of each data session, and sometimes during a data session. Depending on your data Services, usage may be charged against an allowance or on a fixed price per KB, and you may be subject to limitations on the amount of data usage. If you are charged on a fixed price per KB, any fractional cents will be rounded up to the next cent. You are charged for all data directed to your Devices Internet address, including data sessions you did not initiate and for incomplete transfers. As long as your Device is connected to our data networks, you may incur data charges. Examples of data for which you will be charged includes the size of a requested file or Data Content (game, ringer, etc.); Web page graphics (logos, pictures, banners, advertisement, etc.); additional data used in accessing, transporting, and routing the file on our network; data from partial or interrupted downloads; re-sent data; and data associated with unsuccessful attempts to reach websites or use applications. These data charges are in addition to any charges for the 98 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 99 Friday, September 6, 2013 5:08 PM Data Content itself (game, ringer, etc.). Data used and charged to you will vary widely, even between identical actions or data sessions. Estimates of data usagefor example, the size of downloadable filesare not reliable predictors of actual usage. Your bill wont separately list the number of KB attributed to a specific action/data session. Your Bill Your bill provides you notice of your charges. It reflects monthly recurring charges (usually billed one bill cycle in advance), fees, taxes, Surcharges, product and equipment charges, subscription charges, and usage/transaction specific charges (usually billed in the bill cycle in which theyre incurred). Some usage charges, such as those that depend on usage information from a third party, may be billed in subsequent bill cycles and result in higher than expected charges for that month. Bill cycles and dates may change from time to time. Your bill may also include other important notices

(for example, changes to your Agreement, to your Service, legal notices, etc.). Your paper bill may not include itemized billing detail. More specific billing information is available online. Paper bills may be subject to an additional charge. Unless prohibited by law, other charges (for example, data Services or taxes and surcharges) will not include itemized detail but will be listed as total charges for a v.7-1-13 General Terms and Conditions of Service 99 Sprint_H_IIB_.book Page 100 Friday, September 6, 2013 5:08 PM category. If you choose Internet billing, you will not receive paper bills. Your Payments; Late Fees Payment is due in full as stated on your bill. If we do not receive payment in full by the date specified on your bill, a late payment charge, which may be charged at the highest rate permissible by law, may be applied to the total unpaid balance. We may also charge you any costs we pay to a collection agency to collect unpaid balances from you. If we bill you for amounts on behalf of a third party, payments received are first applied to our charges. You may be charged additional fees for certain methods of payment. We may charge you, up to the highest amount permitted by law, for returned checks or other payments paid by you and denied for any reason by a financial institution. Acceptance of payments (even if marked paid in full) does not waive our right to collect all amounts that you owe us. We may restrict your payment methods to cashiers check, money order, or other similar secure form of payment at any time for good reason. Taxes & Government Fees You agree to pay all federal, state, and local taxes, fees, and other assessments that were required by law to collect and remit to the government on the Services that we provide to you. These charges may change from time to 100 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 101 Friday, September 6, 2013 5:08 PM time without advance notice. If youre claiming any tax exemption, you must provide us with a valid exemption certificate. Tax exemptions generally wont be applied retroactively. Surcharges You agree to pay all Sprint surcharges

(Surcharges), which may include, but are not limited to: Federal Universal Service; Regulatory and Administrative charges; gross receipts charges, and other charges. Surcharges are not taxes, and we are not required by law to assess them. They are part of our rates we choose, at our discretion, to collect from you, to recover certain costs and are kept by us. The number and type of Surcharges will be provided on your invoice and may vary depending upon the location of the billing address of the Device and can change over time. We determine the amount for these charges, and these amounts are subject to change, as are the components used to calculate these amounts. We will provide you notice of any changes to Surcharges in a manner consistent with this Agreement (see Providing Notice To Each Other Under The Agreement section). However, because some Surcharges are based on amounts set by the government or based on government formulas, it will not always be possible to provide advance notice of new Surcharges or changes in the amount of v.7-1-13 General Terms and Conditions of Service 101 Sprint_H_IIB_.book Page 102 Friday, September 6, 2013 5:08 PM existing Surcharges. Information on Surcharges is provided during the sales transaction and is available on our website. Disputing Charges - You Must Still Pay Undisputed Charges Any dispute to a charge on your bill must be made within 60 days of the date of the bill that initially contained the charge. Disputes can only be made by calling or writing us as directed on your invoice or elsewhere. You accept all charges not properly disputed within the above time periodundisputed charges must still be paid as stated on your bill. Protecting Our Network & Services We can take any action to: (1) protect our networks, our rights and interests, or the rights of others; or (2) optimize or improve the overall use of our networks and Services. Some of these actions may interrupt or prevent legitimate communications and usage-for example, message filtering/blocking software to prevent spam or viruses; limiting throughput; limiting access to certain websites, applications, or other Data Content; prohibitions on unintended uses (for example, use as a dedicated line, or use as a monitoring service), etc. For additional information on what we do to protect our customers, networks, Services, and equipment, 102 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 103 Friday, September 6, 2013 5:08 PM see our Acceptable Use Policy and Visitors Agreement at our website. Your Privacy Our Privacy Policy is available on our website. To review the policy, visit sprint.com/legal/

privacy.html. This policy may change from time to time, so review it with regularity and care. Call Monitoring: To ensure the quality of our Services and for other lawful purposes, we may monitor or record calls you make to us or we make to you (for example, your conversations with our customer service or sales departments). Authentication and Contact: You (the account holder) may password protect your account information by establishing a personal identification number (PIN). You may also set a backup security question and answer in the event you forget your PIN. You agree to protect your PIN, passwords, and other account access credentials like your backup security question from loss or disclosure. You further agree that Sprint may, in our sole discretion, treat any person who presents your credentials that we deem sufficient for account access as you or an authorized user on the account for disclosure of information or changes in Service. You agree that we may contact you for Service-

related reasons through the contact information that you provide, through the Services or Devices to which you subscribe, or through v.7-1-13 General Terms and Conditions of Service 103 Sprint_H_IIB_.book Page 104 Friday, September 6, 2013 5:08 PM other available means, including text message, email, fax, recorded message, mobile, residential or business phone, or mail. CPNI: As we provide telecommunications products and Services to you (the account holder), we develop information about the quantity, technical configuration, type, location, and destination of telecommunications products and Services you use, as well as some other information found on your bill

(CPNI). Under federal law, you have the right and we have a duty to protect the confidentiality of your CPNI. For example, we implement safeguards that are designed to protect your CPNI, including authentication procedures when you contact us. For some accounts with a dedicated Sprint representative, we may rely on contacting your pre-established point of contact as the standard authentication measure. Third-Party Applications: If you use a third-

party application, the application may access, collect, use, or disclose your personal information or require Sprint to disclose your informationincluding location information

(when applicable)to the application provider or some other third party. If you access, use, or authorize third-party applications through the Services, you agree and authorize Sprint to provide information related to your use of the Services or the application(s). You understand that your use of third-party applications is subject to the third partys terms and conditions 104 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 105 Friday, September 6, 2013 5:08 PM and policies, including its privacy policy. Be sure that you have reviewed and are comfortable with the third partys policies before using its application on your device. Information on Devices: Your Device may contain sensitive or personal information (for example, pictures, videos, passwords, or stored credit card numbers). Sprint is not responsible for any information on your Device, including sensitive or personal information. If possible, you should remove or otherwise safeguard any sensitive or personal information when your Device is out of your possession or control, for example when you relinquish, exchange, return, or recycle your Device. By submitting your Device to us, you agree that our employees, contractors, or vendors may access all of the information on your Device. If you exchange, return, or recycle your Device through us, we typically attempt to erase all data on your Device, but you must remove all data from your Device before you provide it to us. Location-Enabled Services Our networks generally know the location of your Device when it is outdoors and/or turned on. By using various technologies to locate your Device, we can provide enhanced emergency 911 services and optional location-enabled services provided by us or a third party. Network coverage or environmental factors (such as structures, buildings, weather, geography, v.7-1-13 General Terms and Conditions of Service 105 Sprint_H_IIB_.book Page 106 Friday, September 6, 2013 5:08 PM landscape, and topography) can significantly impact the ability to access your Devices location information and use of location-

enabled services. You agree that any authorized user may access, use, or authorize Sprint or third-party location-

enabled applications through the Services. You understand that your use of such location-

enabled applications is subject to the applications terms and conditions and policies, including its privacy policy. If you activate location-enabled services for devices used by other authorized users, you agree to inform the authorized user(s) of the terms of use for location-enabled applications and that the Device may be located. 911 Or Other Emergency Calls Public safety officials advise that when making 911 or other emergency calls, you should always be prepared to provide your location information. Unlike traditional wireline phones, depending on a number of factors (for example, whether your Device is GPS-enabled, where you are, whether local emergency service providers have upgraded their equipment, etc.), 911 operators may not know your phone number, your location, or the location of your Device. In certain circumstances, an emergency call may be routed to a state patrol dispatcher or alternative location set by local emergency service providers. Enhanced 911 service (E911) 106 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 107 Friday, September 6, 2013 5:08 PM where enabled by local emergency authorities uses GPS technology to provide location information. Even when available, however, E911 does not always provide accurate location information. If your Device is indoors or for some other reason cannot acquire a satellite signal, you may not be located. Some Devices have a safety feature that prevents use of the keypad after dialing 911you should follow voice prompts when interacting with emergency service providers employing interactive voice response systems to screen calls. If Your Device Is Lost or Stolen Call us immediately if your Device is lost or stolen because you may be responsible for usage charges before you notify us of the alleged loss or theft. A lost or stolen Device does not reduce or remove your Term Commitment. You will remain liable for any monthly recurring charges associated with the Service on your Device after you notify us of the alleged loss or theft. You agree to cooperate if we choose to investigate the matter (provide facts, sworn statements, etc.). We may not waive any applicable Early Termination Fees if you choose to terminate Services as a result of loss or theft of your Device. v.7-1-13 General Terms and Conditions of Service 107 Sprint_H_IIB_.book Page 108 Friday, September 6, 2013 5:08 PM Disclaimer of Warranties UNLESS EXPRESSLY PROVIDED IN WRITING OTHERWISE, WE MAKE NO REPRESENTATIONS OR WARRANTIES, EXPRESS OR IMPLIED, INCLUDING (TO THE EXTENT ALLOWED BY LAW) ANY IMPLIED WARRANTY OF MERCHANTABILITY, NON-

INFRINGEMENT, OR FITNESS FOR A PARTICULAR PURPOSE CONCERNING YOUR SERVICES (INCLUDING YOUR DEVICE AND ANY SOFTWARE OR APPLICATIONS ON YOUR DEVICE). WE DONT PROMISE UNINTERRUPTED OR ERROR-FREE SERVICES AND DONT AUTHORIZE ANYONE TO MAKE WARRANTIES ON OUR BEHALF. SPRINT PROVIDES ALL SOFTWARE AND APPLICATIONS ON AN AS IS BASIS WITH ALL FAULTS, ERRORS, AND DEFECTS. You Agree We Are Not Responsible For Certain Problems You agree that neither we nor our parent, subsidiary, or affiliate companies, nor our vendors, suppliers, or licensors are responsible for any damages, delay, interruption or other failure to perform resulting from: (a) anything done or not done by someone else; (b) providing or failing to provide Services, including, but not limited to, deficiencies or problems with a Device or network coverage

(for example, dropped, blocked, interrupted Services, etc.); (c) traffic or other accidents, or 108 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 109 Friday, September 6, 2013 5:08 PM audio; or (i) things beyond our control, including acts of God (for example, weather-related phenomena, fire, earthquake, hurricane, etc.), riot, strike, war, terrorism, or government orders or acts. You should implement appropriate safeguards to secure your Device, computer, or equipment and to back up your information stored on each. any health-related claims relating to our Services; (d) Data Content or information accessed while using our Services; (e) an interruption or failure in accessing or attempting to access emergency services from a Device, including through 911, Enhanced 911 or otherwise; (f) interrupted, failed, or inaccurate location information services; (g) information or communication that is blocked by a spam filter;

(h) damage to your Device or any computer or equipment connected to your Device, or damage to or loss of any information stored on your Device, computer, equipment, or Sprint storage space from your use of the Services or from viruses, worms, or downloads of malicious content, materials, data, text, images, video, or v.7-1-13 General Terms and Conditions of Service 109 Sprint_H_IIB_.book Page 110 Friday, September 6, 2013 5:08 PM You Agree Our Liability Is Limited - No Consequential Damages. TO THE EXTENT ALLOWED BY LAW, OUR LIABILITY FOR MONETARY DAMAGES FOR ANY CLAIMS THAT YOU MAY HAVE AGAINST US IS LIMITED TO NO MORE THAN THE PROPORTIONATE AMOUNT OF THE SERVICE CHARGES ATTRIBUTABLE TO THE AFFECTED PERIOD. UNDER NO CIRCUMSTANCES ARE WE LIABLE FOR ANY INCIDENTAL, CONSEQUENTIAL, PUNITIVE, MULTIPLE, OR SPECIAL DAMAGES OF ANY NATURE WHATSOEVER ARISING OUT OF OR RELATED TO PROVIDING OR FAILING TO PROVIDE SERVICES IN CONNECTION WITH A DEVICE, INCLUDING, BUT NOT LIMITED TO, LOST PROFITS, LOSS OF BUSINESS, OR COST OF REPLACEMENT PRODUCTS OR SERVICES. DISPUTE RESOLUTION AND ARBITRATION PLEASE READ THIS CAREFULLY; IT AFFECTS YOUR RIGHTS In those rare instances where your concern is not resolved to your satisfaction through calls to our customer care, you and Sprint each agree to try to resolve those disputes in good faith after you provide written notice of the dispute as set forth below. If the dispute is not resolved, you and Sprint agree that the dispute will be resolved through individual 110 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 111 Friday, September 6, 2013 5:08 PM binding arbitration or small claims court, instead of courts of general jurisdiction. Mandatory Arbitration and Waiver of Class Action Instead of suing in court, you and Sprint agree to arbitrate all Disputes (as defined below) on an individual, non-

representative, basis. You agree that, by entering into this Agreement, you and Sprint are waiving the right to a trial by jury or to participate in a class action or representative action. This agreement to arbitrate is intended to be broadly interpreted. In arbitration, there is no judge or jury. Instead Disputes are decided by a neutral third-party arbitrator in a more informal process than in court. In arbitration, there is limited discovery and the arbitrators decision is subject to limited review by courts. However, just as a court would, the arbitrator must honor the terms of the Agreement and can award damages and relief, including any attorneys fees authorized by law. Disputes shall include, but are not limited to, any claims or controversies against each other related in any way to or arising out of in any way our Services or the Agreement, including, but not limited to, coverage, Devices, billing services and practices, v.7-1-13 General Terms and Conditions of Service 111 Sprint_H_IIB_.book Page 112 Friday, September 6, 2013 5:08 PM policies, contract practices (including enforceability), service claims, privacy, or advertising, even if the claim arises after Services have terminated. Disputes also include, but are not limited to, claims that: (a) you or an authorized or unauthorized user of the Services or Devices bring against our employees, agents, affiliates, or other representatives; (b) you bring against a third party, such as a retailer or equipment manufacturer, that are based on, relate to, or arise out of in any way our Services or the Agreement; or (c) that Sprint brings against you. Disputes also include, but are not limited to, (i) claims in any way related to or arising out of any aspect of the relationship between you and Sprint, whether based in contract, tort, statute, fraud, misrepresentation, advertising claims or any other legal theory;

(ii) claims that arose before this Agreement or out of a prior Agreement with Sprint; (iii) claims that are subject to on-going litigation where you are not a party or class member;

and/or (iv) claims that arise after the termination of this Agreement. Dispute Notice and Dispute Resolution Period Before initiating an arbitration or a small claims matter, you and Sprint each agree to first provide to the other a written notice

(Notice of Dispute), which shall contain: (a) 112 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 113 Friday, September 6, 2013 5:08 PM a written description of the problem and relevant documents and supporting information; and (b) a statement of the specific relief sought. A Notice of Dispute to Sprint should be sent to: General Counsel;

Arbitration Office; 12502 Sunrise Valley Drive, Mailstop VARESA0202-2C682;

Reston, Virginia 20191. Sprint will provide a Notice of Dispute to you in accordance with the Providing Notice To Each Other Under The Agreement section of this Agreement. Sprint will assign a representative to work with you and try to resolve your Dispute to your satisfaction. You and Sprint agree to make attempts to resolve the Dispute prior to commencing an arbitration or small claims action. If an agreement cannot be reached within forty-five (45) days of receipt of the Notice of Dispute, you or Sprint may commence an arbitration proceeding or small claims action. Arbitration Terms, Process, Rules and Procedures

(1) Unless you and Sprint agree otherwise, the arbitration will be conducted by a single, neutral arbitrator and will take place in the county of the last billing address of the Service. The arbitration will be governed by either: (a) rules that we mutually agree upon;

or (b) the JAMS Comprehensive Arbitration v.7-1-13 General Terms and Conditions of Service 113 Sprint_H_IIB_.book Page 114 Friday, September 6, 2013 5:08 PM Rules & Procedures (the JAMS Rules), as modified by this agreement to arbitrate, including the rules about the filing, administration, discovery and arbitrator fees. The JAMS rules are available on its website at jamsadr.com. Notwithstanding any JAMS Rule to the contrary or any other provision in arbitration rules chosen, by agreement, to govern the arbitration, we each agree that all issues regarding the Dispute are delegated to the arbitrator to decide, except that only a court (and not the arbitrator) shall decide any disagreements regarding the scope and enforceability of this agreement to arbitrate.

(2) The Federal Arbitration Act (FAA) applies to this Agreement and arbitration provision. We each agree that the FAAs provisionsnot state lawgovern all questions of whether a Dispute is subject to arbitration. To the extent that this agreement to arbitrate conflicts with the JAMS Policy on Consumer Arbitrations Pursuant to Pre-

Dispute Clauses Minimum Standards for Procedural Fairness (the Minimum Standards), the Minimum Standards in that regard will apply. However, nothing in this paragraph will require or allow you or Sprint to arbitrate on a class-wide, representative or consolidated basis.

(3) The arbitrator may award declaratory or injunctive relief only in favor of the individual party seeking relief and only to the extent 114 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 115 Friday, September 6, 2013 5:08 PM necessary to provide relief warranted by that partys individual claim. YOU AND SPRINT AGREE THAT EACH MAY BRING CLAIMS AGAINST THE OTHER ONLY IN AN INDIVIDUAL CAPACITY, AND NOT AS A CLASS MEMBER IN ANY PUTATIVE CLASS OR REPRESENTATIVE PROCEEDING. Further, unless both you and Sprint expressly agree otherwise, the arbitrator may not consolidate more than one persons claims, and may not otherwise preside over any form of a representative or class proceeding. If any portion of this provision is found to be unenforceable, then the entirety of this arbitration provision shall be null and void.

(4) We each are responsible for our respective costs, including our respective counsel, experts, and witnesses. Sprint will pay for any filing or case management fees associated with the arbitration and the professional fees for the arbitrators services.

(5) An arbitrators award will be a written statement of the disposition of each claim and will also provide a concise written statement of the essential findings and conclusions which form the basis of the award. The arbitrators decision and award is final and binding, with some limited court review under the FAA, and judgment on the award may be entered in any court with jurisdiction. v.7-1-13 General Terms and Conditions of Service 115 Sprint_H_IIB_.book Page 116 Friday, September 6, 2013 5:08 PM

(6) As an alternative to arbitration, we may resolve Disputes in small claims court in the county of your most recent billing address. In addition, this arbitration agreement does not prevent you from bringing your Dispute to the attention of any federal, state, or local government agency. Such agencies can, if the law allows, seek relief against Sprint on your behalf. No Trial By Jury and No Class Action IF FOR ANY REASON A CLAIM ARISING OUT OF OR RELATING TO THIS AGREEMENT IN ANY WAY PROCEEDS IN COURT RATHER THAN IN ARBITRATION, REGARDLESS OF WHETHER THE CLAIM IS AN ACTION, COUTERCLAIM OR ANY OTHER COURT PROCEEDING, WE EACH AGREE THAT TO THE EXTENT ALLOWED BY LAW, THERE WILL NOT BE A JURY TRIAL OR CLASS ACTION AND WE EACH UNCONDITIONALLY (1) WAIVE ANY RIGHT TO TRIAL BY JURY AND (2) WAIVE ANY RIGHT TO PURSUE DISPUTES ON A CLASSWIDE BASIS, INCLUDING JOINING A CLAIM WITH THE CLAIM OF ANY OTHER PERSON OR ENTITY OR ASSERT A CLAIM IN A REPRESENTATIVE CAPACTITY ON BEHALF OF ANYONE ELSE IN ANY OTHER PROCEEDING. 116 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 117 Friday, September 6, 2013 5:08 PM Indemnification You agree to indemnify, defend, and hold Sprint and our subsidiaries, affiliates, parent companies, vendors, suppliers, and licensors harmless from any claims arising out of or relating to your actions, including, but not limited to, your use of the Service and any information you submit, post, transmit, or make available via the Service; failing to provide appropriate notices regarding location-enabled services

(see Location-Enabled Services section);

failure to safeguard your passwords, backup question to your shared secret question, or other account information; or violating this Agreement or any policy referenced in this Agreement, any applicable law or regulation, or the rights of any third party. Providing Notice To Each Other Under The Agreement Except as the Agreement specifically provides otherwise, you must provide us notice by calling or writing us as instructed on your invoice. We will provide you notice through one or more of the following: in your bill, correspondence to your last known billing address, to any fax number or email address youve provided us, by calling you on your Device or any other phone number youve provided us, by voice message on your Device or any other phone v.7-1-13 General Terms and Conditions of Service 117 Sprint_H_IIB_.book Page 118 Friday, September 6, 2013 5:08 PM number youve provided us, or by text message on your Device. Contacting You Regarding Billing and Collections You expressly authorize, and specifically consent to allowing Sprint and any of Sprints agents to contact you in connection with any and all matters relating to that, for attempts to collect unpaid past due charges, Sprint and any of its agents may contact you at any mailing address, telephone number, cellular phone number, email address, or any other electronic address that you have provided, or may in the future provide, to Sprint. You agree and acknowledge that any email address or any other electronic address that you provide to Sprint is your private address and is not accessible to unauthorized third parties. For attempts to collect unpaid charges, you agree that in addition to individual persons attempting to communicate directly with you, any type of contact described above may be made using, among other methods, pre-recorded or artificial voice messages delivered by an automatic telephone dialing system, pre-set email messages delivered by an automatic emailing system, or any other pre-set electronic messages delivered by any other automatic electronic messaging system. 118 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 119 Friday, September 6, 2013 5:08 PM Other Important Terms Subject to federal law or unless the Agreement specifically provides otherwise, this Agreement is governed solely by the laws of the state encompassing the billing address of the Device, without regard to the conflicts of law rules of that state. If either of us waives or doesnt enforce a requirement under this Agreement in an instance, we dont waive our right to later enforce that requirement. Except as the Agreement specifically provides otherwise, if any part of the Agreement is held invalid or unenforceable, the rest of this Agreement remains in full force and effect. This Agreement isnt for the benefit of any third party except our corporate parents, affiliates, subsidiaries, agents, and predecessors and successors in interest. You cant assign the Agreement or any of your rights or duties under it, unless we agree to the assignment. We can assign the Agreement without notice. You cannot in any manner resell the Services to another party. The Agreement and the documents it incorporates make up the entire agreement between us and replaces all prior written or spoken agreementsyou cant rely on any contradictory documents or statements by sales or service representatives. The rights, obligations, and commitments in the Agreement thatby their naturewould logically continue beyond the termination of Services (for example, those relating to billing, payment, 911, v.7-1-13 General Terms and Conditions of Service 119 Sprint_H_IIB_.book Page 120 Friday, September 6, 2013 5:08 PM dispute resolution, no class action, no jury trial) survive termination of Services.

[End General Terms and Conditions of Service]

120 General Terms and Conditions of Service v.7-1-13 Sprint_H_IIB_.book Page 121 Friday, September 6, 2013 5:08 PM Important Message From Sprint Important Information about this devices open architecture. This device is an open device. What that means is that you are free to use it to access the Internet as you see fit. You may go to websites you like and you may download or use applications or software that you choose. Please take care to visit only trusted websites and download applications only from trusted entities. Sprint has no control over websites you visit or applications and software you download, and Sprints policies do not apply to those websites, applications or software. The websites you visit may place cookies or other files on your device when you visit them. Downloaded applications or software may access, use or share information on your device, like your contacts or your location. Although Sprint is excited to allow our customers to make their own choices about the Internet sites you wish to visit or the applications or software youd like to use, we do want to remind you that Sprint is not able to help you troubleshoot issues connected with your use of non-Sprint applications or software (such as the ones you may select and download to your Important Message From Sprint 121 Sprint_H_IIB_.book Page 122 Friday, September 6, 2013 5:08 PM Important Message From Sprint device). Sprint also will not be able to provide you credits for applications or software that you download from sources other than Sprint. And, Sprint is not liable for the websites you visit or anything you download or cause to be downloaded to your device. Damage related to websites visited or downloads to your device may not be covered by Sprints Service and Repair policy, or your device insurance policy. For more information about Sprints policies, products or services, please visit us at sprint.com. 122 Important Message From Sprint Sprint_H_IIB_.book Page 122 Friday, September 6, 2013 5:08 PM 2013 Sprint. Sprint and the logo are trademarks of Sprint. Other marks are the property of their respective owners. GH68-39471A Printed in China Sprint_N900P_IIB_Eng_TE_090613_F2

 

 

Availableapplicationsandservicesaresubjecttochangeatanytime. Table of Contents GetStarted YourPhoneataGlance SetUpYourPhone ActivateYourPhone CompletetheSetup SetUpVoicemail SprintAccountInformationandHelp SprintAccountPasswords ManageYourAccount SprintSupportServices PhoneBasics YourPhonesLayout KeyFunctions TurnYourPhoneOnandOff TurnYourScreenOnandOff TouchscreenNavigation MultiWindow YourHomeScreen CreatingShortcuts AddingandRemovingPrimaryShortcuts AddingandRemovingWidgets ExtendedHomeScreens RecentlyUsedApplications StatusBar EnterText TouchscreenKeyboards TextInputMethods GoogleVoiceTyping SamsungKeyboard Swype TipsforEditingText PhoneCalls MakePhoneCalls 1 1 1 3 3 4 5 5 5 6 7 7 7 8 8 9 14 15 15 16 16 17 17 18 19 19 19 19 20 20 21 23 23 i CallUsingtheKeypad CallfromLogs CallfromContacts CallaNumberinaTextMessage CallaNumberinanEmailMessage CallEmergencyNumbers Enhanced911(E911)Information ReceivePhoneCalls AnsweranIncomingCall MutetheRingingSound RejectanIncomingCall Voicemail RetrieveVoicemailMessages VoicemailNotification VisualVoicemail PhoneCallOptions DialingOptions CallerID CallWaiting 3-WayCalling CallForwarding In-callOptions SpeedDialing Logs ViewLogs LogsOptions ClearLogs Contacts GetStartedwithContacts AccessContacts AddaContact SaveaPhoneNumber EditaContact AddorEditInformationforaContact AssignanImagetoaContact AssignaRingtonetoaContact LinkaContact 23 23 24 24 25 25 25 25 26 26 26 26 26 26 27 27 27 27 28 28 28 29 30 31 31 31 31 32 32 32 32 33 33 33 34 34 35 ii DeleteaContact AddEntriestoYourFavorites CreateGroups CreateaNewGroup AddaContacttoaGroup SendaMessagetoaGroup ShareaContact AccountsandMessaging Google CreateaGoogleAccount AccessGmail SendaGmailMessage ReadandReplytoGmailMessages Email AddanEmailAccount AddaMicrosoftExchangeActiveSyncAccount ComposeandSendEmail ViewandReplytoEmail ManageYourEmailInbox EditEmailSettings DeleteanEmailAccount Messaging SendaMessage NewMessagesNotification ManagingMessageConversations MessagingSettings SocialNetworkingAccounts ChatON Flipboard Google+

Hangouts YouTube AppsandEntertainment SamsungLink ConfigureSamsungLinkSettings UseSamsungLinktoShareMediawithAnotherDevice DivX 35 35 35 35 36 36 36 38 38 38 38 39 39 40 40 40 41 41 42 43 45 46 46 46 46 48 50 50 51 52 52 52 53 53 53 54 54 iii LocatingYourVODRegistrationNumber RegisterYourDivXDeviceforVODPlaybackofPurchasedMovies GooglePlayBooks GooglePlayMagazines GameHub GooglePlayStore FindandInstallanApp CreateaGoogleWalletAccount OpenanInstalledApp UninstallanApp GooglePlayMovies&TV GoogleSearch MediaHub/SamsungHub SprintTV&Movies GooglePlayMusic MusicHub MusicApp SprintMusicPlus Scout GoogleMaps SprintZone VideoApp WebandData Internet DataServices(Sprint3G) YourDataServicesUserName LaunchaWebConnection 4GServices Wi-Fi TurnWi-FiOnandConnecttoaWirelessNetwork SprintHotspot Bluetooth TurnBluetoothOnorOff ConnectaBluetoothHeadsetorCarKit ReconnectaHeadsetorCarKit DisconnectorUnpairfromaBluetoothDevice SendInformationUsingBluetooth 55 55 56 56 56 56 56 57 57 57 58 58 58 60 60 61 61 61 62 63 63 63 66 66 66 66 66 67 67 67 68 69 69 69 70 70 71 iv ReceiveInformationUsingBluetooth VirtualPrivateNetworks(VPN) PrepareYourPhoneforVPNConnection SetUpaScreenLock AddaVPNConnection ConnecttoaVPN DisconnectfromaVPN CameraandVideo TakePictures PictureOptions SharePictureswithShareShot RecordVideos VideoOptions Gallery ViewPhotosandVideos ZoomInorOutonaPhoto WorkingwithPhotos SharePhotosandVideos PaperArtist G+Photos GroupPlay ToolsandCalendar Clock Calendar AddanEventtotheCalendar ViewEvents EraseEvents Calculator Downloads Dropbox DownloadtheDesktopApplication AccessDropboxonyourPhone UploadaPicturetoDropbox GoogleSearch Help microSDCard InstallamicroSDCard 72 72 72 73 73 73 73 74 74 74 76 77 78 79 80 81 81 82 83 83 84 86 86 86 86 87 87 87 88 88 88 88 88 89 89 89 89 v RemoveamicroSDCard ViewmicroSDCardMemory FormatamicroSDCard UnmountamicroSDCard MyFiles MoreServices SMemo CreateaNewSMemo SSuggest SVoice VoiceRecorder VoiceSearch VPNClient Wallet Settings Wi-FiSettings TurnWi-FiOnorOff ConfigureWi-FiSettings OtherWi-FiSettings Wi-FiDirect SprintHotspotSettings AllowedDevices BluetoothSettings TurnBluetoothOnorOff ConfigureBluetoothSettings DataUsageSettings MoreNetworksSettings AirplaneMode MobileNetworks Tethering VPN Roaming NFCSettings TurnNFCOnorOff AndroidBeam SBeamSettings TurnSBeamOnorOff 89 90 90 90 90 90 91 92 93 93 93 93 94 94 95 95 95 95 96 97 97 98 98 98 99 99 100 100 100 101 101 102 102 102 102 103 103 vi NearbyDevices ScreenMirroringSettings LockScreen ScreenLock LockScreenOptions DisplaySettings Wallpaper NotificationPanel MultiWindow PageBuddy Brightness AutoRotateScreen ScreenTimeout Daydream FontStyle FontSize TouchKeyLightDuration DisplayBatteryPercentage AutoAdjustScreenTone LEDIndicatorSettings SoundSettings Volume VibrationIntensity Ringtones Vibrations DefaultNotificationSound VibrateWhenRinging DialingKeypadTone TouchSounds ScreenLockSound HapticFeedback AutoHaptic EmergencyTone HDMIAudioOutput HomeScreenModeSettings CallSettings CallRejection 103 104 104 104 105 107 107 107 107 108 108 109 109 109 109 110 110 110 110 110 111 111 111 112 112 112 112 112 113 113 113 113 113 114 114 114 114 vii SetUpCallRejectionMessages Answering/EndingCalls TurnOffScreenDuringCalls CallAlerts CallAccessories RingtonesandKeypadTones PersonalizeCallSound NoiseReduction IncreaseVolumeInPocket USDialing InternationalDialing TTYMode DTMFTones VoicemailSettings VoicePrivacy BlockingModeSettings Hands-freeModeSettings PowerSavingModeSettings AccessorySettings AccessibilitySettings LanguageandInputSettings ChooseaDefaultLanguage SetaDefaultInputMethod GoogleVoiceTypingSettings SamsungKeyboard SwypeSettings VoiceSearchSettings Text-to-SpeechOptions PointerSpeed MotionSettings SmartScreenSettings SmartStay SmartRotation VoiceControlSettings AccountsSettings AddanAccount BackupOptions 115 115 115 115 116 116 117 117 117 117 117 118 118 118 118 119 120 120 120 121 122 122 122 122 123 124 125 126 126 126 127 128 128 128 129 129 129 viii LocationServicesSettings SecuritySettings Passwords DeviceAdministration SecurityUpdateService CredentialStorage ApplicationManagerSettings BatterySettings StorageSettings DateandTimeSettings ActivateThisDevice SystemUpdateSettings AboutDeviceSettings CopyrightInformation Index 130 130 131 131 131 132 132 132 133 133 134 134 134 136 137 ix Get Started Thefollowingtopicsgiveyoualltheinformationyouneedtosetupyourphoneandwirelessservice thefirsttime. Your Phone at a Glance Thefollowingillustrationoutlinesyourphonesprimaryexternalfeaturesandkeys. Set Up Your Phone Youmustfirstinstallandchargethebatterytobeginsettingupyourphone. 1. Installthebattery. l Insertacoinorotherflatobjectintotheslotatthebottomofthebatterycompartmentcover andliftthecoverupgently. Get Started 1 l Insertthebattery,contactsendfirst,andgentlypressthebatteryintoplace. l Replacethebatterycompartmentcover,makingsureallthetabsaresecureandthereare nogapsaroundthecover. 2. PlugtheUSBconnectorintothecharger/accessoryjackonthebottomofyourphone. 3. PlugtheACadapterintoanelectricaloutletandchargeyourbattery.Fullychargingabattery maytakeuptothreehours. Note: Yourphonesbatteryshouldhaveenoughchargeforthephonetoturnonandfindasignal, runthesetupapplication,setupvoicemail,andmakeacall.Youshouldfullychargethebatteryas soonaspossible. Get Started 2 Activate Your Phone Dependingonyouraccountorhowandwhereyoupurchasedyourphone,itmaybereadytouseor youmayneedtoactivateitonyourSprintaccount. n IfyoupurchasedyourphoneataSprintStore,itisprobablyactivatedandreadytouse. n IfyoureceivedyourphoneinthemailanditisforanewSprintaccountoranewlineofservice,it isdesignedtoactivateautomatically. l Whenyouturnthephoneonforthefirsttime,youshouldseeaHands Free Activation screen,whichmaybefollowedbyaPRL UpdatescreenandaFirmware Updatescreen. Followtheonscreeninstructionstocontinue. n Ifyoureceivedyourphoneinthemailandyouareactivatinganewphoneforanexistingnumber onyouraccount(youreswappingphones),youcanactivateonyourcomputeronlineordirectly onyourphone. l Activateonyourcomputer:

o Gotosprint.com/activateandcompletetheonlineinstructionstoactivateyourphone. l Activateonyourphone:

o Turnonyournewphone.(Makesuretheoldoneisturnedoff.)Yourphonewill automaticallyattemptHands-FreeActivation. o TapActivatetooverrideauto-activationandstartthemanualactivationwizard. o Followtheonscreenpromptstocompletetheactivationprocess. n Toconfirmactivation,makeaphonecall.Ifyourphoneisstillnotactivated,visit sprint.com/supportforassistance.IfyoudonothaveaccesstotheInternet,callSprintCustomer Serviceat1-888-211-4727fromanotherphone. Note: Ifyouarehavinganydifficultywithactivation,visitsprint.com/supportforassistance. Complete the Setup Afteryouactivateyourphone,followthepromptstosetupyourGoogleAccountandpreferences. Forbestresults,activateyourphonebeforestartingthesetupprocess. Note: Duringsetup,youmayseeanoticeaboutConnectionsOptimizer.ConnectionsOptimizer helpsyoumanageandenhanceyourdataexperiencebyfindingandconnectingtorememberedWi-

Finetworksonyourdevice,andifapplicable,the4Gnetwork. 1. Afteryouactivateyourphone,youllseetheWelcomescreen.Choosealanguage,andthentap Starttobeginsetup. 2. Followtheonscreeninstructionstocompleteeachsection.Foreachtopic,youwillhavean optiontoskipitandcontinuetothenextscreen. Get Started 3 l Wi-Fi:YoucanchoosetoconnecttoWi-Fitocompletesetup,insteadofyourphones wirelessnetworkconnection.SelectanavailableWi-Finetwork,andthenfollowtheprompts toconnect. l Got Google?:FollowthepromptstosignintoyourcurrentGoogleAccount,orsignupfora newGoogleAccountrightfromyourphone. o TapYestoenteryourGmailaddressandpasswordandthentaptherightarrowtosign intoyourcurrentGoogleAccount. o TapNotosignupforanewGoogleAccount.TapGet an account,andthenfollow promptstosetupyournewaccount. l Backup and Restore:SelectyourGoogleAccountbackupsettings.Ifyou'resigninginwith anexistingGoogleAccount,youcanchoosetorestoreyourGoogleAccountinformation, suchasapps,bookmarks,Wi-Fipasswords,andcontacts,toyournewphone.Youcanalso choosetokeepyournewphonebackedupwithyourGoogleAccount. l Google & location:SelectoptionsforallowingGoogleandotherappstouseyourlocation information. l This phone belongs to:Enteryourname.Yourphoneusesyournametopersonalize somefeatures. l Google services:LearnaboutGooglesprivacypolicyandotherterms. 3. AttheSetupcompletescreen,tapFinishtocompletesetupandcontinuewithotheroptions. 4. AttheDropboxscreen,selectanoptionandfollowtheonscreeninstructions. l Create a new Dropbox account:TaptosetupaDropboxaccounttosaveyourphotos andvideostoaWeb-basedstoragearea. l I already have an account:TaptosignintoyourcurrentDropboxaccount. l No thanks:TaptoskiptheDropboxsetupscreens. 5. Thatsit,yourphoneisnowreadytouse. Set Up Voicemail YoushouldsetupyourSprintVoicemailandpersonalgreetingassoonasyourphoneisactivated. Alwaysuseapasswordtoprotectagainstunauthorizedaccess.Yourphoneautomaticallytransfers allunansweredcallstoyourvoicemail,evenifyourphoneisinuseorturnedoff. Note:Voicemail PasswordSprintstronglyrecommendsthatyoucreateapasswordwhen settingupyourvoicemailtoprotectagainstunauthorizedaccess.Withoutapassword,anyonewho hasaccesstoyourphoneisabletoaccessyourvoicemailmessages. 1. Press andtap Phone. Get Started 4 2. Touchandhold 3. Followthesystempromptsto:

todialyourvoicemailnumber. l Createyourpassword. l Recordyournameannouncement. l Recordyourgreeting. Note: YoucanalsoaccessVisualVoicemailbytouching

. Sprint Account Information and Help Findoutaboutaccountpasswordsandinformationaboutmanagingyouraccountandfindinghelp. Sprint Account Passwords AsaSprintcustomer,youenjoyunlimitedaccesstoyourpersonalaccountinformation,your voicemailaccount,andyourdataservicesaccount.Toensurethatnooneelsehasaccesstoyour information,youwillneedtocreatepasswordstoprotectyourprivacy. AccountUserNameandPassword Ifyouaretheaccountowner,youwillcreateanaccountusernameandpasswordwhenyousignon tosprint.com/mysprint.(ClickSign in/RegisterandthenclickSign up now!togetstarted.)Ifyou arenottheaccountowner(ifsomeoneelsereceivesthebillforyourSprintservice),youcangeta sub-accountpasswordatsprint.com/mysprint. VoicemailPassword Youllcreateyourvoicemailpasswordwhenyousetupyourvoicemail.SeeVoicemailformore informationonyourvoicemailpassword. DataServicesPassword WithyourSprintphone,youmayelecttosetupanoptionaldataservicespasswordtocontrolaccess andauthorizePremiumServicepurchases. Formoreinformation,ortochangeyourpasswords,signontosprint.com/mysprint. Manage Your Account ManageyourSprintaccountfromyourcomputer,yourSprintphone,oranyotherphone. Online:sprint.com/mysprint n Accessyouraccountinformation. n Checkyourminutesused(dependingonyourSprintserviceplan). n Viewandpayyourbill. Get Started 5 n EnrollinSprintonlinebillingandautomaticpayment. n Purchaseaccessories. n ShopforthelatestSprintphones. n ViewavailableSprintserviceplansandoptions. n Learnmoreaboutdataservicesandotherproductslikegames,ringtones,screensavers,and more. FromYourSprintPhone 1. Press 2. Doanyofthefollowing:

andtap Phone. l Tap tomakeapayment. l Tap toaccessSprintZoneandasummaryofyourSprintserviceplanor togetanswerstootherquestions. Sprint Support Services Sprint411andSprintOperatorServicesletyoueasilyaccessinformationandcallingassistance fromyourSprintphone. Sprint411 Sprint411givesyouaccesstoavarietyofservicesandinformation,includingresidential,business, andgovernmentlistings;movielistingsorshowtimes;drivingdirections,restaurantreservations, andmajorlocaleventinformation.Youcangetuptothreepiecesofinformationpercall,andthe operatorcanautomaticallyconnectyourcallatnoadditionalcharge. Thereisaper-callchargetouseSprint411,andyouwillbebilledforairtime. n Press andtap Phone,andthentap

. SprintOperatorServices SprintOperatorServicesprovidesassistancewhenyouplacecollectcallsorwhenyouplacecalls billedtoalocaltelephonecallingcardorthirdparty. n Press andtap Phone,andthentap

. l Formoreinformationortoseethelatestinproductsandservices,visitusonlineat sprint.com. Get Started 6 Phone Basics Yourphoneispackedwithfeaturesthatsimplifyyourlifeandexpandyourabilitytostayconnectedto thepeopleandinformationthatareimportanttoyou.Thefollowingtopicswillintroducethebasic functionsandfeaturesofyourphone. Your Phones Layout Thefollowingillustrationsoutlineyourphonesbasiclayout. Key Functions Thefollowinglistdefinesthefeatureslistedintheaboveillustrations. n LED indicatorglowsorblinksindifferentcolorstoshowstatuswhenthescreenisturnedoff. TheLEDglowsredwhencharging,andblinksredwhenthebatteryislow;blinksbluewhena notificationhasarrived,orwhenyouarerecordingvoice;andglowsgreenwhenthebatteryis fullychargedandthephoneisattachedtoacharger. n Earpieceletsyouhearthecallerandautomatedpromptsduringcalls. n Proximity and Light Sensorsdetectthepresenceofobjectsnearthephone,andlight conditions. n Front Cameraallowsyoutotakepicturesandvideosofyourself. Phone Basics 7 n Power/Lock Keyletsyouturnthephoneonoroff,turnthescreenonoroff,orlockthescreen. PressandholdforaDeviceoptionsmenu,whereyoucanturnthephoneofforrestartit,orfor easyaccesstoAirplanemode,andtoMute,Vibrate,andSoundmodes. n Back Keyletsyoureturntothepreviousscreen,orcloseadialogbox,optionsmenu,the Notificationpanel,oronscreenkeyboard. n Home KeyreturnsyoutotheHomescreen.Pressandholdtoseerecentapps,andaccess TaskManagerandGoogleNow. n Menu Keyallowsyoutoaccessamenufrommostofyourphonesscreens. n Volume Keyadjuststhevolumeofyourphonessounds.FromtheHomescreen,pressto adjustmastervolume.Duringcallsorplayback,presstoadjustvolume.Presstomutethe ringtoneofanincomingcall. n Cameraletsyoutakepicturesandrecordvideos. n Flashhelpsilluminatesubjectsinlow-lightenvironmentswhenthecameraisfocusingand capturingaphotoorvideo. n Microphonesallowothercallerstohearyouwhenyouareusingthespeakerphone,and capturessoundduringrecording. n 3.5 mm Headset Jackallowsyoutoplugineitherastereoheadsetoranoptionalheadset(not included)forconvenient,hands-freeconversations. n Speakerplaysringtonesandsounds.Thespeakeralsoletsyouhearthecallersvoicein speakerphonemode. n USB Charger/Accessory Portallowsyoutoconnectthephonecharger/USBcable(included) andotheroptionalaccessories(notincluded). Caution: Insertinganaccessoryintotheincorrectjackmaydamagethephone. Turn Your Phone On and Off Theinstructionsbelowexplainhowtoturnyourphoneonandoff. Power/Lock Key. n Pressandholdthe Yourscreenremainsblankwhileyourphoneisoff(unlessthebatteryischarging). Turn Your Screen On and Off Youcanquicklyturnthescreenoffwhennotinuseandturnitbackonandunlockitwhenyouneed it. TurntheScreenOffWhenNotinUse n Toquicklyturnthescreenoff,pressthe Power/Lock Key. Phone Basics 8 Tosavebatterypower,thephoneautomaticallyturnsoffthescreenafteracertainperiodoftime whenyouleaveitidle.Youwillstillbeabletoreceivemessagesandcallswhilethephonesscreenis off. Note: Forinformationonhowtoadjustthetimebeforethescreenturnsoff,seeScreenTimeout. TurntheScreenOnandUnlockIt 1. Pressandholdthe 2. Swipethescreeninanydirectiontounlockthescreen. Power/Lock Key. l Ifyouhavesetupascreenlock,youwillbepromptedtodrawthepatternorenterthe passwordorPIN.SeeScreenLock. Touchscreen Navigation Yourphonestouchscreenletsyoucontrolactionsthroughavarietyoftouchgestures. Tap Whenyouwanttotypeusingtheonscreenkeyboard,selectitemsonscreensuchasapplicationand settingsicons,orpressonscreenbuttons,simplytapthemwithyourfinger. TouchandHold Toopentheavailableoptionsforanitem(forexample,acontactorlinkinaWebpage),touchand holdtheitem. Phone Basics 9 SwipeorSlide Toswipeorslidemeanstoquicklydragyourfingerverticallyorhorizontallyacrossthescreen. Phone Basics 10 Drag Todrag,touchandholdyourfingerwithsomepressurebeforeyoustarttomoveyourfinger.While dragging,donotreleaseyourfingeruntilyouhavereachedthetargetposition. Flick Flickingthescreenissimilartoswiping,exceptthatyouneedtoswipeyourfingerinlight,quick strokes.Thisfingergestureisalwaysinaverticaldirection,suchaswhenflickingthecontactsor messagelist. Phone Basics 11 Rotate Formostscreens,youcanautomaticallychangethescreenorientationfromportraittolandscapeby turningthephonesideways.Whenenteringtext,youcanturnthephonesidewaystobringupa biggerkeyboard. Phone Basics 12 Note: TheAutorotatecheckboxneedstobeselectedforthescreenorientationtoautomatically change.Tomakethisselection,press

> Auto rotate screen.SeeAutoRotateScreenformoreinformation.

>Settings>My device>Display andthentap PinchandSpread

"Pinch"thescreenusingyourthumbandforefingertozoomoutor"spread"thescreentozoomin whenviewingapictureoraWebpage.(Movefingersinwardtozoomoutandoutwardtozoomin.) Phone Basics 13 Tip: PinchinganyHomescreenwillletyouseethumbnailsofallsevenHomescreens.Tapa thumbnailtogostraighttoanotherHomescreen. Multi Window MultiWindowallowsyoutousetwoappsonthesamescreen,inseparate,resizablewindows. EnableMultiWindow EnableMultiwindowintheDisplaysettings. 1. Press 2. TapthecheckboxbesideMulti windowtoenableordisabletheoption.

>Settings>My device>Display. andthentap DisplayMultiWindow AfteryouenableMultiwindowinDisplaysettings,youcancontrolwhetherMultiwindowdisplayson thescreen,foreasyaccesstoitsfeatures. WhenyoudisplayMultiwindow,itappearsontheleftsideofthescreenbydefault.Youcandragthe tabalongthesideofthescreen,ortapthetabtoopenMultiWindow,thendragMultiwindowto anotheredgeofthescreen(top,bottom,orside). Phone Basics 14 n Touchandholdthe Back KeytodisplayMultiwindow. WorkWithMultiWindow AfterenablingMultiWindow,youcanuseittoruntwoappsatthesametime.Youcanlaunchapps fromMultiwindow,ordraganapptothescreentorunmultipleappsatthesametime. Theappsdisplaytogetheronasplitscreen.Youcanswitchbetweentheapps,oradjustthesizeof theirdisplayonthescreen. UseMultiWindowtoLaunchMultipleApps WhenyoudraganappfromMultiwindowontopofanopenapp,bothappsdisplayinasplitwindow. n Whileusingoneapp,touchthetabtodisplayMultiWindow,andthentouchanddraganappto thescreen. AdjusttheSizeofAppsinMultiWindow WhileusingMultiWindow,youcanadjustthesizeofthetwoappsonthescreen. n Touchanddragtheborderbetweenthewindows. SwitchMultiWindowAppPositions WhileusingMultiWindow,youcanswitchthepositionoftheappwindowsonthescreen. n Touchtheborderbetweenthewindows,thentouch MakeaMultiWindowAppFullScreen WhileusingMultiWindow,youcanexpandanapptofullscreenanytime. n Touchtheborderbetweenthewindows,andthentouch Your Home Screen Thehomescreenisthestartingpointforyourphonesapplications,functions,andmenus.Youcan customizeyourhomescreenbyaddingapplicationicons,shortcuts,folders,widgets,andmore. Yourhomescreenextendsbeyondtheinitialscreen.Swipethescreenleftorrighttodisplay additionalscreens. Note: Yourphone'shomescreenscyclethroughsothatyoucankeepswipinginonedirectionand makeitbacktothehomescreen.Thesmallcirclestowardthebottomofthescreenletyouknow yourcurrentscreenposition. toreturntothemainhomescreenfromanyotherscreen. Tip: Press Creating Shortcuts Learnhowtoadd,move,orremoveitemsfromthehomescreen. Phone Basics 15 AddingItemsfromtheApplicationsMenu 1. Press 2. Touchandholdanapplicationicon,andthendragittoaHomescreen.

,andthentap Apps. 3. ReleasethescreentolockthenewshortcutintoitsnewpositionontheHomescreen. AddingItemsfromtheHomescreen 1. Press 2. TouchandholdanemptyareaoftheHomescreen,andthenchooseApps and widgets. todisplaytheHomescreen. 3. Touchandholdtheapplicationicon,andthendragittoaHomescreen.Releasetheicontolock itonthescreen. RemovingaShortcut 1. Press 2. Touchandholdthedesiredshortcut,andthendragittotheRemoveiconandreleaseit.Asyou todisplaytheHomescreen. placetheshortcutintotheTrash,bothitemsturnred. Note: Thisactiondoesnotdeletetheapplication;itsimplyremovestheshortcutfromtheHome screen. Adding and Removing Primary Shortcuts YoucanchangeanyofyourprimaryshortcutswiththeexceptionoftheAppsshortcut.Theprimary shortcutsarethebottomrowofappshortcutsthatremainstaticonallhomescreens(bydefault Phone,Contacts,Messaging,Internet,andApps). Note: Beforereplacingaprimaryshortcut,youmustfirstaddthereplacementshortcuttotheHome Screen.Formoreinformation,seeCreatingShortcuts. 1. Press 2. Touchandholdtheprimaryshortcutyouwanttoreplaceandthendragittoanemptyspaceon todisplaytheHomescreen. anyHomescreen. 3. TouchandholdanewshortcutontheHomescreen,andthendragittotheemptyspaceinthe rowofprimaryshortcuts. Adding and Removing Widgets Widgetsareself-containedapplicationsthatresideeitherinyourWidgetstaboronthemainor extendedHomescreens.Unlikeashortcut,theWidgetappearsasanonscreenapplication. WidgetscanincludeContactsshortcuts,bookmarks,Facebookstatuswindows,Gmailandemail accounts,andmanyothertypesofapps. Phone Basics 16 AddingaWidget 1. Press 2. TouchandholdanemptyareaoftheHomescreen,andthenchooseApps and widgets>

todisplaytheHomescreen. Widgets. 3. Touchandawidget,andthendragittoaHomescreen.Releasethewidgettolockitonthe screen. RemovingaWidget 1. Press 2. Touchandholdthedesiredwidget,andthendragittotheRemoveicon.Asyoudropthewidget todisplaytheHomescreen. intotheTrash,bothitemsturnred. Note: Thisactiondoesnotdeletetheapplication;itsimplyremovesitfromthecurrentscreen. Extended Home Screens Inadditiontothemainhomescreen,yourphonehassixextendedhomescreenstoprovidemore spaceforaddingicons,widgets,andmore.Touchandholdtheiconorwidgetandthendragacross thescreentomovefromthemainscreentoanextendedscreen. TherearesixextendedscreensinadditiontothemainHomescreen. Note: Youcannotaddmorescreens,unlessyouhavepreviouslydeletedanyoftheexisting screens.Themaximumnumberofhomescreensisseven. Togodirectlytoaparticularscreen:

1. Fromanyhomescreen,pinchthescreentodisplaythumbnailimagesofallscreens. or Press Home,andthentap Menu>Edit page. 2. Tapthescreenyouwanttoopen. Recently Used Applications Youcanaccessrecentlyusedapplicationsthroughadisplayofshortcutstotheapplications themselves. 1. Pressandhold 2. Tapanimagetoopentheselectedapplication. fromanyscreentoopentherecentlyusedapplicationswindow. Phone Basics 17 Status Bar Thestatusbaratthetopofthehomescreenprovidesphoneandservicestatusinformationonthe rightsideandnotificationalertsontheleft.Toviewnotificationalerts,touchandholdthestatusbar anddragitdown. StatusIcons Icon Description Bluetoothactive ConnectedtoanotherBluetoothdevice Wi-Fiactive Vibrate Mute SpeakerphoneActive Network(fullsignal) 3G(dataservice) 4G(dataservice) AirplaneMode AlarmSet Smartstayisenabled,andyouareusingafeaturethatutilizesSmartstay. Battery(fullchargeshown) NotificationIcons Icon Description Missedcall Newemail NewGmail Newmessage Phone Basics 18 Icon Description Newvoicemail Event USBconnection Updatesavailable Downloadcomplete Keyboardactive Enter Text Youcantypeonyourphoneusingtheavailabletouchscreenkeyboards. Touchscreen Keyboards TouchscreenkeyboardentrycanbedoneineitherPortraitorLandscapeorientations.The Landscapeorientationprovidesmorespaceandresultsinslightlybiggeronscreenkeys.Ifyoufind thatyouprefertoentertextviatheonscreenkeyboard,andneedbiggerkeys,usethisorientation. Text Input Methods Therearethreetextinputmethodsavailable. n Google voice typingallowsyoutospeakyourentries. n Samsung keyboardallowsyoutoentertextbytouchingkeysonavirtualQWERTYkeyboard. Samsungkeyboardincludesoptionalpredictivetext,whichmatchesyourkeytouchesto commonwordssoyoucanselectawordtoinsertitintoyourtext. n SwypeletsyouenterwordsbyswipingacrossthevirtualQWERTYkeyboard.Insteadof tappingeachkey,useyourfingertotraceovereachletterofaword.Youcanalsotaplettersto enterwords. Google Voice Typing ThisfeatureusesGooglevoicerecognitiontoconvertyourspokenwordsintotext. UseGoogleVoiceTypingtoEnterText 1. Fromascreenwhereyoucanentertext,dragdownfromthetopofthescreentoopenthe Notificationpanel,andthentapSelect input method > Google voice typing. 2. Speakintothemicrophoneandwatchyourtextbeingenteredonscreen.Ifthetextisincorrect, tapDELETE. Phone Basics 19 3. Onceyouhavecompletedenteringyourtext,tapthekeyboardicontodisplaytheonscreen keyboard. Note: SelectalanguagebytappingatthebottomoftheListeningarea.TapAdd more languagestochooseanewlanguageviatheGooglevoicetypingmenu.Removingthecheckmark fromtheAutomaticfieldallowsyoutoselectadditionallanguages. ConfigureGoogleVoiceTyping SetGoogleVoiceTypingoptions.Formoreinformation,seeGoogleVoiceTypingSettings. n Press andtap

>Settings>My device >Language and input,andthentap nexttoGoogle voice typing. Samsung Keyboard WithSamsungKeyboard,it'seasytoentertext,symbols,andnumbers. UseSamsungKeyboardtoEnterText 1. Fromascreenwhereyoucanentertextdragdownfromthetopofthescreentoopenthe Notificationpanel,andthentapSelect input method >Samsung keyboard. 2. Tapkeystoentertext.Whileenteringtext,usetheseoptions:

l Ifyoumakeamistake,tap deleteawholewordorfield. todeleteincorrectcharacters.Touchandhold to l Tap tochangethecaseofthetext.Taptwicetoswitchtoallcapitals. l Tap keyboards. toswitchtoasymbolskeyboard,toentersymbols.Therearethreesymbol l Tap keyboard. tochooseGoogleVoicetyping,Handwriting,Clipboard,Settings,orFloating ConfigureSamsungKeyboard YoucanconfigureoptionsforSamsungkeyboard.Formoreinformation,seeSamsungKeyboard. n Press andtap

>Settings> My device >Language and input,andthentap nexttoSamsung keyboard. Swype SwypeletsyouenterwordsbytracingoverthelettersonthevirtualQWERTYkeyboard.Insteadof tappingeachkey,useyourfingertotraceovereachletterofaword.Youcanalsotapletterstoenter words. Phone Basics 20 Swypeprovidesnext-letterpredictionandregionalerrorcorrection,whichcancompensatefor tappingthewrongkeysonthevirtualQWERTYkeyboards. UseSwypetoEnterText 1. Fromascreenwhereyoucanentertextdragdownfromthetopofthescreentoopenthe Notificationpanel,andthentapSelect input method >Swype. 2. Swipeyourfingercontinuouslyovertheletterstoformaword.Asyouswipeoverletters,words matchingyourpatterndisplayatthetopoftheSwypekeyboard.Toenteraword,liftyourfinger, ortapawordatthetopofthekeyboard. 3. Whileenteringtext,usetheseoptions:

l Ifyoumakeamistake,tap deleteanentirewordorfield. todeleteasinglecharacter.Touchandhold to l Bydefault,Swypestartswithacapitalatthebeginningoftext.Tousecapitalizationatany time,tap oncetostartwithacapitalletter,ortaptwicetoenterallcapitals. l Tap symbols. toswitchtoasymbolskeyboard,andthentapkeystoenternumbersand ConfigureSwype ChooseSwypeoptions.Formoreinformation,seeSwypeSettings. n Press andtap

>Settings> My device >Language and input,andthentap nexttoSwype. Tips for Editing Text Thesetipsallowyoutocutorcopyselectedtextandpasteitintoaseparateselectedarea. 1. Inatextentryfield,double-tapthetext. 2. Touchanddragthesliderstohighlightandselectthedesiredtext. 3. TapanonscreenoptionfromtheEdittextmenubar.Youcandragyourfingeralongthemenu bartoseealltheoptions:

l l l l Select all: Highlightsallthetextinthefield. Cut: Removestheselectedtextandsavesittotheclipboard. Copy:Copiestheselectedtexttotheclipboard. Paste:Insertthelastcopiedorcuttextintothecurrentfield. Phone Basics 21 l Clipboard:Displaytheclipboardtochoosepreviouslycutorcopiedtext. Phone Basics 22 Phone Calls WiththeSprintwirelessserviceandyourphone,youcanenjoyclearcallingacrossthecountry. Make Phone Calls Thereareseveralconvenientwaystoplacecallsfromyourphone. Call Using the Keypad Themosttraditionalwaytoplaceacallisbyusingthephonesdialerscreen. 1. Press 2. Tapthenumberkeysonthekeypadtoenterthephonenumber.Asyouenterdigits,matching andtap Phone. contactsdisplay.Ifyouseethenumberyouwanttodial,tapittoselectthenumberwithout enteringtherestofthedigits. 3. Tap tocallthenumber. 4. Toendthecall,tap Call from Logs Allincoming,outgoingandmissedcallsarerecordedintheCalllog.Youcanplaceacalltonumbers orcontactsthatdisplayinthisarea. 1. Press 2. TaptheLogstab.Alistofrecentcallsdisplays.Youcanusetheseoptions:

andtap Phone. l Foradditionaloptions,tapthenameornumber. l Dragyourfingerfromlefttorightacrossthecontacttoplaceacall. Phone Calls 23 Tip: Youcanalsoswipetheentryfromrighttolefttosendatextmessage. Call from Contacts YoucanplacecallsdirectlyfromyourContactslistusingeitherofthefollowingprocedures. n Press andtap Contacts. l Tapthecontactyouwanttocallandthentap l Dependingonyourmotionsettings,youmayalsoautomaticallycallthedisplayedcontact,

. simplybyliftingthephonetoyourear.SeeMotionSettingsfordetails. l Dragyourfingerfromlefttorightacrossthecontacttocalltheirdefaultnumber. Tip: Youcanalsoswipetheentryfromrighttolefttosendatextmessage. Call a Number in a Text Message Whileviewingatextmessage,youcanplaceacalltoanumberthatisinthebodyofthemessage. Formoreinformation,seeMessaging. Phone Calls 24 andtap Messaging. 1. Press 2. Openthemessagewiththephonenumberandthentapthephonenumber. 3. TapCalltodialthenumber. Call a Number in an Email Message WhileviewinganemailorGmailmessage,youcanplaceacalltoanumberthatisinthebodyofthe message. 1. Press 2. Openthemessagewiththephonenumberandthentapthephonenumber. Apps,andthentap andtap or

. 3. ThePhoneappopens,displayingthephonenumber,readyfordialing.Tap Call Emergency Numbers Placecallstoemergencyservices,evenwhenyourphonesscreenislockedoryouraccountis restricted. toplacethecall. andtap Phone,andthentap n Press Tocallthe911emergencynumberwhenthephonesscreenislockedwithascreenlock:

n Fromthelockscreen,tapEmergency call. Enhanced 911 (E911) Information ThisphonefeaturesanembeddedGlobalPositioningSystem(GPS)chipnecessaryforutilizing E911emergencylocationserviceswhereavailable. Whenyouplaceanemergency911call,theGPSfeatureofyourphoneseeksinformationto calculateyourapproximatelocation.Dependingonseveralvariables,includingavailabilityand accesstosatellitesignals,itmaytakeupto30secondsormoretodetermineandreportyour approximatelocation. Important: Alwaysreportyourlocationtothe911operatorwhenplacinganemergencycall.Some designatedemergencycalltakers,knownasPublicSafetyAnsweringPoints(PSAPs),maynotbe equippedtoreceiveGPSlocationinformationfromyourphone. Receive Phone Calls Whenyoureceiveaphonecallfromacontact,theIncomingcallscreenappearsanddisplaysthe callerIDicon,name,andphonenumberofthecallingparty.Whenyoureceiveaphonecallfrom someonewhoisnotstoredinContacts,onlythedefaultcallerIDiconandphonenumberappearon theIncomingcallscreen. Note: Ifyourphoneisturnedoff,allcallsautomaticallygotovoicemail Phone Calls 25 Answer an Incoming Call Thefollowingprocedureshowsyouhowtoansweranincomingcall. n Whenthecallcomesin,touchanddrag Mute the Ringing Sound Youcanmutetheringtonewithoutrejectingthecallbydoingeitherofthefollowing. n PresstheVolume Keydown. n Placethephonefacedownonalevelsurface.SeeMotionSettingstodisplaythesettings requiredtomuteincomingcallsbyturningoverthephone. Reject an Incoming Call Thefollowingprocedureshowsyouhowtorejectandincomingcall. n Whenthecallcomesin,touchanddrag

. RejectaCallwithaTextMessage Youcanautomaticallyrejectanincomingcallbysendingatextmessagetothecaller. n TouchanddragReject call with message,andthenselectamessage,ortap tocreatea newmessage. Voicemail Yourphoneautomaticallytransfersallunansweredcallstoyourvoicemail,evenifyourphoneisin useorturnedoff.YoushouldsetupyourSprintVoicemailandpersonalgreetingassoonasyour phoneisactivated.Alwaysuseapasswordtoprotectagainstunauthorizedaccess. Retrieve Voicemail Messages Youcanaccessyourvoicemailbyusingthefollowingprocess. 1. Press andtap Phone. toaccessvoicemail,andfollowthepromptstoreviewvoicemail. 2. Touchandhold Voicemail Notification Thereareseveralwaysyourphonealertsyoutoanewmessage. n Byplayingaringtone. n Bydisplaying intheNotificationsareaoftheStatusbar. Phone Calls 26 Note: Yourphoneacceptsmessagesevenwhenitisturnedoff.However,yourphonenotifiesyou ofnewmessagesonlywhenitisturnedonandyouareinaservicearea.Youcancheckyour voicemailbydialing1+areacode+yourwirelessphonenumber.Whenyourvoicemailanswers, enteryourpassword. Visual Voicemail VisualVoicemailgivesyouaquickandeasywaytoaccessyourvoicemail.Nowyoucanfindexactly themessageyouarelookingforwithouthavingtolistentoeveryvoicemailmessagefirst.View voicemailsbycallernameandnumber,alongwiththelengthoftimeandprioritylevelofthe message. andtap Apps>

Voicemail. n Press Phone Call Options Yourphoneapplicationprovidesmanyusefulfeaturesandoptionstohelpyoumakethemostofyour callingexperience. Dialing Options Thereareseveraloptionsavailablewhenenteringanewnumber. 1. Press 2. Whiledialing,tap andtap Phone. todisplayalistofoptions.Tapanoptiontoselectit. l Send message tosendatextmessagetotheentry. l Add to contactstoaddtheenterednumberintoyourContactslist.SeeAddaContactfor moreinformation. l Speed dial settingtodisplaythecontactsassignedtonumbers2through100.Thenumber 1isreservedforVoicemail. l Add 2-sec pausetoadda2-secondpausetothenumberyouaredialing. l Add waittoaddapausetothecallingsequenceuntilyoutapakeytocontinue. l Call settings todisplaytheCallsettingsmenu.Formoreinformation,seeCallSettings. Caller ID CallerIDidentifiesacallerbeforeyouanswerthephonebydisplayingthenumberoftheincoming call.YoucanblockCallerIDifyoudonotwantyournumberdisplayedwhenyoumakeacall.This blockonlylastsforonecall;topermanentlyblockyournumber,callCustomerService. Phone Calls 27 1. Press andtap Phone. 2. Tap

. 3. Enteraphonenumberandthentap Call Waiting Whenyoureonacall,CallWaitingalertsyoutoincomingcallsbysoundingatone.Yourphones screeninformsyouthatanothercalliscominginanddisplaysthecallersphonenumber(ifitis available). Torespondtoanincomingcallwhileyoureonacall:

totherighttoputthefirstcallonholdandanswerthesecondcall. 1. Slide 2. Toswitchbacktothefirstcaller,tapSwap. 3-Way Calling With3-WayCalling(alsoknownasConferencecalling),youcantalktotwopeopleatthesametime. Whenusingthisfeature,thenormalairtimerateswillbechargedforeachofthetwocalls. 1. Press andtap Phone. 2. Enteranumberandtap 3. Onceyouhaveestablishedtheconnection,tapAdd callanddialthesecondnumber.(Thisputs

. thefirstcalleronholdanddialsthesecondnumber.) 4. Whenyoureconnectedtothesecondparty,tapMerge. Ifoneofthepeopleyoucalledhangsupduringyourcall,youandtheremainingcallerstay connected.Ifyouinitiatedthecallandarethefirsttohangup,allcallersaredisconnected. 5. Toendthethree-waycall,tap Call Forwarding CallForwardingletsyouforwardallyourincomingcallstoanotherphonenumberevenwhenyour phoneisturnedoff.YoucancontinuetomakecallsfromyourphonewhenyouhaveactivatedCall Forwarding. Note: Youarechargedahigherrateforcallsyouhaveforwarded. Phone Calls 28 ActivateCallForwarding 1. Press andtap Phone. 2. Tap 3. Entertheareacodeandphonenumbertowhichyouwantyourcallsforwarded. 4. Tap

.(YouwillhearatonetoconfirmtheactivationofCallForwarding.) DeactivateCallForwarding 1. Press andtap Phone. 2. Tap

. (Youwillseeamessageandhearatonetoconfirmthedeactivation.) 3. Tap In-call Options Whileyoureonacall,youwillseeanumberofonscreenoptions.Tapanoptiontoselectit. n Add call:displaysthedialersoyoucancallanotherperson. n Keypad:displaystheonscreenkeypad,whereyoucanenternumbersusingDTMF(DualTone Multi-Frequency).Thisisespeciallyhelpfulifyouneedtoenteranaccesscodeorother informationwhileonanactivecall. n End call:Terminatethecall. n Speaker:Routethephonesaudioeitherthroughthespeakerorthroughtheearpiece. Warning: Becauseofhighervolumelevels,donotplacethephonenearyourearduring speakerphoneuse. n Mute:Turntheonboardmicrophoneeitheronoroff. n Headset:ConnecttoaBluetoothheadset. n Touch formoreoptions:

l Contacts:GotoyourContactlist. l Memo:Createamemoduringacall. l Message:Sendamessageduringacall. Phone Calls 29 Speed Dialing YoucanassignashortcutnumbertoaphonenumberinyourContactsListforspeeddialing.There areonehundredavailablenumberedspaces.Thenumber1isreservedforVoicemail. AssigningSpeedDials andtap 1. Press 2. Touch 3. TapanunusedspaceandtheSelect contact screendisplays.

>Speed dial setting. Phone. 4. Selectacontacttoassigntothenumber.Theselectedcontactnumberwilldisplayinthespeed dialnumberbox. RemovingSpeedDials Phone. andtap

>Speed dial setting.

>Remove. 1. Press 2. Tap 3. Tap 4. TaptheXnexttothespeeddialentriesyouwanttoremove. 5. TapDone. EditSpeedDials Phone. andtap 1. Press 2. Tap 3. Tap 4. Taptheentryyouwanttomove,andthentapanunassignedspace.(Forexample,ifyouselect

>Speed dial setting.

>Change order. speeddial12,andspeeddial8shows"Notassigned,"youcantapspeeddial8tomovethe entry.)Ifyoutapanassignedspace,thetwospeeddialswillswapplaces. 5. TapDone. MakingaCallUsingaSpeedDialNumber 1. Press 2. Touchthespeeddialdigits,holdingthelastdigituntilthenumberdials. andtap Phone. Phone Calls 30 Logs TheLogstabofthePhoneapplicationlistsallrecentincoming,outgoing,andmissedcalls,plus messages. View Logs Thefollowingprocedureswillguideyouthroughviewingyourcalllogslist. 1. Press 2. TaptheLogstabtodisplayLogs. andtap Phone. l TochangetheLogsview,tap

>View.TapAll calls,Missed calls,Dialed calls, Received calls, orRejected callstofilterthelist. Logs Options Thefollowingprocedureswillguideyouthroughaccessingandunderstandingyourcalllogoptions. n TomakeacallfromLogs,seeCallfromLogs. Foradditionaloptions:

1. Press 2. TaptheLogstabtodisplaylogs. andtap Phone. 3. Touchandholdalistingtodisplaytheoptionslist. l Copy to dialing screen:CopythephonenumberformthecallrecordtothePhonescreen. l Add to contacts/View contact:Savethephonenumbertocreateorupdateacontact,or viewthecontactrecordwherethisnumberissaved. l Send number:Sendthephonenumberinatextmessage. l Add to reject list:Addthephonenumbertothelistofnumbers,tohavecallsfromthe numberblocked. l Delete:ErasethecallrecordfromLogs. Clear Logs FollowthesestepstocleartheLogslist. 1. Press 2. TaptheLogstabtodisplaylogs. andtap Phone. 3. Tap

>Delete,andthenfollowthepromptstoselectentriestodelete. Phone Calls 31 Contacts TheContactsapplicationletsyoustoreandmanagecontactsfromavarietyofsources,including contactsyouenterandsavedirectlyinyourphoneaswellascontactssynchronizedwithyour GoogleAccount,yourPC,compatibleemailprograms(includingExchangeServer),andyour Facebookfriends. Get Started with Contacts BeforeusingContacts,itsbesttolearnafewbasics. YourphoneautomaticallysortstheContactsentriesalphabetically.YoucancreateaGoogle contact,aphonecontact,oraCorporate(MicrosoftExchangeActiveSync)contact. n Phonecontactsarestoredlocallyonthephone. Note: Ifthephoneiseverresettoitsfactorydefaultparameters,locallystoredcontacts(phone contacts)canbelost. n GooglecontactsaresharedwithyourexistingGoogleAccountandcanalsobeimportedtoyour phoneafteryouhavecreatedaGoogleMailaccount. n Microsoft Exchange ActiveSynccontactsaresharedwithaMicrosoftExchangeaccount. Access Contacts ThereareafewwaystodisplayContacts. n Press andtap Contacts. or Press Phone>Contactstab. andtap Add a Contact YoucanaddcontactsdirectlyfromtheContactsapplication.Enterdetailssuchasname,phone numbers,emailaddresses,mailingaddresses,andmore. 1. Press andtap Contacts. atthetopofthescreen. 2. Tap 3. Ifyouhaveaccountssetuponyourphone,tapastorageaccount. 4. Touchcontactfieldstoenterinformation. Contacts 32 l Tap andassignanimagetothenewentry.ChooseanimagefromGallery,takeanew picturewiththeCamera,oruseanSMemo. l TaptheNamefieldandusetheonscreenkeyboardtoenterthefullname.Tap theNamefieldtodisplayadditionalnamefields. nextto l TapthePhone numberfield,andthenenterthephonenumber.Tap

,andthenchoosealabelforthenumber. Phonenumber.Tap toaddanother l TapEmailtoenteranemailaddress. l TapGroupstoassignthecontacttoagroup. l TapRingtonetochoosearingtonetoplayforcallsfromthecontact. l TapMessage alerttochoosearingtonetoplayfornewmessagesfromthecontact. l TapVibration patterntochooseavibrationtoplayfornewcallsormessagesfromthe contact. l TapAdd another fieldtoaddnewfieldsforthecontact. 5. TapSavetosavethenewcontact. Save a Phone Number YoucansaveaphonenumbertoContactsdirectlyfromthephonedialpad. 1. Press 2. Enteraphonenumberusingthekeypad. andtap Phone.

>Add to Contacts,andthenchooseCreate contactorUpdate existing. 3. Tap 4. Ifyourecreatinganewcontact,chooseanaccountforthecontact. 5. Continueenteringcontactinformation,ifdesired.SeeAddaContact. 6. TapSavetosavethecontact. Edit a Contact Onceyouveaddedacontact,youcanaddoreditanyoftheinformationintheentry,assignacaller IDpicture,customizewithauniqueringtone,andmore. Add or Edit Information for a Contact Youcanmodifyexistingcontactinformationtokeepyourinformationup-to-date. Contacts 33 1. Press andtap Contacts. 2. Tapacontacttodisplayit,andthentap 3. Tapanyfieldyouwanttochangeoradd.SeeAddaContact. 4. Addoredittheinformation,andthentapSave. Assign an Image to a Contact Addingapictureorimagetoacontactentrycreatesamorepersonalandeasilyrecognizedentry. Forexample,whenreceivingacallfromoneofyourcontacts,thepicturewilldisplay.Youcanadda picture,oruseanSMemo. 1. Press andtap Contacts. 2. Tapacontacttodisplayit,andthentap

. 3. Tap,

,andthenchooseanoption:

l ChooseImagetoselectapicturefromGallery. l ChoosePictures by peopletoselectapicturefromGallerythatcontainsatagforthe contact. l ChooseTake Picturetotakeanewpicture. l ChooseS MemotoassignanSMemotothecontactimage. 4. Touchanddragalongthesidesoftheblueborderboxtocroptheimagetothedesiredsize. 5. TapDone,andthentapSavetoassigntheimage. Assign a Ringtone to a Contact Youcanassignaspecialringtonetoindividualcontactsformorepersonalization. andtap 1. Press 2. Tapacontacttodisplayit. 3. TapRingtone,andthenchoosefromthefollowing:

Contacts. l Taparingtonetoselectit,andthentapOK.Whenyoutaparingtone,asampleplays. l TapAddtochooseasoundfromoneoftheseoptions:

o Choose music track:SelectasoundfromGooglePlayMusic. o Dropbox:SelectasoundfromyourDropbox. Contacts 34 o Sound picker:SelectasoundfromtheMusicapp. Link a Contact Whenyouhavecontactsfromvarioussources(Gmail,phone,Facebook,etc.),youmayhave multiplesimilarentriesforasinglecontact.YourphonesContactsapplicationletsyoulinkmultiple entriesintoasinglecontact. 1. Press andtap Contacts. 2. Tapacontacttodisplayit,andthentap 3. Tapanotherentrytolinkittotheoriginalcontact. Note: Youcanlinkuptotencontactsinasingleentry. Delete a Contact Youcandeleteacontactfromthecontactsdetailspage. andtap

>Delete. Contacts. 1. Press 2. Tapacontacttodisplayit,andthentap 3. TapOK. Tip: YoucanalsotouchandholdthecontactandthentapDelete. Add Entries to Your Favorites TheFavoritestabisalistingthatcanhelpyouquicklyaccessyourmostusedorpreferredContacts entries.Favoritesaremarkedwithastar. andtap Contacts. 1. Press 2. Tapacontacttodisplayit,andthentapthestaronthecontactrecord. Create Groups Thisfeatureallowsyoutoaddaneworexistingcontacttoacallgroup.Thisgroupcanbeoneofthe alreadypresentgroups(Family,Friends,orWork)orauser-createdgroup. Create a New Group Youcancreatenewgroupswithuniqueringtonesandvibrationpatterns. andtap 1. Press 2. Press 3. Enterinformationaboutthegroup:

andthentapCreate. Contacts>Groups. Contacts 35 l TaptheGroup namefieldandenteranameforthenewgroup. l TapGroup ringtoneandselectaringtoneforthegroup. l TapMessage alerttochoosearingtonetoplayfornewmessagesfromgroupmembers. l TapVibration patternandselectavibrationpatternforthegroup. l TapAdd memberandselectamemberormemberstoaddtothenewGrouplist. 4. TapDonewhenyouarefinishedaddingmembers,andthentapSave. Add a Contact to a Group YoucanaddnewmemberstoagroupfromyourContacts. 1. Press andtap Contacts>Groups. 2. Tapagrouptodisplayit,andthentap 3. Fromthelistofcontacts,tapthecontact(s)youwanttoadd.(Agreencheck-markappearsnext

. totheselectedentries.) 4. TapDone toaddthecontact(s)tothegroup. Send a Message to a Group Youcansendamessagetoallorselectedmembersofagroup. andtap 1. Press 2. Tapanexistinggroupandthentap 3. Selecttherecipientsofthenewmessage(indicatedbyagreencheckmark)andthentapDone. Contacts>Groups.

>Send message. 4. Typeyourmessage,andthentap Share a Contact YoucansharecontactsusingBluetooth,ChatON,Email,Gmail,Messaging,orWi-FiDirect. andtap Contacts. 1. Press 2. Tapacontacttodisplayit,andthentap 3. Sendthecurrentcontactinformationtoanexternalrecipientviaoneofthefollowing:

>Share namecard via. l Bluetooth:SendtheinformationviaBluetooth.SeeBluetoothforinformationonpairingand sendingviaBluetooth. l ChatON:SendtheinformationviaChatON. Contacts 36 l Email:Sendtheinformationasanemailattachment.SeeComposeandSendEmailfor detailsonsendingemail. l Gmail:SendtheinformationasaGmailattachment.SeeSendaGmailMessagefordetails. l Messaging:SendthecontactinformationasanMMSmessageattachment(vcffile).For moreinformationaboutmessaging,seeMessaging. l Wi-Fi Direct:Sendtheinformationviaaphone-to-deviceconnection. Contacts 37 Accounts and Messaging Setupaccountsonyourphone,tosynchronizeinformationbetweenyourphoneandaccounts.Use yourphonesmessagingfeaturestosendtextandmultimediamessages. Google Manyofyourphonesapplications,suchasGmail,GoogleMaps,GoogleTalk,andtheGooglePlay Store,requireaGoogleAccount.Tousetheseapplications,youmustsetupyourGoogleAccount onyourphone.SettingupyouraccountonyourphonesyncsyourphoneandyouronlineGoogle Account. Create a Google Account IfyoudonotalreadyhaveaGoogleAccount,youcancreateoneonlineorusingyourphone. Note: YoucanalsocreateandsignintoyourGoogle/GmailaccountthroughyourphonesSetup application. AlthoughyouneedaGmailaccounttousecertainfeaturesofyourphone,suchasGooglePlay,you donotneedtouseGmailasthedefaultaccountforyourphone. CreateaGoogleAccountOnline 1. Fromacomputer,launchaWebbrowserandnavigatetowww.google.com. 2. Onthemainpage,clickSign in>Create an account. 3. Followtheonscreenpromptstocreateyourfreeaccount. CreateaGoogleAccountUsingYourPhone 1. Press 2. TapAdd account>Google > New. andtap

>Settings>Accounts. 3. Followtheonscreenpromptstocreateyourfreeaccount. Access Gmail BelowareproceduresforaccessingyourGmailaccount. 1. Press 2. Doanyofthefollowing:

andtap Apps>

Gmail. l View more email messages:IftheInboxisfull,swipeyourfingerupthescreentoview moremessagesandconversations. l Read a new email message:Taptheunreadmessageortheconversationwithanunread message(just-arriveditemsdisplayinbold). Accounts and Messaging 38 l Select messages and conversations:Taptheboxbeforetheemailorconversation. l View the Inbox of another Gmail account:Tapthe thentaptheinboxoftheGmailaccountyouwanttoview. menuatthetopofthescreenand Send a Gmail Message BelowareproceduresforsendingaGmail. 1. Press andtap Apps>

Gmail. 2. FromtheInbox,tap 3. EnterthemessagerecipientsemailaddressintheTofield.Youcanaddmultiplerecipients. 4. TapSubjectandentertheemailsubject. 5. TapCompose emailandcomposeyouremail. l Toaddapictureorvideo,tap l Tosendacarboncopy(Cc)orablindcarboncopy(Bcc)ofthecurrentemailtoother

>Attach pictureorAttach video. recipients,tap

>Add Cc/Bcc. 6. Tosendthemessage,tap

. l Tosavethecurrentemailasadraft,tap

>Save draft.Toviewyourdraftemail messages,fromtheInbox,tapthe menuatthetopofthescreenandthentapDrafts. l Todeletethecurrentemailmessage,tap

>Discard. Read and Reply to Gmail Messages BelowareproceduresforreadingandreplyingtoGmailmessages. Gmail. andtap Apps>

1. Press 2. Tapamessagetodisplayitscontents. Tip: YoucanalsoaccessnewmessagesthroughtheNotificationsbar.WhenanewGmail messagearrives,youllseetheiconintheNotificationsbar.Touchandholdthebarandslideitdown todisplaynotifications.Tapamessagetodisplayit. todisplaythereplyscreen. 3. Tap 4. Fromthemenuatthetopofthescreen,tapReply,Reply all,orForward. 5. Tosendthemessage,tap

. Accounts and Messaging 39 Email UsetheEmailapplicationtosendandreceiveemailfromyourwebmailorotheraccounts.Youcan alsoaccessyourExchangeActiveSyncemailonyourphone. Add an Email Account Emailallowsyoutosendandreceiveemailusingvariousemailservices.Youcanalsoreceivetext messagealertswhenyoureceiveanimportantemail. 1. Press 2. Enteryouremailaddressandpassword.Toseeyourpasswordasyouenterit,tapShow Apps>

andtap Email. password. 3. TapNexttostartautomaticemailsetup.Ifyouneedtoconfigurecustomsettings,tapManual setupandthenenteryoursettings.Thesemayincludemailtype,username,password,server, securitytype,etc. 4. Followtheonscreenpromptstoconfigureoptionsfortheaccount. 5. TapDonetocompletesetup. Note: YoucanalsoaddemailaccountsfromSettings.Press Accounts>Add account> Email. Add a Microsoft Exchange ActiveSync Account TheEmailapplicationalsoprovidesaccesstoyourMicrosoftExchangeaccountfromyourphone.If yourcompanyusesMicrosoftExchangeServer2003,2007,or2010asthecorporateemailsystem, youcanusethisemailapplicationtowirelesslysynchronizeyouremail,Contacts,andTask informationdirectlywithyourcompanysExchangeserver.

>Settings>

andtap Usethefollowingproceduretosynchronizeyourphonewithacorporateemailaccount. Note: YoucansetupmultipleMicrosoftExchangeActiveSyncaccountsonyourphone. 1. Press 2. Enteryouremailaddressandpassword.Toseeyourpasswordasyouenterit,tapShow Apps>

andtap Email. password. 3. TapNexttostartautomaticemailsetup.Forsystemsthatrequirecustomsettings,tapManual setupandthenenteryoursettings.Youmayneedtoconsultyournetworkadministratorforthis information:

l Domain\Username:Enteryournetworkdomainandusername,separatedby\. l Password:Enteryournetworkaccesspassword(case-sensitive). Accounts and Messaging 40 l Exchange Server:EnteryoursystemsExchangeserverremoteemailaddress.Obtainthis informationfromyourcompanynetworkadministrator. l Use secure connection (SSL):Taptoplaceacheckmarkinthebox,ifyoursystem requiresSSLencryption. l Use client certification:Taptoplaceacheckmarkinthebox,ifyoursystemrequires certification. 4. Followtheonscreenpromptstoconfigureoptionsfortheaccount. 5. TapDonetocompletesetup. Note: YoucanalsoaddemailaccountsfromSettings.Press Accounts>Add account> Email. Compose and Send Email Composeandsendemailusinganyaccountyouhavesetuponyourphone.Increaseyour productivitybyattachingfilessuchaspictures,videos,ordocumentstoyouremailmessages. andtap

>Settings>

1. Press andtap Apps>

Email. 2. FromtheInbox,tap 3. Composeyourmessage:

. l TaptheTofieldandentertherecipientsemailaddress.Youcanaddmultiplemessage recipients. l Tosendacarboncopy(Cc)orablindcarboncopy(Bcc)ofthecurrentemailtoother recipients,tapCc/Bcc. l TaptheSubjectfieldandentertheemailsubject. l Tapthetextentryfieldandcomposeyouremail. l Toaddanattachment,tap

.Choosefromthefollowing:My Files,Images,Take picture,Video,Record video,Audio,Record audio,S Memo,Calendar,Contacts,or Location. 4. Tosendthemessage,tap

. View and Reply to Email Readingandreplyingtoemailonyourphoneisassimpleasonyourcomputer. 1. Press 2. OntheemailaccountInbox,tapamessagetoviewit,andthenchooseanoption:

Apps>

andtap Email. Accounts and Messaging 41 l Tap Replytoreplytothesender. l Tap Reply alltoreplytoalltheaddressesintheoriginalrecipientlist. l Tap Forwardtoforwardthemessagetonewrecipient(s). 3. Enteramessage(ifdesired)andthentap Manage Your Email Inbox Thefollowingproceduresallowyoutoview,refresh,sort,anddeleteyouremailmessages. ViewYourEmailInbox 1. Press 2. Taptheaccountnamefield(upper-left)toopenthecompleteemailaccountlistpage. Apps>

andtap Email. 3. Selectanemailaccountandtapanemailmessage. RefreshanEmailAccount Whateveryourautomaticsynchronizationsettingsare,youcanalsosynchronizeyoursentand receivedemailmessagesmanuallyatanytime. 1. Press 2. Selectanemailaccount. andtap Apps>

Email. l Ifyouarealreadyinanemailaccount,taptheaccountnamefield(upper-left)toopenthe completeemailaccountlistpage. l Selectanavailableemailaccount. 3. Tap

(Refresh). SortEmailMessages andtap 1. Press 2. OntheemailaccountInbox,tap 3. Selectfromtheoptionstosortemailmessagesbydatereceived(mostrecentoroldest),by Email.

>Sort by. Apps>

sender,read/unreadstatus,starredfavorites,attachments,recipient(s),priority,subject,flag, request,meetingrequests,orsize.(Notalloptionsareavailableforallemailaccounts.) Accounts and Messaging 42 DeleteanEmailMessage 1. Press andtap Apps>

Email. Delete. 2. Tapthecheckboxbesideemail(s)youwanttodelete,andthentap 3. Followthepromptstoconfirmthedeletion. Edit Email Settings Youcaneditgeneralpreferences,whichapplytoallemailaccounts,orconfiguresettingsforspecific emailaccounts,suchasemailaddressandpassword,namedisplayandsignature,frequencyof retrieval,andmore. Note: Availablesettingsdependonthetypeofemailaccount. EditGeneralPreferences 1. Press 2. Tap andtap Apps>

Email.

>Settingstoconfiguresettings.Availablesettingsdependonthetypeofemail account,andmayinclude:

l Display:Choosehowemailsareshownintheemaillist,andwhenyouopenthem. l Composing and sending:Choosewhatfunctionsareavailablewhilecomposingand sendingemails. l Autoadvance:Choosehowtheemaillistdisplaysafteryoudeleteormoveanemail. l Confirm deletions:Choosewhetherthephonepromptsyoutoconfirmtheactionwhen youmarkemailsfordeletion. l Priority senders:Maintainalistofemailaddressestoensurethatemailsfromthe addressesreceivepriorityhandling. l Spam addresses:Createalistofemailaddressesanddomains,toblockemailsfromthese senders. l Rules for filtering:Setfiltersandmanagefilteredemail. EditAccountSettings Youcaneditsettingsforyourindividualemailaccounts,suchasemailaddressandpassword,name displayandsignature,frequencyofretrieval,andmore. Note: Availablesettingsdependonthetypeofemailaccount. 1. Press andtap Apps>

Email. Accounts and Messaging 43 2. Tap

>Settings> Account settings,andthentapanaccounttoconfiguresettings. Availablesettingsmayinclude:

l Sync settings: Taptoconfigureoptionsforsynchronizingyourphonewithyouraccount. o Sync Email:Whenenabled,yourphonemaintainssynchronizationwithyouremail account.Thelastsynchronizationisdisplayed. o Sync schedule:Setoptionsforsynchronizingyourphonewithyouremailaccount. AvailablewhenSyncEmailisenabled. o Period to sync Email:Chooseaperiodoftimetomaintainsynchronizationbetween yourphoneandemailaccount. o Size to retrieve emails:Chooseamaximumsizeforemails,foryourphoneto automaticallyretrieveduringsynchronization.Forlargeremails,yourphonewillprompt youtodownloadthecontentswhenyouopenthem. l Signature:WhenOn,atextsignatureisautomaticallyaddedtoemailsyousend.Tapthe ON/OFFswitchtoturnsignaturesOnorOff.AfterturningsignaturesOn,tapSignatureto editthedefaulttextsignature. l Out of office settings: Configureoptionsforautomaticrepliestoemailswhenyouareout oftheoffice. l Default account:Assignanaccountasthedefaultemailaccountforoutgoingmessages. Whenyoulaunchanemailfromotherapps,theemailwillautomaticallybefromthisaccount. l Password: Updateyouraccountpasswordtomatchthepasswordsetonyouraccount. l Email notifications:Whenenabled,anicondisplaysintheStatusbarwhenyoureceive newemails. l Select ringtone:Choosearingtonetoplayfornewemailnotifications. l Vibrate:Whenenabled,vibrationplaysfornewemailnotifications. l More settings:Configureotheroptions,includingtheaccountname,carboncopyandblind carboncopy,synchronization,andsecurityoptions. o Account name:Enteranametoidentifythisemailaccount. o Your name:Enteraname,tobeshowntorecipientsinemailsfromthisaccount. o Always Cc/Bcc myself:Chooseoptionsforsendingacopyofemailsyousendto yourself,asacopy(Cc)orblindcopy(Bcc). o Forward with attachments:Choosewhethertoautomaticallyincludeattachments whenforwardinganemail. o Show images:Choosewhethertoautomaticallydisplayembeddedimagesinthebody ofanemail. Accounts and Messaging 44 o Auto download attachments:Choosewhetherthephoneautomaticallydownloads emailattachmentswhenyouareconnectedtoWi-Fi.Youmightusethisoptiontocontrol howandwhetheryouuseyourplansdataservicestodownloadattachments. o Auto resend times:Choosethenumberoftimesthephoneattemptstoresendan emailafteradeliveryfailure. o Folder sync settings:Choosefolderstosynchronizebetweenyourphoneand account. o Period to sync Calendar:Choosetheperiodforsynchronizingcalendarevents betweenyourphoneandaccount. o Empty server trash:Deletethecontentsofthetrashfolderontheaccountserver. o In case of sync conflict:Choosewhetherinformationfromtheserverorphonehas prioritywhenthereisaconflict. o Security options:Configureadvancedsecurityoptions,includingencryption. o Number of emails to load:Choosethenumberofemailsdisplayedatonetime. o Sync Contacts:Choosewhethercontactsaresynchronizedbetweenyourphoneand theaccount. o Sync Calendar:Choosewhethercalendareventsaresynchronizedbetweenyour phoneandtheaccount. o Sync Task:Choosewhetheremailsaresynchronizedbetweenyourphoneandthe account. o Exchange server settings:ConfiguretheDomain\username,Password,andother Exchangeserversettings. o Incoming settings:Configuresettingsfortheaccountservertoaccessyouraccounton yourphone. o Outgoing settings:Configuresettingsforaccessingyouraccountfromyourphone. Delete an Email Account Ifyounolongerwantanemailaccountonyourphone,youcandeleteitthroughthemailsettings menu. 1. Press 2. Tap andtap Apps>

Email.

>Settings> Account settings.

,andthentapaccount(s)todelete. 3. Tap 4. TapDelete,andthenfollowthepromptstoconfirmthedeletion. Accounts and Messaging 45 Messaging Withtextmessaging(SMS),youcansendandreceivetextmessagesbetweenyourphoneand anotherphonethatsupportsmessaging. Multimediamessages,(MMS),cancontaintextandpictures,recordedvoice,audioorvideofiles, pictureslideshows,contactnamecards(vCard),orcalendarevents(vCalendar). Seeyourserviceplanforapplicablechargesformessaging. Send a Message Quicklycomposeandsenttextmessagesonyourphone. 1. Press andtap Apps>

Messaging. 2. Tap Composetocreateamessage:

l TapEnter recipient andenteraContactname,amobilephonenumber,oranemail addressusingtheonscreenkeyboard.Asyouenterletters,possiblematchesfromyour accountsandcontactsdisplayonthescreen.Touchamatchtoaddittothemessage. l TapEnter messagetoenteryourmessage. l Tap toattachanimage,picture,video,audioclip,SMemo,Calendarevent,location info,orcontact. Send tosendthemessage. 3. Tap New Messages Notification Dependingonyournotificationsettings,thephonewillplayaringtone,vibrate,ordisplaythe messagebrieflyinthestatusbarwhenyoureceiveanewtextormultimediamessage.Tochange thenotificationfornewtextandmultimediamessages,seeMessagingSettingsfordetails. Anewmessageicon alsoappearsinthenotificationsareaofthestatusbartonotifyyouofa newtextormultimediamessage.TheMessagingapplicationicon newmessages. alsodisplaysthenumberof Toopenthemessage,touchandholdthestatusbar,andthenslidethestatusbardowntoopenthe Notificationpanel.Tapthenewmessagetoopenandreadit.Forinformationonreadingand replyingtomessages,seeManagingMessageConversations. Managing Message Conversations Textandmultimediamessagesthataresenttoandreceivedfromacontact(oranumber)are groupedintoconversationsormessagethreadsintheAllmessagesscreen.Threadedtextor Accounts and Messaging 46 multimediamessagesletyouseeexchangedmessages(similartoachatprogram)withacontacton thescreen. ReadaTextMessage 1. Dooneofthefollowing:

l OntheMessagingscreen,tapthetextmessageormessagethreadtoopenandreadit. l Ifyouhaveanewmessagenotification,slidethestatusbardowntoopentheNotification panel.Tapthenewmessagetoopenandreadit. 2. ToreturntotheAllmessagesscreenfromatextmessagethread,tap Note: Toviewthedetailsofaparticularmessage,inthemessagethread,touchandholdthe messagetoopentheoptionsmenu,andthentapView message details. Back. IfamessagecontainsalinktoaWebpage,tapthemessageandthentapthelinktoopenitinthe Webbrowser. Ifamessagecontainsaphonenumber,tapthemessageandthentapthephonenumbertodialthe numberoraddittoyourcontacts. ViewaMultimediaMessage 1. Press 2. Fromthemessagelist,tapamessagetoopenitscontents. Messaging. Apps>

andtap 3. Whilethemessageisopen,taptheplayicon(onavideooraudiofile)toplaybackthefileortap animagetoviewapicture. l ThefileattachmentontheMMSmessagecanbesavedtoanoptionalinstalledmemorycard

(notincluded).Tosavetheattachment,touchandholdthefile.TapSave attachment. SelecttheattachmentcheckboxandtapSave. ReplytoaMessage andtap 1. Press 2. Fromthemessagelist,tapamessage. 3. TaptheEnter messagefieldandthentypeyourreplymessage. Messaging. Apps>

4. Oncecomplete,tap Sendtosendthemessage. ProtectaMessagefromDeletion Youcanlockamessagesothatitwillnotbedeletedevenifyoudeletetheothermessagesinthe conversation. Accounts and Messaging 47 1. Press 2. OntheMessagingscreen,tapamessagethread. Apps>

andtap Messaging. 3. Touchandholdthemessagethatyouwanttolock. 4. TapLock ontheoptionsmenu.Alockicondisplaysbelowthemessage. DeleteaMessageThread andtap 1. Press 2. Touchandholdthemessagethreadthatyouwanttodelete. 3. TapDelete. Messaging. Apps>

DeleteSeveralMessageThreads andtap Apps>

Messaging.

>Delete threads. 1. Press 2. Tap 3. SelectthemessagethreadsyouwanttodeleteandtapDelete. Note: Anylockedmessageswillnotbedeleted,unlessyouselecttheInclude protected messagescheckboxbeforeconfirmingthedeletion. DeleteaSingleMessage andtap Apps>

1. Press 2. Whileviewingamessagethread,touchandholdthemessagethatyouwanttodelete. 3. TapDelete ontheoptionsmenu. 4. Whenpromptedtoconfirm,tapOK. Messaging. ViewContactDetailsandCommunicatewithaContact Whenyouhavereceivedamessagefromsomeoneinyourstoredcontacts,youcantapthe contactsphotooriconinthemessagethreadtoopenamenuofoptions.Dependingonthestored contactinformation,youcanviewthecontactdetails,phone,orsendanemailmessagetothe contact,andmore. Messaging Settings MessagingsettingsallowyoucontroloptionsforyourtextandMMSmessages,includingmessage limits,sizesettings,andnotifications. Accounts and Messaging 48 1. Press 2. Tap andtap Apps>

Messaging.

>Settingstoconfiguretheseoptions:

l Delete old messagesallowsthephonetoautomaticallydeletetheoldestmessageswhen themaximumnumberofmessagesisreached.Setthemaximumnumberofmessageswith theTextmessagelimitandMultimediamessagelimitsettingsbelow. l Text message limitallowsyoutosetthemaximumnumberoftextmessagesper conversation. l Multimedia message limitallowsyoutosetthemaximumnumberofmultimedia messagesperconversation. l Text templatesallowsyoutocreateandmanagetextstringsthatyoucanaddtomessages. l Auto combinationallowsyoutochoosewhetherlongmessagesthatarereceivedin multiplepartsareautomaticallyre-assembledtodisplayasasinglemessage. l Group messagingallowsyoutocontrolhowmessagestomultiplerecipientsarehandled. Whenenabled,asinglemessageissenttomultiplerecipients.Whendisabled,aseparate messageissenttoeachrecipient. l Auto retrieveallowsyoutochoosewhethermessageattachment(s)areautomatically downloadedwhenyoudisplayamultimediamessage.Ifyoudisablethisoption,onlythe messageheaderdisplaysinthemessagelist,andyoullbepromptedtodownloadthe attachment(s). l Roaming auto retrieveallowsyoutochoosewhethermessageattachment(s)are automaticallydownloadedwhileyourphoneisinroamingmode. l MMS alertallowsyoutohavethephonealertyouwhenyoumakeachangetoamessage thatwillconvertthemessagetoamultimediamessage(MMS). l Bubble styleallowsyoutochoosehowmessagesappearonthescreen.Bubblesarethe boxesthatsurroundeachmessage. l Background styleallowsyoutochoosethebackgroundofthemessagescreen. l Use the volume keyallowsyoutochangethetextsizewhilereadingamessageby pressingtheVolumeKeyupordown. l Notificationsallowsyouspecifywhethernotificationsfornewmessagesdisplayinthe statusbar. l Select ringtoneallowsyoutosettheringtoneforyourmessagenotifications. l Vibrateallowsyoutochoosewhethervibrationplaysalongwiththeringtonefornew messagenotifications. l Message alert repetitionallowsyoutochoosehowoftenyourphonenotifiesyouofnew message(s). Accounts and Messaging 49 l Preview messageallowsyoutochoosewhetherapreviewofanewmessageappearsin thestatusbarwiththemessagenotification. l Emergency Alertsallowsyoutoconfigureemergencyalertsettings.Youcanenableor disablesomealerts:ExtremeAlert,SevereAlert,AmberAlert,andEmergencyalerttest messages.YoucannotdisablePresidentialalerts. Important: TheCommercialMobileAlertSystem(CMAS)systemprovidesthegovernmentthe abilitytosendgeographicallytargetednotificationsofemergencies,suchasthreatstopublicsafety, severeweatherevents,ahazardousmaterialspilloramissingchildinthephoneusersarea. l Emergency notification previewallowsyoutoplayasampleemergencyalerttone.Tap Stoptocanceltheplayback. l Vibrateallowsyoutoselectvibrateoptionsforemergencymessages. l Alert reminderallowsyoutoconfigurethereminderinterval. l Add signatureallowsyouaddatextsignaturetoallmessagesyousend. l Signature textallowsyoutoenteratextsignature,whenAddsignatureisenabled. l Spam settingsallowsyoutofilterincomingmessagesforspammessages. l Add to spam numbersallowsyoutoentertelephonenumbers,toautomaticallyflag messagesfromthenumbersasspam,whenSpamsettingsisenabled. l Add to spam phrasesallowsyoutoenteratextphrase,toautomaticallyflagmessagesas spamwhentheycontainthephrase.AvailablewhenSpamsettingsareenabled. l Block unknown sendersallowsyoutoautomaticallyblockmessagesfromnumbersthat arenotstoredascontactsonyourphone. Social Networking Accounts Stayintouchonthegowithallyoursocialnetworkingaccounts.PostupdatesonFacebookand Twitter,reviewyourLinkedIncontacts,seewhateveryonestalkingaboutfromYouTube,andmore. ChatON TheChatONapplicationprovidesaglobalmobilecommunicationservicewhereyoucanchatwith morethan2buddiesviaagroupchat.Sharethingssuchaspictures,videos,animationmessages

(Scribbles),audio,Contacts,Calendarentries,andLocationinformation. Important: TheSamsungaccountmanagestheaccessinformation(username/password)to severalapplications,suchasSamsungLink,ChatON,andSamsungHub. RegisterWiththeService 1. Press andtap Apps>

ChatON. Accounts and Messaging 50 2. FollowthepromptstoreadandaccepttheTermsandconditionsandPrivacypolicyandreadthe onscreeninformation.TapAccepttocontinue. 3. Selectacountrycodeandenteryourcurrentphonenumbertoregisterwiththeservice. 4. ChoosetoreceivetheverificationcodeviaeitherSMS(textmessage)orVoice(answering machinecall)toyourphone. 5. Entertheverificationcodeyoureceived,andthentapNext. 6. EnteryournameandthentapDone. AddYourFirstChatONBuddy 1. Press andtap Apps>

ChatON. 2. Tap andchooseasearchmethod. l Phone number:SearchbyCountrycodeandphonenumber. l Search by ID:SearchusingaknownSamsungaccountID. 3. Followthepromptstofindabuddy. UseChatONforChatting 1. Press 2. TaptheBuddiestabandselectabuddytoinitiateyourchat. ChatON. Apps>

andtap 3. Enteryourmessageusingtheonscreentextentrymethod. 4. Tap tosendthemessage. DeleteaSingleMessageBubble Apps>

ChatON. andthentap 1. Press 2. Launchachatsessiontorevealthemessagestring. 3. TouchandholdamessagebubbleandthentapDelete. Flipboard TheFlipboardapplicationcreatesapersonalizeddigitalmagazineoutofeverythingbeingshared withyou.Accessnewsstories,personalfeedsandotherrelatedmaterial.Flipthroughyour Facebooknewsfeed,tweetsfromyourTwitteraccount,photosfromfriendsandmuchmore. 1. Press andthentap Apps>

Flipboard. Accounts and Messaging 51 2. FollowthepromptstostartusingFlipboard,ortologintoyourFlipboardaccount. Google+

Google+makesmessagingandsharingwithyourfriendsaloteasier.YoucansetupCirclesof friends,visittheStreamtogetupdatesfromyourCircles,useMessengerforfastmessagingwith everyoneinyourCircles,oruseInstantUploadtoautomaticallyuploadvideosandphotostoyour ownprivatealbumonGoogle+.Visitgoogle.com/mobile/+/formoreinformation. Google+usesyourGoogleAccount.IfyoudontalreadyhaveaGoogleAccountsetuponyour phone,youcansetoneup. 1. Press 2. IfyouaresignedintomorethanoneGoogleAccount,selecttheaccountyouwouldliketouse Google+. Apps>

andtap withGoogle+. 3. FollowtheonscreeninstructionstouseGoogle+. Hangouts HangoutsisanapplicationforinstantmessagingofferedbyGoogle.Conversationlogsare automaticallysavedtoaChatsareainyourGmailaccount.Thisallowsyoutosearchachatlogand storetheminyourGmailaccounts. Note: IfyouhavealreadysignedintoyourGoogleaccount,itdisplaysontheHangoutsscreen. andtap Apps>

Hangouts. n Press YouTube YouTubeisavideosharingwebsiteonwhichuserscanuploadandsharevideos.Thesiteisused todisplayawidevarietyofuser-generatedvideocontent,includingmovieclips,TVclips,andmusic videos,aswellasvideocontentsuchasvideoblogging,informationalshorts,andotheroriginal videos. YouTubeisadata-intensivefeature.Checkyourdataplantoavoidadditionaldatacharges. andtap Apps>

n Press Note: ItisnotnecessarytosignintotheYouTubesitetoviewcontent.However,ifyouwishtosign intoaccessadditionaloptionstapSign inunderthe ACCOUNT tab.Selectanaccount(if available)orcreateanewaccount.(EvenifyousignintoYouTubeviatheWeb,youmust separatelysigninviayourphone.) YouTube. Accounts and Messaging 52 Apps and Entertainment AllyourphonesfeaturesareaccessiblethroughtheAppslist. Samsung Link SamsungLinkmakesstayingconnectedeasy.YoucanwirelesslysynchronizeyourSamsung devicewithyourTV,streamcontent,andevenkeeptabsonwhocallsorsendstextmessageswith real-time,on-screenmonitoring. SamsungLinkallowsuserstosharetheirin-devicemediacontentwithotherexternaldevicesusing DLNAcertified(DigitalLivingNetworkAlliance)Devices.Theseexternaldevicesmustalsobe DLNA-compliant.Wi-FicapabilitycanbeprovidedtoTVsviaadigitalmultimediastreamer(not included). SamsungLinkusesyourSamsungaccount.ThefirsttimeyoulaunchSamsungLink,followthe promptstosignintoyourSamsungaccount,orcreateanewaccount. Bothyourphone,andthedevicesthatconnecttoyourphone,mustbeonthesameWi-Fiaccess point(AP).FormoreinformationaboutusingWi-Fi,seeWi-Fi. Note: Dependingonthesoftwareversiononyourphone,youmayseeAllSharePlaypreloaded,or SamsungLink.IfyouhaveAllSharePlay,youllbepromptedtoupgradetoSamsungLinkthefirst timeyoulaunchAllSharePlay. 1. Press 2. FollowthepromptstosignintoyourSamsungaccountandlearnaboutSamsungLink. Samsung Link. Apps>

andtap 3. OntheSamsungLinkscreen,swipeyourfingerleftorrightacrossthescreentoscrollbetween Photos,Music,Video,orDocumenttypes. 4. TosetoptionsforSamsungLink,swiperightfromtheedgeofthescreenforoptions:

l All content:Displayallcontentcategories. l Registered devices:StreamorsharemultimediacontentfromyourdevicetootherDLNA-

compliantdevicesconnectedtothesameWi-Finetwork.WhenyoulaunchSamsungLink, compatibledevicesonthesameWi-FinetworkdisplayautomaticallyinRegistereddevices. l Registered storage:Addstorageservice(s)toviewmultimediafilesanywhere.Storage servicesincludeWebstorage,suchasDropBoxorotherservices.Webstorageis sometimesreferredtoasthecloud. Configure Samsung Link Settings ConfigureSamsungLinkoptions,suchasstoragelocation,accountinformation,andregistered storageservices. 1. Press andtap Apps>

Samsung Link. Apps and Entertainment 53 2. Tap

>Settingsforoptions:

l Registered storage:AddaWebstorageservice,tovieworsharefiles. l Save to:Chooseadefaultfilestoragelocation.Youcansavetoyourphonesinternal memoryortoanoptionalinstalledmemorycard(SDcard,notincluded). l Auto upload:WhenturnedOn,photosandvideosfromyourdevicewillbeautomatically uploadedtoyourPC,ortoaWebstorageservice.Youcanalsochoosehowfilesare uploaded.TurnOnUse mobile networkstoallowyourphonetouseyourphones connectiontothewirelessdatanetwork,orturnitOfftoonlyallowuploadswhenconnected toWi-Fi. l Video optimization:WhenturnedOn,videoqualityforstreamedvideocontentisoptimized dependingoncurrentnetworkconditions. l Password lock:WhenturnedOn,youmustenteryourSamsungaccountpasswordtostart SamsungLink. l My account:AccessinformationaboutyourSamsungaccount. l About this service:LearnaboutSamsungLink. Use Samsung Link to Share Media with Another Device SharemediawithanotherDLNA-compliantdeviceviaSamsungLink. Bothyourdevice,andthedevice(s)thatconnecttoyourdevice,mustbeonthesameWi-Fiaccess point(AP).FormoreinformationaboutusingWi-Fi,seeWi-Fi. 1. Press 2. LaunchAllSharePlayorSamsungLinkonthetargetdevice. Samsung Link. Apps>

andtap 3. Onyourphone,swipethescreenfromtheleftside,andthenchooseasourceformedia.You canchoosearegistereddevice,orregisteredstorage. 4. Choosemediatoshare.Tapanitem,toselectit,ortap toselectmultipleitems.

,andthenfollowthepromptstochoosethetargetdevice. 5. Tap DivX DivX,DivXCertifiedandassociatedlogosaretrademarksofRoviCorporationoritssubsidiaries andareusedunderlicense. DivXCertifiedtoplayDivXvideouptoHD720p,includingpremiumcontent. ABOUTDIVXVIDEO:DivXisadigitalvideoformatcreatedbyDivX,LLC,asubsidiaryofRovi Corporation.ThisisanofficialDivXCertifieddevicethathaspassedrigoroustestingtoverifythatit Apps and Entertainment 54 playsDivXvideo.Visitdivx.comformoreinformationandsoftwaretoolstoconvertyourfilesinto DivXvideos. ABOUTDIVXVIDEO-ON-DEMAND:ThisDivXCertifieddevicemustberegisteredinorderto playpurchasedDivXVideo-on-Demand(VOD)movies.Toobtainyourregistrationcode,locatethe DivXVODsectioninyourdevicesetupmenu(tapApps>Settings>More>About device>

Legal information>License settings >DivX VOD >Register).Gotovod.divx.comformore informationonhowtocompleteyourregistration. Important: DivXVODcontentisprotectedbyaDivXDRM(DigitalRightsManagement)system thatrestrictsplaybacktoregisteredDivXCertifieddevices. Locating Your VOD Registration Number FollowtheseprocedurestolocateyourVODregistrationnumber. n Press andtap

>Settings>More>About device>Legal information>

License settings>DivX VOD>Register. Register Your DivX Device for VOD Playback of Purchased Movies ToplaypurchasedDivXmoviesonyourSamsungGalaxySIIIphone,youwillfirstneedtocomplete aone-timeregistrationusingbothyourphoneandyourcomputer. 1. LocateyourVODRegistrationcode.Press andtap

>Settings>More>About device>Legal information>License settings>DivX VOD>Register. 2. OpentheDivXPlayeronyourcomputer.Todownloadthefreeplayerforyourcomputer,visit divx.com. 3. FromtheDivXPlayeronyourcomputer,choosetheVODmenuandselectRegisteraDivX CertifiedDevice.Followthepromptstologin,orcreateaDivXaccountifyoudontalreadyhave one. 4. FollowtheinstructionsinDivXPlayertoenteryourphonesVODregistrationcodeandcreatea phonenickname. 5. ChoosealocationonyourcomputertodownloadtheDivXregistrationvideo,andthen downloadthefile. 6. ConnectyourphonetothecomputerviaUSBandtransfertheDivXregistrationvideotoyour phone.FromtheRegistrationscreen(Transfer),selectUSB(thephone)asthetarget destinationfortheDivXregistrationvideoandtapStart.ReturntotheDivXVODManager screen(fromwithinyourcomputersDivXPlayer)andconfirmbothyourcomputerandyournew phoneappearsinthelistofregisteredDivXdevices. Note: ThereisnospecialregistrationorconfigurationnecessarytoplaybackDRM-freeDivX movies.RegistrationofyourphoneisonlyrequiredforplaybackofDivXmaterial. Apps and Entertainment 55 Google Play Books WithGooglePlayBooks,youcanfindmorethan3millionfreee-booksandhundredsofthousands moretobuyintheGooglePlayStore. andtap Apps>

n Press Google Play Magazines WithGooglePlayMagazines,youcansubscribetoyourfavoritemagazinesandhavethemavailable toreadonyourphoneatanytimeoranyplace. Play Books. andtap Apps>

Play Magazines. n Press Game Hub GameHubprovidesapremiumone-stopservicecenterthatletsyouplay,connect,andshare gamesoncompatibleSamsungAndroiddevices. Note: YoumusthavetheSamsungAccountapplicationinstalledandregisteredpriortousing GameHub. 1. Press 2. Readtheon-screendisclaimerandtapConfirm. andthentap Game Hub.

>

3. Followtheonscreeninstructionsandnavigatetoyourfavoritegamesandservices. Google Play Store TheGooglePlayStoreistheplacetogotofindnewAndroidapps,games,movies,music,and booksforyourphone.Choosefromawidevarietyoffreeandpaidappsrangingfromproductivity appstogames.Whenyoufindanappyouwant,youcaneasilydownloadandinstallitonyour phone. ToaccesstheGooglePlayStoreyoumusthaveaGoogleAccountsetuponyourphone.See CreateaGoogleAccountfordetails. Important: Third-partyapplicationsmayaccessyourpersonalinformationorrequireyourservice providertodiscloseyourcustomerinformationtothethird-partyapplicationprovider.Tofindouthow athird-partyapplicationwillcollect,access,use,ordiscloseyourpersonalinformation,checkthe applicationproviderspolicies,whichcanusuallybefoundontheirwebsite.Ifyouarentcomfortable withthethird-partyapplicationspolicies,dontusetheapplication. Find and Install an App WhenyouinstallappsfromtheGooglePlayStoreappandusethemonyourphone,theymay requireaccesstoyourpersonalinformation(suchasyourlocation,contactdata,andmore)or Apps and Entertainment 56 accesstocertainfunctionsorsettingsofyourphone.Downloadandinstallonlyappsthatyoutrust. Note: YouneedaGoogleWalletaccounttopurchaseitemsfromtheGooglePlayStoreapp. 1. Press 2. Browsethroughthecategories(Apps,Games, Music, Books,MagazinesorMovies & TV), Play Store. Apps>

andtap findanappyou'reinterestedin,andtapthename. 3. Followthepromptstodownloadandinstalltheapp. Warning: Read the notification carefully!Beespeciallycautiouswithappsthathaveaccessto manyfunctionsorasignificantamountofyourdata.OnceyoutapOKonthisscreen,youare responsiblefortheresultsofusingthisitemonyourphone. Create a Google Wallet Account YoumusthaveaGoogleWalletaccountassociatedwithyourGoogleAccounttopurchaseitems fromtheGooglePlayStoreapp. Dooneofthefollowing:

n Onyourcomputer,gotogoogle.com/wallet/tocreateaGoogleWalletaccount. or ThefirsttimeyouuseyourphonetobuyanitemfromtheGooglePlayStoreapp,youre promptedtoenteryourbillinginformationtosetupaGoogleWalletaccount. Warning: WhenyouveusedGoogleWalletoncetopurchaseanitemfromtheGooglePlayStore app,thephoneremembersyourpassword,soyoudontneedtoenteritthenexttime.Forthis reason,youshouldsecureyourphonetopreventothersfromusingitwithoutyourpermission.(For moreinformation,seeSecuritySettings.) Open an Installed App Thereareseveraloptionsforopeninganinstalledapp. andtap Appsandtaptheappicon. n Press Uninstall an App YoucanuninstallanyappthatyouhavedownloadedandinstalledfromGooglePlay.Youcannot uninstallappsthatarepreloadedonyourphone.

>Settings>More>Application manager>DOWNLOADED. 1. Press 2. Taptheappyouwanttouninstall,andthentapUninstall.Followthepromptstocompletethe andtap uninstall. Apps and Entertainment 57 Google Play Movies & TV TheGooglePlayMovies&TVapplicationallowsyoutoconnecttotheGooglePlayStoreand downloadamovieorTVshowtowatchinstantly.ChoosefromthousandsofmoviesandTVshows, includingnewreleasesandHDtitlesinGooglePlayandstreamtheminstantlyonyourAndroid phone.PreviouslyrentedmoviesareautomaticallyaddedtoyourMyMovieslibraryacrossyour phones. Apps>

Play Movies & TV. n Press andtap Google Search SearchtheWebwithGoogle. andtap Apps>

Google. n Press Note: AGoogleSearchwidgetdisplaysonthemainHomescreenbydefault.Youcantapthe widgettosearchfromtheHomescreen. Media Hub/Samsung Hub MediaHubisnowSamsungHub,youronestopforthehottestmovieandTVcontent.With hundredsoftitlesavailable,entertainingyourfamilyonthegowasnevereasier.Youcanrentor purchaseyourfavoritecontentandwatchfromanylocation.Featuringthestunningviewingquality Samsungisknownfor,SamsungHubisyourgatewaytomobilevideolikeyou'veneverexperienced itbefore. SamsungHubusesyourSamsungaccounttomanageaccessandaccountinformation. Note: YourphonemayhaveMediaHubpreloaded.WhenyoulaunchMediaHub,youwillbe promptedtoupgradetoSamsungHub. 1. Press 2. Scrollacrossthescreentoselectfromthefollowingavailablepages:

Samsung Hub. Apps>

andtap l Overview:Accessforallavailablecategoriesandrecentlyavailablecontentforpurchaseor rental. l MUSIC:Musicthatisavailableforpurchaseandallowsyoutosearchfornewmusic. l VIDEO:VideosandTVshowsthatareavailableforpurchase/rentalandallowsyouto searchfornewcontent. l BOOKS:Booksandmagazinesthatareavailableforpurchaseandallowsyoutosearchfor newcontent. l GAMES:Gamesthatareavailableforpurchaseorastrialsandallowsyoutosearchfornew content. Apps and Entertainment 58 3. Scrollthroughthemedialistings.Youcantapitemstobuyorrentthem.Asyoutapsomeitems, youcanlistenorwatchapreview. 4. Followthepromptstobuyorrentmedia. SamsungHubNotices l Anymediaitem(MediaContent)mayberentedorpurchasedafteryoucreateanaccountin SamsungHub. l MediaContentthatispurchasedanddownloadedmaybeviewedconcurrentlyonuptofive

(5)deviceswithSamsungHub(ortheservice)thatarealsoregisteredtothesame account. l Youmayremoveadevicefromyouraccountnomorethanonceevery90days. l YoumayremoveMediaContentfromadeviceasmanytimesasyoudlike.Youwillhavethe abilitytore-downloadtheMediaContentlatersubjecttocontentre-downloadavailabilityand contentproviderpermissions. l YoumayneednetworkcoveragetoaccessMediaContentyouhaveacquiredthroughthe Service. l Youcanuse3G,4G,orWi-FiconnectivitytodownloadMediaContent. l UnlikepurchasedMediaContent,rentedMediaContentwillbeviewableononly1devicein youraccountatatime. l MediaContentisdownloadedandsavedtoyourauthorizeddevice'sSDcard.NoSDCard includedoutofbox. l YourMediaContentmaypause/stopornotdownloadinnetworkswherethereisaweak signal. l YoumaybeginwatchingdownloadedMediaContentassoonasa)licenseacquisitionhas occurredandb)sufficientamountoftheMediaContenthasbeenbuffered. l YoumustfinishwatchingMediaContentwithinthetimelimitsetoutforeachpieceofcontent

(whichmaybeasshortas24consecutivehours). o Stopping,pausingorrestartingrentedMediaContentdoesnotextendtheavailable viewingtime. o InnoeventwillrentedMediaContentbeavailableforaperiodofmorethanthirty(30) days(orshorteronatitle-by-titlebasis)aftertheMediaContenthasbeenrented(e.g.,if youbeginviewingrentedMediaContentonthe29thdayaftertherentaltransaction,but donotfinishviewingtheentiretitle,thatrentedMediaContentmaynotbeavailablefor theentiretwenty-four(24)consecutivehourperiodifsuchperiodwouldextendthe viewabletimebeyondthethirty(30)dayrentalwindow). l UnlessotherwiserestrictedbytheContentProviders,youcandownloadMediaContentto yourTVusingHDMIconnections;otherwise,youcannotplayMediaContentdownloaded Apps and Entertainment 59 fromyourmobiledeviceoutput. Sprint TV & Movies WithSprintTV&Movies,youcanwatchliveTVandaccessmoviesandotherondemand entertainmentonthego. InstalltheSprintTV&MoviesApponYourPhone BeforeyouuseSprintTV&Moviesonyourphone,youmustdownloadandinstalltheappfromthe GooglePlayStoreapp. andtap Play Store. 1. Press 2. TouchtheSearchiconandsearchfor"sprinttv". 3. TouchSprint TV & Moviesfromtheresultslist.Followthepromptstoinstalltheapp.

>

Note: Afterinstalling,youcanopentheappfromthehomescreen.Press Apps>

SprintTV & Movies. andtap YourSprintTVChannelOptions TheSprintTVapplicationoffersawidevarietyofaccessiblechannels.Subscriptionoptionsinclude comprehensivebasicpackagesaswellasafullmenuofalacartechannels.Visit sprintchannels.mobitv.comformoreinformationonchannelsandpricing. Note: Coverageisnotavailableeverywhere.Contentandlineupsubjecttochange.Select channelsalsoavailableforcasualusage.Gotosprintchannels.mobitv.comformoreinformation. WatchTV 1. Press 2. Inthetopbar,touchanoptiontoseewhatsavailable,andthenbrowsethroughtheavailable SprintTV & Movies. Apps>

andtap programmingandtouchacliporchanneltoviewtheprogram. Note: Thefirsttimeyouaccessachannelthatrequiresasubscription,youwillbepromptedto purchaseaccess.TouchSubscribetopurchaseaccess,ortouchPreviewtoseeapreviewofthe selectedchannel. Tip: Forquickaccess,touchafeaturediteminthecenterofthescreenorselectalivechannelfrom thebottombar. Google Play Music GooglePlayMusicletsyoubrowse,shop,andplaybacksongspurchasedfromtheGooglePlay Storeapp,aswellassongsyouhaveloadedfromyourownmusiclibrary.Themusicyouchooseis automaticallystoredinyourGoogleMusiclibraryandinstantlyreadytoplayordownload. Apps and Entertainment 60 andtap Apps>

Play Music. n Press Music Hub MusicHubletsyouuploadyourmusiccollectiontothecloud,stream,andpurchasesongsfroman extensivecatalog,andlistentopersonalradio. Note: YoumusthavetheSamsungAccountapplicationinstalledandregisteredpriortousing MediaHub. andtap Apps>

Music Hub. n Press Music App TheMusicappisanapplicationthatcanplaymusicfiles.LaunchingMusicallowsyoutonavigate throughyourmusiclibrary,playsongs,andcreateplaylists(musicfilesbiggerthan300KBare displayed). 1. Press 2. Tapalibrarycategoryatthetopofthescreen(Songs,Playlists,Albums,Artists,orFolders) Apps>

andtap Music. toviewtheavailablemusicfiles. 3. Scrollthroughthelistofsongsandtapanentrytobeginplayback. Sprint Music Plus SprintMusicPlusisSprintsofficialmusicstore.Itgivesyouexactlythatwithafull-featuredmusic andtonemanagerallowingyoutoeasilymanageyourmusiccontentallinoneconvenientplace. SprintMusicPlusletsyourockoutwhileyoucreatemusicandringtoneplaylists,assignringback tonestoplayfordifferentcallers,andgetsongrecommendationsbasedonyourmusictastes. InstallSprintMusicPlusonYourPhone BeforeyouuseSprintMusicPlusApponyourphone,youmustdownloadandinstalltheappfrom theSprintZoneapp. andtap Play Store. 1. Press 2. TaptheSearchiconandsearchfor"sprintmusicplus". 3. TapSprint Music Plusfromtheresultslist.Followthepromptstoinstalltheapp. Apps>

Note: Afterinstalling,youcanopentheappfromthehomescreen.Press andtap Apps>

Sprint Music Plus. Apps and Entertainment 61 UseSprintMusicPlus UseSprintMusicPlustoplaymusicalreadyonyourphone,aswellasnewmusicyoupurchasefrom theSprintMusicPlusStore. 1. Press 2. Taptheiconintheupperleftcorner,selectacategory,andtouchasongtobeginplayback. Sprint Music Plus. Apps>

andtap l Taptheonscreennavigationtoolstoskipaheadorrewind. l Tap atanytimeformoreoptions. PurchaseandDownloadMusicfromtheSprintMusicPlusStore FromtheSprintMusicPlusStore,youcanshopforsongstopurchaseanddownloadtoyourphone. 1. Press 2. Enterasongorartistinthesearchfieldorbrowsethroughoptionsinthevariouscategories. Sprint Music Plus>Music Store. Apps>

andtap 3. Tapasongtoselectit.(Thesonginformationscreenisdisplayed.) 4. Followtheonscreeninstructionstoprevieworpurchasethesong.Tap options. atanytimeformore Tip: Forringtonesorringbacktones,tapRingtones StoreorRingbacks StorefromtheSprint MusicPlusmainmenu. Scout ScoutbyTelenavisadailypersonalnavigatorthathelpsyougetwhereyouregoing.Itletsyou seeandhearturn-by-turndirectionsanditcanprovideimportant,personalizedinformationabout trafficandalternateroutes. InstalltheScoutApponYourPhone BeforeyouuseScoutonyourphone,youmustdownloadandinstalltheappfromtheGooglePlay Storeapp. andtap 1. Press 2. TaptheSearchiconandsearchfor"scout". 3. TapScout GPS Navigation & Trafficfromtheresultslist,andthenfollowthepromptsto Play Store. Apps>

downloadandinstalltheapp. Apps and Entertainment 62 Note: Afterinstalling,youcanopentheappfromthehomescreen.Press Apps>

Scout. andtap EnableLocationServicesonYourPhone Beforeusinganylocation-basedservices,youmustenableyourphonesGPSlocationfeature.For moreinformationaboutlocationservices,seeLocationServicesSettings. UseScoutasYourPersonalNavigator Scout. Apps>

n Press andtap Google Maps UsetheGoogleMapsapplicationtofinddirections,locationinformation,businessaddresses,etc. DetermineyourcurrentlocationwithorwithoutGPS,getdrivingandtransitdirectionsandgetphone numbersandaddressesforlocalbusinesses. EnableLocationServicesonYourPhone Beforeusinganylocation-basedservices,youmustenableyourphonesGPSlocationfeature.For moreinformationaboutlocationservices,seeLocationServicesSettings. UseGoogleMaps Maps. andtap Apps>

n Press Sprint Zone TheSprintZoneappwillkeepyouup-to-dateonalltheSprintinformationthatmattersmosttoyou. Thisincludesaccesstoyouraccountinformation,thelatestSprintpromotionsandcustomernews, helpwithyourphoneandaccount,andSprintssuggestionsforapps. andtap Apps>

n Press Video App TheVideoapplicationplaysvideofilesstoredinyourphonesmemory,oronanoptionalinstalled memorycard(notincluded). Sprint Zone. andtap Apps>

1. Press 2. Bydefault,videosdisplaybynameinanarrayofthumbnails.Youcanalsodisplayyourvideosin analphabeticallistbytouchingtheListtab,ortouchtheFolderstabtolistthefolderswhereyour videosarestored. Video. Apps and Entertainment 63 3. Toplayavideo,simplytouchitsthumbnailorlistentry. 4. Thefollowingvideocontrolsareavailable:

l l l l l l Pausethevideo. Startthevideoafterbeingpaused. Touchandholdtorewindthevideo.Touchtogotopreviousvideo. Touchandholdto fast-forwardthevideo.Touchtogotonextvideo. TaptosetVolume. TaptodisplaythevideoinaPopUpPlaywindow.Thevideoplaysinasmallwindow soyoucanuseyourphoneforotherpurposeswhilewatchingthevideo.Toreturnto previoussize,double-tapthescreen.Formoreinformation,see l Original size view.Thevideoplaysinitsoriginalsize. Note: Thescreenviewiconsareathree-waytoggle.Theiconthatdisplays,isthemodethat displaysaftertappingtheicon. 5. Whileplayingavideo,tap foroptions. l Share via:SendthevideobyBluetooth,ChatON,Dropbox,Email,Gmail,Google+, Messaging,Picasa,Wi-FiDirect,orYouTube. l Chapter preview:Displayschapters(ifchapterinformationisrecordedinthevideo).Touch achaptertobeginplayingthevideoatthatpoint. l Trim:Trimtheoriginalvideoortrimthevideoandcreateanewvideo. l Via Bluetooth:TurnBluetoothontouseBluetoothservices. l Video auto off:Chooseanoption,tohaveyourphoneautomaticallystopplayingvideos afteraperiodoftimeyouset. l Settings:Configureplaybacksettings:

o Mini controller:Chooseoptionsfordisplayingasmallsetofcontrolsonscreenduring playback. o Brightness:Chooseabrightnesslevelforthescreen. o Capture:Saveastillpicturefromthevideo. o Play speed:Chooseaspeedforplayback. o SoundAlive:UseSoundAliveaudioeffectswithearphones. Apps and Entertainment 64 o Subtitles (CC):Viewclosed-captioningsubtitlesforthevideo,ifavailable o Tag buddy:WhenturnedOn,weather,location,and/ordateinformationisstoredinthe videofile. l Details:Providesdetailsaboutthevideo,suchasfilename,format,resolution,filesize, availabilityforforwarding,audiochannel,last-modifieddate,andstoragelocation. UsePopUpPlay PopUpPlayallowsyoutoviewavideoinawindowthatfloatsontheHomescreen,soyoucan multitaskwhilewatchingthevideo.YoucanmovethePopUpPlaywindowonthescreen,anddrag theedgesofthewindowtoresizeit. 1. Press 2. Selectavideoandplayit. andtap Apps>

Video. 3. Tap tocontinueviewingthevideoinaPopUpPlaywindow.Youmayneedtotapthe screentodisplaytheplaybackcontrols.WhileviewingthevideointhePopUpPlaywindow,you cantapthescreentopauseplayback. Apps and Entertainment 65 Web and Data Thefollowingtopicsaddressyourphonesdataconnectionsandthebuilt-inWebbrowser. Additionaldata-relatedfeaturescanbefoundinAccountsandMessaging,AppsandEntertainment, andToolsandCalendar. YourphonesdatacapabilitiesletyouwirelesslyaccesstheInternetoryourcorporatenetwork throughavarietyofconnections,including:

Internet YourphonesWebbrowsergivesyoufullaccesstobothmobileandtraditionalwebsitesonthego, using3G,4G,orWi-Fidataconnections. andtap Internet. n Press Note: InternetlaunchesautomaticallywhenyoutouchaWeblinkinatextoremailmessage. Data Services (Sprint 3G) WithyourSprintservice,youarereadytostartenjoyingtheadvantagesofdataservices.The followingtopicswillhelpyoulearnthebasicsofusingyourdataservices,includingmanagingyour username,launchingadataconnection,andnavigatingtheWebwithyourphone. Important: Certaindataservicesrequestsmayrequireadditionaltimetoprocess.Whileyour phoneisloadingtherequestedservice,thetouchscreenkeyboardmayappearunresponsivewhen infactitisfunctioningproperly.Allowthephonesometimetoprocessyourrequest. Your Data Services User Name Whenyoubuyyourphoneandsignupforservice,youreautomaticallyassignedausername,which istypicallybasedonyournameandanumber,followedby@sprintpcs.com.(Forexample,the thirdJohnSmithtosignupforSprintdataservicesmighthavejsmith003@sprintpcs.comashisuser name.) Whenyouusedataservices,yourusernameissubmittedtoidentifyyoutotheNationwideSprint Network.Yourusernameisautomaticallyprogrammedintoyourphone.Youdonthavetoenterit. UpdateYourUserName Ifyouchoosetochangeyourusernameandselectanewoneonline,ormakeanychangestoyour services,youmustthenupdatetheprofileonyourphone.

>Settings>More>System update. andtap 1. Press 2. TapUpdate Profile. Launch a Web Connection FollowthebelowproceduretolaunchaWebconnection. Web and Data 66 andtap Internet.(Yourdataconnectionstartsandyouseethehomepage.) n Press Note: ThefirsttimeyouaccesstheWebonyourphone,youmaybepromptedtosigninwithyour phonenumber.Enteryournumberandtap Ok. 4G Services 4Gisaservicethatmustbeincludedinyourserviceplanandalsoavailablewithinyourarea.4G coverageiscurrentlyavailableinonlycertainmarkets.Formoredetailson4Gavailabilitygoto:

sprint.com/4GandclicktheCoverage maplink. Note: If4Gserviceisnotincludedinyourserviceplan,the4Giconwillnotappearinthe Notificationsarea. Notallservicesareavailableon4Gandcoveragemaydefaultto3G/separatenetworkwhere4G unavailable. Important: 4Gservicemustbeaddedtoyouraccountbeforeattemptingaconnectiontothe4G network. DependingonwhichiconsappearwithintheNotificationsarea,yourservicesandfeatureswill change. Wi-Fi Wi-FiprovideswirelessInternetaccessoverdistancesofupto300feet.TouseyourphonesWi-Fi, youneedaccesstoawirelessaccesspointorhotspot. TheavailabilityandrangeoftheWi-Fisignaldependsonanumberoffactors,including infrastructureandotherobjectsthroughwhichthesignalpasses. Turn Wi-Fi On and Connect to a Wireless Network Bydefault,yourphonesWi-Fifeatureisturnedoff.TurningWi-Fionmakesyourphoneableto discoverandconnecttocompatiblein-rangeWi-Finetworks(orWAPs-wirelessaccesspoints). andthentap

>Settings>Connections. TurnWi-FiOn 1. Press 2. TaptheON/OFFswitchbesideWi-FitoturnWi-FiOn. Tip: YoucanalsoturnWi-FionandoffthroughtheNotificationpanel.DragtheNotificationpanel downandtapWi-FitoenableordisableWi-Fi. Note: MostWi-Finetworksareself-discoverable,whichmeansnoadditionalstepsarerequiredfor yourphonetoconnecttoaWi-Finetwork.Itmaybenecessarytoprovideausernameand passwordforcertainclosedwirelessnetworks. Web and Data 67 ConnecttoaWi-FiNetwork 1. Press 2. Thenetworknamesandsecuritysettings(OpennetworkorSecuredwithxxx)ofdetectedWi-Fi

>Settings>Connections>Wi-Fi. andtap networksaredisplayed. l Whenyouselectanopennetwork,youwillbeautomaticallyconnectedtothenetwork. l Whenyouselectasecurednetwork,youwillneedtoenterthewirelesspasswordtoconnect tothenetwork.EnterthepasswordandtapConnect.Youcanusetheshow password optiontodisplaythepasswordasyouenterit. AddaNewNetworkConnection 1. Press 2. TapAdd Wi-Fi network. andtap

>Settings>Connections>Wi-Fi. 3. EntertheNetworkSSID.ThisisthenameofyourWi-Finetwork. 4. TaptheSecurityfieldandselectasecurityoption.Thismustmatchthecurrentsecuritysetting onyourtargetnetwork. 5. TapConnecttostorethenewinformationandconnecttotheWi-Finetwork. Note: Thenexttimeyourphoneconnectstoapreviouslyaccessedorsecuredwirelessnetwork, youarenotpromptedtoenterthewirelesspasswordagain,unlessyouresetyourphonebacktoits factorydefaultsettings.

>Settings>Connections>Wi-Fi. ScanforaWi-FiNetwork 1. Press andtap 2. TapScan. Sprint Hotspot SprintMobileHotspotallowsyoutoturnyourphoneintoaWi-Fihotspot.Thefeatureworksbest whenusedinconjunctionwith4Gdataservices(although3Gservicecanalsobeused).See4G Servicesformoreinformation. SetUpSprintHotspot 1. Press 2. TaptheON/OFFslidernexttoSprint hotspottoturnSprinthotspotON. Sprint hotspot. Apps>

andtap l Whenactive,theNotificationsareaofthestatusbarshowsHotspot activated. Note: ConnectyourchargertoyourphoneifyouplantouseSprintHotspotforanextendedperiod. Web and Data 68 Important: Uponactivation,anycurrentWi-Ficonnectiontoanaccesspointisterminated. ConnecttoSprintHotspot 1. EnableWi-Fionyourtargetdevice(laptop,mediadevice,etc.). 2. ScanforWi-Finetworksfromthephoneandselectyourhotspotfromthenetworklist. l ThenetworknameforSprintHotspotonyourphonewillbeintheformofSPH-L710XXX.

(XXXrepresentsathree-digitnumberuniquetoyourphone.)Youcanchangethenameby tappingConfigurefromtheSprintHotspotscreen. 3. Selectthisphoneandfollowyouronscreeninstructionstoenterthepasskey(providedonthe SprintHotspotpage). 4. LaunchyourWebbrowsertoconfirmyouhaveanInternetconnection. AdjustYourSprintHotspotSettings 1. Press 2. TapConfigureforoptions,includingNetwork (SSID),devicevisibility(Hide my device), Sprint hotspot. Apps>

andtap Security[OpenorWPA2PSK],Password,passwordvisibility(Show password),andother advancedoptions. 3. TapSavetostorethenewhotspotsettings. Bluetooth UseBluetoothtoshareinformationwithotherdevices,ortoconnecttootherdevices,suchas headsets. Turn Bluetooth On or Off ThefollowingprocedureswillguideyouthroughturningonandturningoffyourBluetoothphone. andtap

>Settings>Connections>Bluetooth. 1. Press 2. TapON/OFFbesideBluetoothtoturnBluetoothon. Tip: YoucanalsoturnBluetoothonandoffthroughtheNotificationpanel.DragtheNotification paneldownandtapBluetoothtoenableordisableBluetooth. Note: TurnoffBluetoothwhennotinusetoconservebatterypower,orinplaceswhereusinga wirelessphoneisprohibited,suchasaboardanaircraftandinhospitals. Connect a Bluetooth Headset or Car Kit YoucanlistentomusicoveraBluetoothstereoheadset,orhavehands-freeconversationsusinga compatibleBluetoothheadsetorcarkit.Itsthesameproceduretosetupstereoaudioandhands-

freedevices. Web and Data 69 Tolistentomusicwithyourheadsetorcarkit,theheadsetorcarkitmustsupporttheA2DP Bluetoothprofile. 1. Press 2. IfBluetoothisnoton,taptheon-offslidertoturniton. andtap

>Settings>Connections>Bluetooth. 3. Makesurethattheheadsetisdiscoverable,sothatyourphonecanfindtheheadset.Refertothe instructionsthatcamewiththeheadsettofindouthowtosetittodiscoverablemode. 4. TapScan.YourphonewillstarttoscanforBluetoothdeviceswithinrange. 5. WhenyouseethenameofyourheadsetdisplayedintheBluetoothdevicessection,tapthe name.Yourphonethenautomaticallytriestopairwiththeheadset. 6. Ifautomaticpairingfails,enterthepasscodesuppliedwithyourheadset. Thepairingandconnectionstatusisdisplayedbelowthehands-freeheadsetorcarkitnameinthe Bluetoothdevicessection.WhentheBluetoothheadsetorcarkitisconnectedtoyourphone,

(Bluetoothconnected)displaysinthestatusbar.Dependingonthetypeofheadsetorcarkityou haveconnected,youcanthenstartusingtheheadsetorcarkittolistentomusicormakeandreceive phonecalls. Note: DuetodifferentspecificationsandfeaturesofotherBluetooth-compatibledevices,display andoperationsmaybedifferent,andfunctionssuchastransferorexchangemaynotbepossible withallBluetooth-compatibledevices. Reconnect a Headset or Car Kit Whenyouhavepairedaheadsetwithyourphone,youshouldbeabletoreconnectitautomatically byturningonBluetoothonyourphoneandthenturningontheheadset.However,sometimesyou willneedtoreconnectmanually,forexampleifyouhavebeenusingyourheadsetwithanother Bluetoothdevice. 1. Press 2. IfBluetoothisnoton,taptheon-offslidertoturniton. andtap

>Settings>Connections>Bluetooth. 3. Makesurethattheheadsetisdiscoverable. 4. TaptheheadsetsnameintheBluetoothdevicessection. 5. Ifpromptedtoenterapasscode,try0000or1234,orconsulttheheadsetorcarkit documentationtofindthepasscode. 6. Ifyoustillcannotreconnecttotheheadsetorcarkit,followtheinstructionsinDisconnector UnpairFromaBluetoothDevice,andthenfollowtheinstructionsinConnectaBluetooth HeadsetorCarKit. Disconnect or Unpair from a Bluetooth Device FollowtheseinstructionstodisconnectorunpairyourphonefromaBluetoothdevice. Web and Data 70 DisconnectfromaBluetoothDevice 1. Press andtap

>Settings>Connections>Bluetooth. 2. IntheBluetoothdevicessection,tap nexttothedevice,andthentapDisconnect. UnpairfromaBluetoothDevice YoucanmakeyourphoneforgetitspairingconnectionwithanotherBluetoothdevice.Toconnectto theotherdeviceagain,youmayneedtoenterorconfirmapasscodeagain. 1. Press andtap

>Settings>Connections>Bluetooth. nexttothedevice,andthentapUnpair. 2. IntheBluetoothdevicessection,tap Send Information Using Bluetooth YoucanuseBluetoothtotransferinformationbetweenyourphoneandanotherBluetooth-enabled devicesuchasaphoneornotebookcomputer.Thefirsttimeyoutransferinformationbetweenyour phoneandanotherdevice,youneedtoenterorconfirmasecuritypasscode.Afterthat,yourphone andtheotherdevicearepaired,andyouwillnotneedtoexchangepasscodestotransferinformation inthefuture. Youcansendthefollowingtypesofinformation,dependingonthedeviceyouaresendingto:

n Imagesandvideos n Calendarevents n Contacts n Audiofiles Thelocationwheretheinformationissaveddependsonthetypeofinformationandthereceiving device. SendInformationfromYourPhonetoAnotherDevice 1. TurnBluetoothOn,onyourdeviceandthetargetdevice. l Onyourdevice,press l Setthereceivingdevicetovisibleordiscoverablemode.Refertothedevicesdocumentation

>Settings>Connections>Bluetooth. andtap forinstructionsonreceivinginformationoverBluetooth. 2. Onyourphone,opentheapplicationthatcontainstheinformationorfileyouwanttosend.For example,ifyouwanttosendaphoto,press andtap Apps>

Gallery. 3. Followthestepsforthetypeofitemyouwanttosend:

Web and Data 71 l Photos and videos:FromGallery,ontheAlbumstab,tapanalbum,tapanitem,andthen tap

>Bluetooth. l Calendar event:IntheCalendarsDayview,Agendaview,orWeekview,taptheeventand thentap

>Share via>Bluetooth. l Music track:FromtheMusicapp,ontheNowplayingscreen,tap l Voice recording:OnthemainVoiceRecorderscreen,touchandholdarecordingandthen

>ViaBluetooth. tapShare via>Bluetooth. 4. Tapthetargetdevice,andthenfollowthepromptsonthetargetdevicetoacceptthetransfer. Receive Information Using Bluetooth YourphoneiscapableofreceivingawidevarietyoffiletypeswithBluetooth,includingphotos,music tracks,anddocumentssuchasPDFs. 1. Press 2. IfBluetoothisnoton,taptheon-offslidertoturniton. andtap

>Settings>Connections>Bluetooth. 3. Tapthecheckboxnexttoyourphone'sBluetoothnametomakeitdiscoverable. 4. Onthesendingdevice,sendoneormorefilestoyourphone.Refertothedevices documentationforinstructionsonsendinginformationoverBluetooth. 5. Followthepromptsonyourphonetoacceptthetransfer.Whenyouopenareceivedfile,what happensnextdependsonthefiletype:

l Mediafilesanddocumentsareusuallyopeneddirectlyinacompatibleapplication.For example,ifyouopenamusictrack,itstartsplayingintheMusicapplication. l Foranevent(vCalendarfile),selectthecalendarwhereyouwanttosavetheevent,and thentapImport.TheeventisaddedtoyourCalendar.(Formoreinformationonusingthe Calendar,seeCalendar.) l Foracontactrecord(vCardfile),youcanchoosetoimportone,several,orallofthose contactstoyourcontactslist. Virtual Private Networks (VPN) Fromyourphone,youcanadd,setup,andmanagevirtualprivatenetworks(VPNs)thatallowyou toconnectandaccessresourcesinsideasecuredlocalnetwork,suchasyourcorporatenetwork. Prepare Your Phone for VPN Connection DependingonthetypeofVPNyouareusingatwork,youmayberequiredtoenteryourlogin credentialsorinstallsecuritycertificatesbeforeyoucanconnecttoyourcompanyslocalnetwork. Youcangetthisinformationfromyournetworkadministrator. Web and Data 72 BeforeyoucaninitiateaVPNconnection,yourphonemustfirstestablishaWi-Fiordataconnection. Forinformationaboutsettingupandusingtheseconnectionsonyourphone,seeLaunchaWeb ConnectionandTurnWi-FiOnandConnecttoaWirelessNetwork. Set Up a Screen Lock IfyournetworkadministratorinstructsyoutodownloadandinstallsecuritycertificatesforVPN access,youllneedtosetupapattern,PIN,orpasswordscreenlocktoprotectinformationonyour phone. Formoreinformation,seeScreenLock. Add a VPN Connection ThefollowingproceduresoutlinethemethodtousewhenaddingaVPNconnection. 1. Press andtap

>Settings>Connections>More networks>VPN. 2. Tap

,andthenentertheinformationfortheVPNyouwanttoadd.Informationincludes Name,Type,Server address,PPP encryption (MPPE),andShow advanced options. ConsulttheVPNadministratorformoreinformation. 3. Whenfinished,tapSave. Connect to a VPN ThefollowingdescribeshowtoconnecttoaVPN. andtap 1. Press 2. IntheVPNssection,taptheVPNthatyouwanttoconnectto. 3. Whenprompted,enteryourlogincredentials,andthentapConnect.Whenyouareconnected,

>Settings>Connections>More networks>VPN. anotificationdisplays. 4. OpentheWebbrowsertoaccessresourcessuchasintranetsitesonyourcorporatenetwork. Disconnect from a VPN ThefollowingdescribeshowtodisconnectfromaVPNconnection. 1. Touchandholdthetitlebar,andthendragdowntoopentheNotificationpanel. 2. TaptheVPNconnectiontoreturntotheVPNsettingsscreen,andthentaptheVPNconnection todisconnectfromit. Web and Data 73 Camera and Video Usethecameratotakeandsharepicturesandvideos. Important: Donottakephotosofpeoplewithouttheirpermission.Donottakephotosinplaces wherecamerasarenotallowed.Donottakephotosinplaceswhereyoumayinterferewithanother personsprivacy. Take Pictures LaunchtheCameraapptotakepictures. 1. Press andtap Apps>

Camera. 2. Usingthedisplayasaviewfinder,composeyourpicturebyaimingthelensatthesubject.You canrotatethephonetoanyposition,andthescreencontrolsrotatetomaketakingpictureseasy. 3. Asyoucomposeapicture,theCameraautomaticallyfocusestheshot(thefocusbracketturns green),or:

l Touchthescreentofocusontheareayoutouched. l Pinchthescreen,orpresstheVolumeKey,tozoominorout. l Configureotheroptions.Formoreinformation,seePictureOptions. 4. Totakethepicture,tap Picture Options Setoptionsforthepicturesyoutake. 1. Press 2. Configuretheseoptions:

andtap Apps>

Camera. Camera and Video 74 l Self-portrait:Switchbetweenthebackcameraandthefrontcamera,forself-portraits. l Flash:Chooseaflashsetting. l Shooting mode:Chooseanautomaticshootingmode.Somemodesarenotavailablefor Self-portraits. o Single shot:Takeasinglephoto. o Best photo:HolddownCapturetotakemultipleshots;thenchoosethebestshotsto keep. o Best face:HolddownCapturetotakemultipleshots;thenchoosethebestfaceona photosubjecttousethatfaceinthefinalshot. o Sound & shot:Recordupto9secondsofsoundwitheachpictureyoutake.Youcan recordsoundwhenyoutakethepicture,orafterthepictureistaken. o Face detection:Whilecomposingapicture,double-taponafacetozoominorout. o Panorama:TouchCapturetotakeapicture;thenusetheonscreenguidelinetomove theviewfinderandtakethenext12shotsautomatically. o Share shot:Sharethepicturesyoutake,withotherShareShot-capabledevicesviaWi-

FiDirect. o HDR:TakephotosinHighDynamicRange(HDR)modetoincreasedetail. o Buddy photo share:Whenyoutakeapicture,theCamerarecognizesfacesfrom Contacts,soyoucaneasilysharethepicturewithyourfriends. o Beauty:Adjustthecontrasttocreateasmoothfacialfeatureeffect. o Smile shot:TouchCapturetofocusonthesubjectsface.Ifasmileisdetected,the pictureistakenautomatically. o Low light:Adjustexposureautomatically,foroptimumpicture-takinginlow-light conditions.Becarefulnottoshakethephonewhiletakingpictures. l Effects:Applyaneffecttopictures. l Options o Edit shortcuts:Chooseshortcutstoappearonthetoolbar.Touchanddragshortcuts betweenthetoolbarandthelist. o Use the volume key as:ChoosewhetherpressingtheVolumeKeyzoomsinorout whencomposingashot,ortakesapicture. o Burst shot:WhenOn,touchandholdtheCapturebuttontotakeupto20shots automatically. o GPS tag:AddGPSlocationinformationtophotodetails. o Self-portrait:WhenOn,theCameratakespictureswiththefrontCamera. Camera and Video 75 o Flash:Choosethedefaultflashmode. o Shooting mode:Choosethedefaultmodefortakingpictures. o Effects:Applyaneffecttopictures. o Scene mode:Chooseamodetomatchthekindofpicturesyouretaking. o Exposure value:Setthedefaultbrightnesslevel. o Focus mode:Setthedefaultfocusmode. o Timer:SetadelaytowaitbetweentouchingtheCamerabuttonandtakingapicture. o Resolution:Chooseasizefortheimage. o White balance:Chooseasettingforthelightsource. o ISO:Chooseasettingforimagingsensitivity. o Metering:Selectamethodformeasuringlight. o Auto contrast:Allowautomaticlight/darkadjustment. o Guidelines:Enableordisableanon-screengridtoaidinphotocomposition. o Auto share shot:WhenturnedOn,youcaneasilyconnecttootherdevicesvia SBeamtosharepictureswithotherSBeamdevices.Tosharepictures,bringthe devicesback-to-back.Formoreinformation,seeSBeamSettings. o Anti-shake:Whenenabled,minimizestheeffectofcameramovement. o Contextual filename:Whenenabled,thefilenamethecameratothepictureincludes GPSinformation. o Voice control:Whenenabled,youcanspeakacommandtocaptureapicture. o Save as flipped:WhenOn,picturesorrecordingsyoumakeusingthefrontcameraare savedasamirror-image(onlyavailablewhenSelf-portraitisturnedOn). o Image quality:Chooseaqualitysettingforphotos. o Storage:Ifanoptionalmemorycardisinstalled(notincluded),choosethedefault storagelocationforpictures.Bydefaultallpicturesarestoredtothephonesinternal memory. o Reset:SetallCamerasettingstothedefaults. Share Pictures with Share Shot Youcansharepicturesyoutakewithotherdevices,usingtheSBeamandShareShotfeaturesof yourphone.Whenthefeaturesareenabled,picturesyoutakeareautomaticallysharedwiththe connecteddevice(s). Camera and Video 76 TouseShareShot,theNFCandSBeamfeaturesmustbeenabledonyourphone,andthedevice youwanttosharewith.Formoreinformation,seeNFCSettingsandSBeamSettings. 1. Press andtap Apps>

Camera.

>Share shot,andthenchooseOntoturnthefeatureOn. 2. Tap 3. Holdthedevicesback-to-back,andthentapthescreentostartsharing. 4. Asyoutakepictures,theyareautomaticallysharedwiththeotherdevice(s). Record Videos UsetheCameratorecordvideo. Important: Donottakevideosofpeoplewithouttheirpermission.Donottakevideosinplaces wherecamerasarenotallowed.Donottakevideosinplaceswhereyoumayinterferewithanother personsprivacy. 1. Press andtap Apps>

Camera,andthentapthe Modeswitchtolaunch recordingmode. 2. Usingthedisplayasaviewfinder,composeyourshotbyaimingthelensatthesubject.Youcan rotatethephonetoanyposition,andthescreencontrolsrotatetomakerecordingeasy. 3. Asyoucomposeashot,theCameraautomaticallyfocusestheshot(thefocusbracketturns green),oryoucanpinchorspreadyourfingersonthescreentozoominorout. 4. Tap Recordtobeginrecording.Whilerecording,youcanusetheseoptions:

l Tapthescreentochangethefocusareatotheareayoutapped. Camera and Video 77 l Tap Pausetotemporarilystoprecording. l Tap Stoptostoprecording. Video Options Configureoptionsforvideos. 1. Press 2. Configuretheseoptions:

andtap Apps>

Camera. l Self-recording:Switchbetweenthebackcameraandthefrontcamera,forrecording yourself. l Flash:Chooseaflashsetting. l Recording mode:Chooseanautomaticshootingmode.Somemodesarenotavailablefor Self-recording. o Normal:Recordavideoofanylength(limitedonlybymemoryspace). o Limit for MMS:Restrictthelengthofthevideosoitcanbesentasamessage attachment. o Slow motion:Recordinslowmotion. o Fast motion:Recordainfastmotion. l Effects:Applyaneffecttovideos. l Options:

o Edit shortcuts:Chooseshortcutstoappearonthetoolbar.Touchanddragshortcuts betweenthetoolbarandthelist. o Use the volume key as:ChoosewhetherpressingtheVolumeKeyzoomsinorout whencomposingashot,ortakesapicture. o GPS Tag:AddGPSlocationinformationtovideodetails. o Self-recording:WhenOn,theCamerarecordswiththefrontCamera. o Flash:Choosethedefaultflashmode. o Recording mode:Choosethedefaultrecordingmode. o Effects:Applyaneffecttovideos. o Exposure value:Setthedefaultbrightnesslevel. o Timer:SetadelaytowaitbetweentouchingtheCamerabuttonandstartingrecording. o Resolution:Chooseasizeforthevideo. Camera and Video 78 o White balance:Chooseasettingforthelightsource. o Guidelines:Enableordisableanon-screengridtoaidinvideocomposition. o Anti-shake:Whenenabled,minimizestheeffectofcameramovement. o Contextual filename:Whenenabled,thecameraassignsafilenametothevideofile, thatincludesGPSinformation. o Save as flipped:WhenOn,picturesorrecordingsyoumakeusingthefrontcameraare savedasamirror-image(onlyavailablewhenSelf-portraitisturnedOn). o Video quality:Chooseaqualitysettingforvideos. o Storage:Ifanoptionalmemorycardisinstalled(notincluded),choosethedefault storagelocationforvideos.Bydefaultallvideosarestoredinthephonesinternal memory. o Reset:SetallCamerasettingstothedefaults. Gallery UsingtheGalleryapplication,youcanviewpicturesandwatchvideosthatyouvetakenwithyour phonescamera,downloaded,orcopiedtoanoptionalmemorycard(notincluded). Forpicturesstoredonanoptionalmemorycard,youcandobasiceditingsuchasrotatingand cropping.Youcanalsosetapictureasyourcontactpictureorwallpaperandsharepictureswith yourfriends. WhileviewingpicturesintheGallery,scrollupthescreentoviewmorealbums.Simplytapanalbum toviewthephotosorvideosinthatalbum. Ifyouhavepicturesorvideosstoredonanoptionalmemorycard(notincluded),theywillbedisplay folderstheyarestoredin,andfoldersaretreatedasalbums.Theactualfoldernameswillbeusedas thealbumnames.Ifyouhavedownloadedanyphotosandvideos,thesewillbeplacedintheAll downloadsalbum. 1. Press 2. Selectafolderlocation(suchasCamera)andtapanimagetoviewyourpicture. Apps>

Gallery. andtap 3. FromtheGalleryscreen,youcanusetheseoptions:

l Tapapictureorvideotodisplayitinfullscreenview. l Touchandholdthumbnailstoselectthem(indicatedbyacheckmark). l Tap Create albumtocreateanalbum.Givethealbumaname,andthenselectand dragthumbnailstothealbumtomoveorcopyfilestothenewalbum. l Tap CameratolaunchtheCamera,totakepicturesorrecordvideo. Camera and Video 79 l Tap foroptions,including:

o Select album/Select item:Dependingontheview,tapalbumsoritemstoselectthem. Afterselection,youcantap againforoptionsyoucanusewiththeselecteditem. o Slideshow:Chooseoptionstocreateaslideshowforviewingyourpicturesandvideos. o Content to display:Choosecontenttodisplay,fromcontentstoredonyourdeviceor accountssetuponyourphone. o Scan for nearby devices:SearchfornearbyDLNA-compatibledevicestoshare content. o Hide items/Show hidden items:UseHideitemstochooseitemstohidefromdisplay. Theitemsarenotdeleted,andcanbedisplayedwiththeShowhiddenitemsoption. o Settings:ConfigureGallerysettings. View Photos and Videos AfterselectinganalbumfromtheAlbumstab,youcanbrowsethephotosandvideosofthatalbumin eitherphotopileorgridview.Tapaphotoorvideotoviewitinfullscreen. ViewPhotos 1. Press 2. Tapathumbnailtoviewthepicture.Whileviewingapicturefull-screenyoucanusethese Apps>

Gallery. andtap options:

l l l l Screen mirroring:ChooseadevicetosharethepictureviaAllShareorGroupPlay. Share:Chooseanoptionforsharingthepicture.OptionsmayincludeBluetooth, Dropbox,Email,Gmail,Google+,Messaging,Picasa,Wi-FiDirect,orYouTube. Delete:Erasethecurrentpicture. Camera:LaunchtheCamera,totakepicturesorrecordvideo. ViewVideos Note: Ifnocontroliconsaredisplayedonthescreeninadditiontothepicture,tapanywhereonthe screentodisplaythem. 1. Press 2. Tapavideotoselectit.Whenthevideoisdisplayedfull-screen,youcanusetheseoptions:

Apps>

Gallery. andtap Camera and Video 80 l Share:Chooseanoptionforsharingthevideo.OptionsmayincludeBluetooth, Dropbox,Email,Gmail,Google+,Messaging,Picasa,Wi-FiDirect,orYouTube. l l Trim:Editthelengthofthevideo. Delete:Erasethecurrentvideo. l Tap toplaythevideo. Zoom In or Out on a Photo Therearetwowaysyoucanzoominoroutofaphoto. n Tapthescreentwicequicklytozoominandthentapthescreentwicequicklyagaintozoomout. or Youcanalsousepinchandspreadtozoominorout.SeePinchandSpread. Working with Photos Youcantouchandholdonaphototoopenaselectionmenuandchoosewhattodowithit.Youcan choosetodeletethephoto,rotateorcropit,andmore. RotateandSaveaPhoto Usethisproceduretorotateandsaveaphoto. 1. Press 2. Selectafolderlocation(suchasCamera)andtapanimagetoviewyourpicture. Apps>

Gallery. andtap 3. Tap

>Rotate leftorRotate right. CropaPhoto Followthisproceduretocropaphoto.Thecroppedpictureissavedalongwiththeoriginalcopyin yourdefaultstoragelocation. 1. Press 2. Selectafolderlocation(suchasCamera)andtapanimagetoviewyourpicture. Apps>

Gallery. andtap 3. Tap

>Crop,andthenusetheonscreentoolstocropthepicture:

l Toadjustsizeofthecropbox,touchanddragtheedgeofthebox. l Tomovethecropboxtoadifferentpartofthephoto,dragthecropboxtothedesired position. Camera and Video 81 4. TapDonetoapplythechangestothepicture. Share Photos and Videos TheGalleryapplicationletsyousendphotosandvideosusingemailormultimediamessages.You cansharephotosonyoursocialnetworks(suchasFacebook,Picasa,andTwitter)andsharevideos onYouTube.YoucanalsosendthemtoanotherphoneoryourcomputerusingBluetooth. SendPhotosorVideosbyEmail Youcansendseveralphotos,videos,orbothinanemailmessage.Theyareaddedasfile attachmentsinyouremail. 1. Press 2. Selectphotosorvideostoshare. andtap Apps>

Gallery. 3. Touchthescreenandthentap

>GmailorEmail. 4. Composeyourmessageandthentap Note: IfyouselectedEmailandyouhavemultipleemailaccounts,thedefaultemailaccountwillbe used. or

. SendPhotosorVideosbyMultimediaMessage Althoughyoucansendseveralphotosorvideosinamultimediamessage,itmaybebettertosend oneatatime,especiallyifthefilesarelargeinsize. 1. Press 2. Selectphotosorvideostoshare. andtap Apps>

Gallery. 3. Touchthescreenandthentap

>Messaging. 4. Composeyourmessageandthentap

. SendPhotosorVideosUsingBluetooth Youcanselectseveralphotos,videos,orbothandsendthemtosomeonesphoneoryourcomputer usingBluetooth. 1. Press 2. Selectphotosorvideostoshare. andtap Apps>

Gallery. Camera and Video 82 3. Touchthescreenandthentap

>Bluetooth.Inthenextfewsteps,youllbeaskedtoturnon BluetoothonyourphoneandconnecttothereceivingBluetoothphonesothefilescanbesent. Formoreinformation,seeBluetooth. SharePhotosorVideosonGoogle+

1. Press 2. Selectphotosorvideostoshare. andtap Apps>

Gallery. 3. Touchthescreenandthentap

>Google+. SharePhotosonPicasa YouneedtobesignedintoaGoogleAccounttouploadpicturestothePicasaphotoorganizing service.Youcanviewthephotosonlineatpicasaweb.google.com. 1. Press 2. Selectphotosorvideostoshare. andtap Apps>

Gallery. 3. Touchthescreenandthentap 4. Followthepromptstouploadtheitems.

>Picasa. ShareVideosonYouTube YoucanshareyourvideosbyuploadingthemtoYouTube.Beforeyoudothis,youmustcreatea YouTubeaccountandsignintothataccountonyourphone. 1. Press 2. Selectphotosorvideostoshare. andtap Apps>

Gallery.

>YouTube. 3. Touchthescreenandthentap 4. Followthepromptstouploadtheitems. Paper Artist PaperArtistallowsyoutoquicklyaddstylizedeffectstoyourphotosorimages. andtap Apps>

n Press G+ Photos KeepallyourphotosbackedupandorganizedwithGoogle+Photos. Paper Artist. Camera and Video 83 andtap Apps>

n Press Group Play UseGroupPlaytosharemediafromyourphonetootherdevices,viaWi-Fi,usingyourphoneasan AP(AccessPoint). G+ Photos. ManyofyourphonesappsoffersharingviaGroupPlay.Tap fromtheShare vialistofoptions. tofindsharingoptions,usually TouseGroupPlay,allparticipantsmustbeconnectedtothesameWi-Finetwork. Important: IfyouareusingGroupPlayviaanunsecuredWi-Finetwork,yourinformationmaybe vulnerabletounauthorizedthirdpartieswhilebeingtransferred. UseGroupPlayonlyforpersonalandnon-profitpurposes.UsingGroupPlayforcommercialuse violatescopyrightlaw.Thecompanyisnotresponsibleforcopyrightinfringementbyusers. CreateaGroupandShare Note: TouseGroupPlay,allparticipantsmustbeconnectedtothesameWi-Finetwork. 1. Press 2. TapSet group password>Create Group,andthenfollowthepromptstocreateagroup. Group Play. Apps>

andtap Youllneedtosetupagrouppassword,whichparticipantswillusetojoinyourGroupPlay session. 3. Afteryoucreatethegroup,yourphoneturnsonthemobileAP(AccessPoint).Followthe onscreendirectionstobringotherdevicesback-to-backwithyourphonetojointhegroup. 4. Chooseoptionsforsharing:

l Share music:Selectmusicstoredonyourphoneoronanoptionalinstalledmemorycard

(notincluded). l Share images:Selectpicturesstoredonyourphoneoronanoptionalinstalledmemory card(notincluded). l Share documents:Selectdocumentsstoredonyourphoneoronanoptionalinstalled memorycard(notincluded). l Play games and more:Playgameswithotherparticipants. JoinaGroup 1. Press 2. TapJoin Group.Yourphonescansfornearbyavailablegroups.Yourdevicecanonlydetect Group Play. Apps>

andtap groupsonthesameWi-Finetworkyourphoneisconnectedto. Camera and Video 84 3. Selectagrouptojoin.Afterconnecting,youcanseeandinteractwiththegroupssharedmedia. Camera and Video 85 Tools and Calendar Learnhowtousemanyofyourphonesproductivity-enhancingfeatures. Clock Setalarmstokeeptrackoftime. CreateanAlarm andtap 1. Press 2. TapCreate alarm,andthenenterinformationforthealarm. 3. TapSavetostorethenewalarmevent. Apps>

Clock. DeleteanAlarm Clock. andtap Apps>

1. Press 2. Touchandholdanalarm,andthentapDelete. Calendar UseCalendartocreateandmanageevents,meetings,andappointments.YourCalendarhelps organizeyourtimeandremindsyouofimportantevents.Dependingonyoursynchronization settings,yourphonesCalendarstaysinsyncwithyourCalendarontheWeb,ExchangeActiveSync calendar,andOutlookcalendar. Add an Event to the Calendar AddeventstoyourCalendartohelpyouorganizeyourtimeandremindyouofimportantevents. Note: TosynchronizecalendareventsamongyourGoogleandCorporateaccounts,makesure theyarebeingmanagedbyyourphone.SeeAccountsandMessagingformoreinformation. 1. Press 2. Double-tapadaytowhichyouwouldliketoaddaneventtorevealtheAdd event/Add task Apps>Calendar. andtap screen. 3. TaptheCalendarfieldtochooseanaccount,ifyouhaveaccountssetuponyourphone. Availableoptionsdependontheaccount,andnotallaccountsupportcalendarsynchronization. 4. TaptheTitlefieldandenteratitlefortheevent. 5. TapOK,ortapEdit event detailstoentermoreinformationabouttheevent:

Tools and Calendar 86 l SelectaFrom/To timefortheeventbytappingthecorrespondingfields,andadjustingthe month,day,andyear. l Selectatimefortheeventbytappingthetimefieldandthenadjustingthehourandminute. TaptheAll dayfieldtoassignthisasanall-dayevent.Ifassignedasanall-dayevent,the timefieldsareremovedasoptions. l SelectarecurrencecyclefortheeventbytappingtheRepeatfield. l SelectanalarmtimebytappingtheReminderfield. l EnteralocationfortheeventintheLocationfieldortap map. toselectthelocationonthea l Enteradescriptionfortheeventinthe Descriptionfield. l TapMemostoaddanS Memofileasanattachment.Formoreinformation,seeSMemo. l TapImagestoaddanimagefromtheGalleryortakeanewpictureusingthecamera. 6. TapSavetostoretheneweventandsynchronizeitwithyourselectedaccount. View Events Thefollowingprocedurehelpsyouviewyourcalendarevents. 1. Press 2. Tochangethecalendarview,taptheYear,Month,Week,Day,List,orTasktab. Calendar. Apps>

andtap 3. Tapthedayforwhichyouwouldliketoviewevents.(Yourphonelistseventsinchronological order.) 4. Todisplayaneventsdetails,tapitfromthecurrentscreen. Erase Events Thefollowingproceduresshowyouhowtoeraseyourcalendarevents. Calendar. andtap Apps>

1. Press 2. Selectaneventtodisplayitsdetails,andthentap 3. Followthepromptstodeletetheevent. Calculator Yourphonecomeswithabuilt-incalculator.

>Delete. 1. Press 2. Enternumbersandoperatorsbytappingtheonscreenkeyboard.TapCtoclearallnumbers. Calculator. Apps>

andtap Tools and Calendar 87 Downloads TheDownloadsapplicationallowsyoutomanagefilesyoudownloadtoyourphone. andtap Apps>

Downloads. n Press Note: ApplicationsyoudownloadfromGooglePlayStorearemanagedwiththePlayStore application,anddonotdisplayinDownloads. Dropbox Dropboxprovidesaccesstoyourdesktopfilesdirectlyfromyourphone.Thisappallowsyoutobring yourfileswithyouwhenyou'reonthego,editfilesinyourDropboxfromyourphone,uploadphotos andvideostoDropbox,andshareyourselectedfilesfreelywithfamilyandfriends. Theappworksinconjunctionwithapartnerprogramplacedonatargetcomputerusinganactive Internetconnection. Dropboxcreatesafolderthatautomaticallysynchronizesitscontentsacrossallofyourconnected devicesonyouraccount.UpdateafiletoyourDropboxonyourcomputer,anditsautomatically updatedtothesamefolderonyourotherdevices. Download the Desktop Application Followtheproceduresbelowtodownloadthedesktopapplication. 1. Useyourcomputersbrowsertonavigatetodropbox.com. 2. Followtheonscreensetupandinstallationinstructionsonyourtargetcomputercontainingthe desiredfiles. Important: Thecomputerapplicationmustbeinstalledonthecomputercontainingthedesiredfiles. ThiscomputermusthaveanactiveInternetconnection. Access Dropbox on your Phone AccesstheDropboxappandsetupyourDropboxaccount. 1. Press 2. TapSign in,enteryourcurrentaccountcredentials,andtapSign in. Dropbox. Apps>

andtap or TapSign up for Dropboxandfollowtheonscreeninstructionstoregisterforanewaccount. Upload a Picture to Dropbox FollowthebelowprocedurestomanuallyuploadpicturestotheDropboxapp. Tools and Calendar 88 andtap 1. Press 2. Afteryoutakeapicture,taptheGallerybuttontoviewthepicture.TheGallerybuttonappearsin thebottomrightcorneroftheCamerascreeninlandscapeorientation,orthebottomleftcorner inportraitorientation. Camera. Apps>

3. Tapthepicturetodisplayoptions,andthentap andtapAdd.

>Add to Dropbox.Selectafolderlocation, Note: Ifyoursharefolderislocatedonyourcomputer,youwillmomentarilyreceiveanonscreen popupnotifyingyouthatanewimagewasuploadedtoyoursharedDropboxfolder. Google Search UseGoogleSearchtosearchtheInternet. andtap Apps>

n Press Help Helpprovidesonlineinformationtohelpwithyourphonequestions. Google. Help. Apps>

n Press andtap microSD Card YoucaninstallanoptionalmicroSDmemorycard(notincluded),toaddstorageforimages, videos,music,documents,andotherfilesonyourphone. Install a microSD Card Usethefollowingprocedurestoinstallanoptionalmemorycard(notincluded)inyourphone. 1. Usingtheslotprovided,gentlyliftthebatterycoveroffthephone. 2. Insertthecardwiththegoldcontactsfacingdown. 3. Firmlypressthecardintotheslotandmakesurethatitlocksintoplace. 4. Replacethebatterycover. Remove a microSD Card Usethefollowingprocedurestoremoveanoptionalinstalledmemorycard(notincluded)fromyour phone. 1. Usingtheslotprovided,gentlyliftthebatterycoveroffthephone. 2. Firmlypressthecardintotheslottoreleasethelock.Thecardshouldpoppartiallyoutoftheslot. Tools and Calendar 89 3. Removethecardfromtheslot. 4. Replacethebatterycover. Important: Youcaneasilydamagethememorycardanditsadapterbyimproperoperation.Please becarefulwheninserting,removing,orhandlingit.Donotover-insertthecardasthiscandamage thecontactpins. View microSD Card Memory Usethefollowingproceduretoviewusedandavailablememoryonanoptionalinstalledmemory card(notincluded). andtap

>Settings>More>Storage. n Press Format a microSD Card Formattingpermanentlyremovesallfilesstoredonanoptionalinstalledmemorycard(notincluded). Note: Theformattingprocedureerasesallthedataonaninstalledcard,afterwhichthefilescannot beretrieved.Topreventthelossofimportantdata,pleasecheckthecontentsbeforeyouformata card. andtap

>Settings>More>Storage. 1. Press 2. TapFormat SD card>Format SD card>Delete all. Unmount a microSD Card Whenyouneedtoremoveanoptionalinstalledmemorycard,youmustunmountthecardfirstto preventcorruptingthedatastoredonitordamagingthecard. andtap

>Settings>More>Storage. 1. Press 2. TapUnmount SD card,thentapOK. My Files Myfilesallowsyoutomanageyourmanagesounds,images,videos,Bluetoothfiles,Androidfiles, andfilesstoredonyourphone,oronanoptionalinstalledmemorycard(notincluded).Youcanopen afileiftheassociatedappisalreadyonyourphone. andtap Apps>

My Files. 1. Press 2. Filesaredisplayedincategories,includingAllfiles,Images,Videos,Music,andDocuments. Note: Differentfoldersmayappeardependingonhowyourphoneisconfigured. More Services MoreServicescontainsanassortmentofSamsungappsthatarenotpreloadedonyourGalaxySIII. Tools and Calendar 90 andtap Apps>

n Press S Memo TheSMemoapplicationallowsyoutocreatememosusingthekeyboard,yourfinger,orboth.You canaddimages,voicerecordings,andtextallinoneplace. More Services. FollowthestepsbelowtoexploretheSMemoapp. 1. Press 2. FromtheSMemoscreen,tap andtap Apps>

S Memo. toaccessoptions:

l Search:Taptosearchforasavedmemo. l Delete:TouchoneorallmemosandthentapDelete. l Sort by:Choosehowtosortthelistofmemos. l View by list/View by thumbnail:Taptoviewyourexistingmemosinalistorthumbnail

(default)view. l Share via:SendamemoviaGroupPlay,Dropbox,Flipboard,Picasa,PaperArtist, Google+,Bluetooth,Wi-FiDirect,Messaging,Gmail,orEmail. l Import/Export:Exportamemo,orimportafileintoSMemo. l Sync:Synchronizememo(s)withEvernoteorGoogle+. l Create folder:Createafoldertostorememos. l Move:Moveamemotoafolder. l Copy:Copyamemototheclipboard. l Lock/Unlock:Whenlocked,amemocannotbedeleted. l Print:Printmemo(s)viaWi-FitoacompatibleSamsungprinter(notincluded). l Settings:

o Auto Sync:SyncyoursettingsonyourphoneorsavethemtoyouSamsungaccount. o Change PIN:SetaPINnumbertousetolockyourmemos. o Screen timeout:Taptoselectthelengthoftimethatthescreenwilldisplaywhenyou areintheSMemoapplication.Choosefrom15 seconds,30 seconds,1 minutes,2 minutes,5 minutes,or10 minutes. o Handwriting language update:Taptoupdatethesoftwarethattranslatesyour handwritingintotext. o Auto hide toolbar:Taptohidethetoolbarwhenenteringamemo. Tools and Calendar 91 l Help:LearnaboutSMemo. l Backup and restore:Saveorimportmemosfromanoptionalinstalledmemorycard(not included),orimportmemos. Create a New S Memo FollowthestepsbelowtocreateanewmemoorexpandorreplytoanexistingmemousingtheS Memoapp. 1. Press andtap Apps>

S Memo. 2. Tap tostartanewmemointextmode. or tostartanewmemoindrawingmode. Tap 3. Tap Note: Dependingonwhetheryouhavesavedthememo,areinkeyboardmode,orindrawing mode,theoptionswillappeardifferently.Thefollowingisalistoftheoptionsyoumaysee. toaccessoptions:

l Rename:Changethecurrentmemotitle. l Share via:SendamemoviaGroupPlay,Dropbox,Flipboard,Picasa,PaperArtist, Google+,Bluetooth,Wi-FiDirect,Messaging,Gmail,orEmail. l Handwriting-to-text:Transcribehandwritingintotext. l Export:Savethememotomemory,asagraphicorPDF. l Save as:Savethememowithadifferentname. l Add picture:Addanimagetothecurrentmemo.ChoosePicture,Takepicture,ClipArt, Clipboard,orMap. l Add tag:Settagstoaddinsearches. l Add to Favorites:Tagthecurrentmemoasafavorite. l Change background:Setthebackgroundforyourmemo.Swipethescreentotheleftor righttoselectabackgroundandthentap Done. l Link to Calendar:LinkthememotoyourCalendar. l Lock:LockthememobyusingaPINnumber. l Set as:Setamemoasacontacticon,Homescreenwallpaper,Lockscreenwallpaper,ora widget. l Print:Printmemo(s)viaWi-FitoacompatibleSamsungprinter(notincluded). Tools and Calendar 92 4. Whenyouarefinishedcreatingyourmemo,tapSave. S Suggest TheSSuggestapplicationprovidesonscreenrecommendationsforappsthatarespecifically supportedandmadeforuseonyourphone. Note: AccesstothisfeaturerequiresthatyoualreadybeloggedintoyourSamsungaccount application. andtap 1. Press 2. Readthetermsandconditions. 3. PlaceacheckmarkintheAgreefieldthentapAgree. S Suggest. Apps>

4. Selectanapplicationfromoneoftheavailablecategories(Picks,Categories,Games,Friends, andInfo). 5. Followtheonscreendownloadandinstallationinstructions. S Voice YourphonesSVoiceisavoicerecognitionapplicationusedtoactivateawidevarietyoffunctionson yourphone.Thisisanaturallanguagerecognitionapplication. ThisgoesbeyondtheGoogleSearchVoiceActionsfeaturethatsimplyrecognizesGoogle commandsandsearchterms.Youcanaskitquestions(IsitraininginDallas?)orgiveitcommands

(Showmewheretofindcheapgas). 1. Press 2. FollowthepromptstolearnaboutSVoice.Youcanalsochangethephraseyouspeaktowake S Voice. Apps>

andtap upSVoice. Voice Recorder TheVoicerecorderallowsyoutorecordanaudiofileuptooneminutelongandthenimmediately shareitusingBluetooth,Dropbox,Email,Gmail,GroupPlay,Messaging,orWi-FiDirect.Recording timewillvarybasedontheavailablememorywithinthephone. Apps>

n Press andtap Voice Search SpeakkeywordstosearchtheWeb. Voice Recorder. n Press andtap Apps>

Voice Search. Tools and Calendar 93 VPN Client VPNClientprovidessupportforthelatestIPSecVPNstandardsandinteroperabilitywithsupportfor allmajorVPNGateways. andtap Apps>

VPN Client. 1. Press 2. Followtheon-screeninstructionstoconfigureVPNClient. Wallet GoogleWalletallowsyoutocarrycreditcardsanddebitcardsinyourAndroidphone.Tousethis app,tapthebackofyourphoneatthepointofsaletopayorshoponlineeverywhereyouseethe GoogleWalletBuybutton. n Press andtap Apps>

Wallet Tools and Calendar 94 Settings ThefollowingtopicsprovideanoverviewofitemsyoucanchangeusingyourphonesSettings menus. AccessSettings Settingsarearrangedontabsbycategory,toquicklyaccessoptions. 1. Press 2. Tapatabtoaccesssettingsbycategory:

andthentap

>Settings. l l l l Connections:Connecttowirelessnetworks,including3G,4G,andWi-Fi,andto otherdevices. My device:Personalizeyourphone,includingsoundsandthedisplay,accessibility, andinput. Accounts:Setupaccountsonyourphone,likeyourGoogleandSamsung accounts,andyouremailandsocialnetworkingaccounts.Youcanalsosetupbackup options. More:Setpermissionsforlocationsandsecurity,andmanageyourdevice. Wi-Fi Settings UseWi-FisettingstocontrolyourphonesconnectionstoWi-Finetworks,andforusingWi-FiDirect toconnectdirectlytootherWi-FiDirectdevices. Turn Wi-Fi On or Off WhenWi-FiisturnedOn,yourdevicewillnotifyyouofavailableWi-Finetworks,andyoucan connecttotheWi-Finetworks.TurnWi-FiOffwhennotinuse,toconservebatterypower. andthentap

>Settings>Connections. 1. Press 2. TaptheON/OFFswitchbesideWi-FitoturnWi-FiOnorOff. Note: YoucanalsoturnWi-FiOnorOfffromNotifications.Dragdownfromthetopofthescreen, thentaptheWi-Fibutton. Configure Wi-Fi Settings Setupandmanagewirelessaccesspoints. 1. Press andthentap

>Settings>Connections. Settings 95 2. TapWi-Fi,andthentaptheON/OFFswitchbesideWi-FitoturnWi-FiOn.Wi-FimustbeOnto configuresettings. 3. Configurethesesettings:

l Add Wi-Fi network:ConnecttoanewWi-Finetwork. l Scan:SearchforavailableWi-Finetworks. l Wi-Fi Direct:ConnecttootherWi-FiDirectdevices. Other Wi-Fi Settings Setupandmanagewirelessaccesspoints. 1. Press 2. TapWi-Fi,andthentaptheON/OFFswitchtoturnWi-FiOn.Wi-FimustbeOntoconfigure

>Settings>Connections. andthentap settings. 3. Tap toconfigurethesesettings:

l Advanced:

o Network notification:Whenenabled,yourphonealertsyouwhenanewWi-Finetwork isavailable. o Sort by:ChooseasortingorderforWi-FinetworksontheWi-Fiscreen. o Keep Wi-Fi on during sleep:SpecifywhentoswitchfromWi-Fitomobiledatafordata communications,whenthedevicegoestosleep(whenthebacklightgoesout).This settingcanaffectdatausage,sincethedataconnectionwillremainactiveevenwhenthe phonescreenisoff. o Always allow scanning:Whenenabled,yourphonewillallowGooglelocationservice andotherappstoscanfornetworks,evenwhenWi-Fiisturnedoff. o Auto network switch:Whenenabled,yourphonewillautomaticallyswitchbetween knownWi-Finetworksandmobilenetworks.KnownWi-Finetworksarethoseyouhave alreadyconnectedto. o Wi-Fi timer:WhenturnedOn,yourphonewillautomaticallyconnectordisconnectfrom aWi-Finetwork,usingtheStartingtimeandEndingtimesyouset. o Install certificates:Ifyouhavecertificatesstoredonaninstalledoptionalmemorycard

(notincluded),youcanusethisoptiontoinstallthecertificates. o MAC address:(Notconfigurable)ViewyourdevicesMACaddress,neededfor connectingtosomesecurednetworks. o IP address:(Notconfigurable)ViewyourdevicesIPaddress. Settings 96 l WPS push button:SetupaconnectiontoaWPS(Wi-FiProtectedSetup)routerorother equipment. l WPN PIN entry:(Notconfigurable)ViewthePINusedbyyourdevicetosetupaPIN-

securedconnectiontoaWi-Firouterorotherequipment. Wi-Fi Direct Wi-FiDirectallowsdevicestoconnecttoeachotherdirectlyviaWi-Fi,withoutaWi-Finetworkor hotspot,andwithouthavingtosetuptheconnection.Forexample,yourdevicecanuseWi-FiDirect tosharephotos,contactsandothercontentwithotherWi-FiDirectdevices. 1. Press 2. TapWi-Fi,andthentaptheON/OFFswitchbesideWi-FitoturnWi-FiOn.Wi-FimustbeOnto

>Settings>Connections. andthentap configureWi-FiDirectsettings. 3. TapWi-Fi Directatthebottomofthescreen.YourdeviceautomaticallyscansfornearbyWi-Fi Directdevices,oryoucantapScantostartscanning. 4. Afterscanningfordevices,selectadevice,thenfollowthepromptstocompletetheconnection. or TouchMulti-connecttocreateaconnectiontodevicesthatsupportmulti-connect.TouchScan tosearchforavailablemulti-connectdevices,thenselectthedevicesandfollowthepromptsto completetheconnection. Sprint Hotspot Settings UsetheSprintHotspotfeaturetoshareyourphonesdatanetworkconnectionwithotherdevicesvia Wi-Fi. Note: UsingtheSprintHotspotfeatureconsumesbatterypowerandusesdataservices. TurnSprintHotspotOnorOff 1. Press andthentap 2. TaptheON/OFFswitchbesideSprintHotspottoturnSprintHotspotOnorOff.

>Settings>Connections. ConfigureSprintHotspot 1. Press 2. TapSprintHotspot>Configuretosettheseoptions:

andthentap

>Settings>Connections. l Network SSID:Viewandchangethenameofyourmobilehotspot. l Hide my device:Whenenabled,yourmobilehotspotisnotvisibletootherWi-Fidevices duringascan.Otherdevicescanstillconnecttoyourmobilehotspot,butwillhavetosetup theconnectionmanuallywithyourNetworkSSIDandPassword. Settings 97 l Security:ChoosethesecuritylevelforyourMobileHotspot. l Password:Ifyouchooseasecuritylevelthatusesapassword,setapassword.Bydefault, thepasswordisyourmobiletelephonenumber. l Show password:Whenenabled,thecontentsofthePasswordfieldarevisible. l Show advanced options:Whenenabled,youcanaccessadvancedoptions,including Broadcastchannel,tospecifythechannelyourdeviceusesforHotspot,andyoucansetthe maximumnumberofconnectionstoyourHotspot. Allowed Devices ControlwhetherdevicescanconnecttoyourSprintHotspotwiththeAlloweddeviceslist.Afteryou adddevicestothelist,theycanscanforyourphoneandconnectusingyourphoneshotspotname andpassword. Note: UsingtheSprintHotspotfeatureconsumesbatterypowerandusesdataservices. 1. Press 2. TapSprint hotspot>Allowed devices. andthentap

>Settings>Connections. 3. Tap

,andthenentertheotherdevicesDevice nameandMAC address.Consulttheother devicessettingstofinditsMACaddress. 4. TapOKtoaddthedevicetotheAlloweddeviceslist. Bluetooth Settings Bluetoothisashort-rangewirelesscommunicationstechnologyforexchanginginformationovera distanceofabout30feet.YoudontneedtolineupthedevicestosendinformationwithBluetooth.If thedevicesareinrange,youcanexchangeinformationbetweenthem,eveniftheyareindifferent rooms. YourdevicecanuseBluetoothtosharephotos,contactsandothercontentwithotherBluetooth devices.ManyoftheappsonyourdeviceprovideoptionsforsharingviaBluetoothunder Turn Bluetooth On or Off WhenBluetoothisOn,youcanscanandfindotherBluetoothdevicestoshareinformationbetween thedevices.TurnBluetoothOffwhennotinusetoconservebatterypower. Menu. andthentap

>Settings>Connections. 1. Press 2. TaptheON/OFFswitchbesideBluetoothtoturnBluetoothOnorOff. Note: YoucanalsoturnBluetoothOnorOfffromtheNotificationpanel.Dragdownfromthetopof thescreen,andthentaptheBluetoothbutton. Settings 98 Configure Bluetooth Settings PairwithotherBluetoothdevices,manageyourBluetoothconnections,andcontrolyourdevices visibilitytootherdevices. 1. Press 2. TapBluetooth,andthentaptheON/OFFswitchtoturnBluetoothOn.BluetoothmustbeOnto

>Settings>Connections. andthentap configuresettings. 3. FromtheBluetoothscreen,configurethesesettings:

l TaptheON/OFFswitchtoturnBluetoothOnorOff. l TapyourdevicesnametoenableordisablevisibilitytootherBluetoothdevices.Whenyour deviceisvisible,otherdevicescanfindyourdevicesduringascan.Yourdeviceremains visiblefortheperiodoftimesetintheVisibilitytimeoutsetting. l Tapapaireddevicetoconnecttoit,ortouch l TapScantosearchforvisibleBluetoothdevices.Aftersearching,tapadevicetopairwithit. besideadevicetochangeitssettings. 4. Tap formoresettings:

l Visibility timeout:Setthelengthoftimeyourdeviceisvisibletootherdeviceswhenyou turnonvisibility. l Received files:ViewfilestransferredtoyourdeviceviaBluetooth. Data Usage Settings Monitordatausage,andcontrolyourdevicesconnectiontomobiledataservice. Note: Dataismeasuredbyyourphone.Yourserviceprovidermayaccountfordatausage differently. 1. Press 2. TapData usagetoconfigureoptions:

andthentap

>Settings>Connections. l Mobile data:EnableordisableMobiledata.YoucanalsocontrolMobileDataat Notifications. l Limit mobile data usage:Whenenabled,yourmobiledataconnectionwillbedisabled whenthespecifiedlimitisreached.Afterenablingthesetting,dragtheredlimitlineonthe graphbelowtosetthedatausagelimit. l Alert me about data usage:Whenenabled,yourdevicewillalertyouwhenmobiledata usagereachesthewarninglimityouset.Afterenablingthesetting,dragtheorangewarning lineonthegraphbelowtosetthedatausagewarninglimit. Settings 99 l Data usage cycle:Tapthemenu,andthenchooseatimeperiodfordatausage.Data usagefortheperioddisplaysonthegraph,alongwithusagebyapplicationbelow. 3. Tap tosetotheroptions:

l Data roaming:Whenenabled,yourdevicecanconnecttomobiledataservicewhen outsideyourhomenetworkarea.Usingdatawhileroamingmayincuradditionalcosts;

contactyourserviceproviderformoreinformation. l Restrict background data:Yourdeviceiscapableofconnectingtothenetworkinthe background,forsynchronizationorotherservices.Whenenabled,backgroundconnections willnotoccur. l Auto sync data:Whenenabled,yourdevicewillsynchronizewithaccountsautomatically, atanytime. l Show Wi-Fi usage:WhenturnedOn,aseparatetabdisplaysdatausagewhileconnected toWi-Fi. l Mobile hotspots:SelectWi-Finetworksthataremobilehotspots.Youcanrestrictapps fromusingthesenetworks,andyoucanconfigureappstowarnyoubeforeusingthese networksforlargedownloads. More Networks Settings TheMorenetworksmenuprovidesadditionalwirelessandnetworkoptions. Airplane Mode EnablingAirplanemodeturnsoffcalling,messaging,anddatanetworkfeatures.Italsoturnsoff otherconnectivityfeatures,suchasWi-FiandBluetooth. WhileinAirplanemode,the otherfeaturesofyourdevice,suchasplayingmusic,watchingvideos,orotherapplications. icondisplaysintheStatusbar.Whileinairplanemode,youcanuse TouseWi-FiandBluetoothwhenAirplanemodeisenabled,turnthemoninSettings,oronthe Notificationpanel. 1. Press 2. TapMore networks,andthentapthecheckboxnexttoAirplane modetoenableordisable

>Settings>Connections. andthentap theoption. Note: YoucanalsocontrolAirplanemodefromtheDevice optionsmenu.Pressandholdthe Power/LockKey,thentapAirplane mode. Mobile Networks Controlyourphonesaccesstonetworks,includingmobiledataservice. Settings 100

>Settings>Connections. 1. Press 2. TapMore networks>Mobile networkstoconfigureoptions:

andthentap l Mobile data:Whenenabled,yourdeviceconnectstothemobiledatanetwork. l Network mode:Chooseapreferrednetworkmode. l Connections optimizer:Whenenabled,helpsyoumanageandenhanceyourdata experiencebyfindingandconnectingtorememberedWi-Finetworksonyourdevice,and,if applicable,to4Gnetworkservice. Tethering UseTetheringtoshareyourdevicesinternetconnectionwithacomputerthatconnectstoyour deviceviaUSBcable,orbyBluetooth. 1. Press 2. TapMore networks>Tethering,andthenchooseatetheringmethod:

>Settings>Connections. andthentap l USB tethering:ConnectthecomputertothedeviceviaUSBcable,thentouchUSB tetheringtoturntetheringOnorOff. l Bluetooth tethering:PairyourdevicewiththecomputerviaBluetooth.Consultthe computersdocumentationformoreinformationaboutconfiguringyourcomputertopairvia Bluetooth.TouchBluetooth tetheringtoturntetheringOnorOff. Note: TapHelpforinformationaboutusingTethering. VPN SetupandmanageVirtualPrivateNetworks(VPN). Note:VPNsettingsincludestorageoflogincredentialsonyourdevice.Youmustconfigureascreen unlockpattern,PINorpasswordbeforesettingupaVPN. 1. Press andthentap

>Settings>Connections. 2. TapMore networks>VPN,andthentap toaddaVPN.DependingonthetypeofVPN, thismayincludetheseoptions:

l Name:EnterthenameoftheVPN. l Type:ChoosethetypeofVPN,fromPPTP,L2TP/IPSecPSK,L2TP/IPSecRSA,IPSec XauthPSK,IPSecXauthRSA,orIPSecHybridRSA. l Server address:EntertheVPNserveraddress. l PPP Encryption (MPPE):Taptoenable,ifapplicablefortheVPN. l Show advanced options:Taptosetotheroptions,dependingonthetypeofVPN. 3. TapSavetosavetheVPN. Settings 101 Roaming Whenyouareoutsideyourhomenetworkarea,yourphonecanstillconnecttoothernetworksthat yourprovidersupportsviaroaming.Theremaybeadditionalcostsforaccessingnetworkswhile roaming,soyoumaywanttocontrolyourphonesroamingbehaviorwithRoamingsettings. 1. Press 2. TapMore networks>Roamingtoconfigureoptions:

andthentap

>Settings>Connections. l Roaming network:Selectaroamingdefault,fromHomeonly,toonlyconnecttotheSprint network,orAutomatic,toallowconnectionstoSprintspartnernetworks,ifavailable. l Roaming settings:Chooseoptionsforroaming,includingVoiceanddataforDomestic CDMAandInternationalCDMAnetworks,andDataforGSMnetworks(ifavailable). l Roaming guard:Chooseoptionsforpreventingroamingforcertainfunctions.Enableor disableroamingaccessforVoiceanddataforDomesticCDMA,Voice,DataandOutgoing SMSforInternationalCDMAnetworks,andVoice,DataandOutgoingSMSforGSM networks(ifavailable). NFC Settings UseNFC(NearFieldCommunication)toshareinformationbetweenyourdeviceandanotherNFC devicebytouchingthedevicestogether,typicallyback-to-back. NFCisusedwithSBeamandAndroidBeam,andmustbeturnedOntousethesefeatures. Turn NFC On or Off UseNFC(NearFieldCommunication)toshareinformationbetweenyourdeviceandanotherNFC deviceorNFCtag,bytouchingthedevicestogether,typicallyback-to-back. andthentap

>Settings>Connections. 1. Press 2. TaptheON/OFFswitchbesideNFCtoturnNFCOnorOff. Android Beam WithAndroidbeam,youcantransmitappcontentviaNFCtootherNFCdevicesthatsupport AndroidBeam. AndroidBeamusesNFC,soNFCmustbeturnedOnbeforeyoucanturnonAndroidBeam. andthentap 1. Press 2. TaptheON/OFFswitchbesideNFCtoturnNFCOn.NFCmustbeontouseAndroidBeam. 3. TapNFCtoaccessAndroidBeamsettings,andthentaptheON/OFFswitchbesideAndroid

>Settings> Connections. BeamtoturnAndroidBeamOnorOff. Settings 102 S Beam Settings SharemoreandshareitfasterwithSBeam.Fromphotostodocuments,largevideofilestomaps, youcansharealmostanythinginstantlywithonetouch,simplybyplacingyourdevicesback-to-back. SBeamusesyourdevicesNFC(NearFieldCommunication)featuretosend,orbeam,contentto otherNFCdevices. SBeamworksinthebackground.Usethesharingoptionsfromyourfavoriteappstoselectcontent toshareviaSBeam.Forexample,youcanbeampicturesorvideosfromGallery,orsongsfrom Musicplayer.Justbringthedevicestogether(typicallybacktoback),andthentapthescreen. Turn S Beam On or Off WhenSBeamisturnedOn,youcansendorreceivedatabytouchingyourdevicetoanotherNFC-

capabledevice. andthentap

>Settings>Connections. 1. Press 2. TaptheON/OFFsliderbesideSBeamtoturnSBeamOnorOff. Nearby Devices SharefileswithdevicesusingDLNA(DigitalLivingNetworkAlliance)standards,overWi-Fi. TouseNearbydevices,youmustconnecttothesameWi-Finetworkasthedevicesyouwishto sharewith,andtheotherdevicesmustsupportDLNA. Note: Usecarewhenenablingfilesharing.Whenenabled,otherdevicescanaccessdataonyour device. 1. Press 2. TapNearby devicestoconfiguretheseoptions:

andthentap

>Settings>Connections. l TaptheON/OFFswitchbesideNearby devicestoturnNearbydevicesOn. l UnderAdvanced,touchoptionstocontrolhowcontentissharedfromyourdevice:

o Shared contents:Choosethetypeofcontenttoshare,fromVideos,Photos,orMusic. o Allowed devices list:Viewandmanagealistofdevicesallowedtoconnecttoyour device. o Not-allowed devices list:Viewandmanagealistofdevicesrestrictedfromconnecting toyourdevice. o Download to:Choosealocationtosavedownloadedcontent,fromdevicememoryor anoptionalinstalledSDcard(notincluded). o Upload from other devices:Choosehowtohandleincomingfilesfromotherdevices, fromAlwaysaccept,Alwaysask,orAlwaysreject. Settings 103 Screen Mirroring Settings WithScreenmirroring,youcanshareyourdevicesscreenwithanotherdevice,usinganoptional AllShareCastaccessory(notincluded). TurnScreenMirroringOnorOff 1. Press 2. TapScreen mirroring,andthentaptheON/OFFswitchbesideScreenMirroringtoturn

>Settings>Connections. andthentap ScreenmirroringOnorOff.

>HelptofindinstructionsforusingScreenmirroringtoconnecttoadevice. Note: Tap Lock Screen Configuresettingsforlockingthescreen,toimprovesecurity. Screen Lock Chooseascreenlock,todimandlockthescreen. 1. Press 2. TapLock screen>Screen lock. andthentap

>Settings>My device. 3. Choosesettings:

l Swipe:Whenenabled,youunlockthedevicebyswipingyourfingeracrossthescreen.This isthedefaultscreenlock,andoffersnosecurity. l Face unlock:Whenenabled,youunlockthedevicebylookingatthescreen.Thisoption offerslowsecurity,becausesomeonewholookssimilartoyoucouldunlockyourdevice.Tap theoptionformoreinformation,andtosetupFaceunlock. l Face and voice:Whenenabled,youunlockthedevicebylookingatthescreenand speaking.Thisoptionofferslowsecurity,becausesomeonewholooksand/orsoundssimilar toyoucouldunlockyourdevice.Touchtheoptionformoreinformation,andtosetupFace andvoiceunlock. l Pattern:Whenenabled,youdrawapattern,whichyoucreate,onthescreentounlockthe device.Touchtheoption,thenfollowthepromptstocreateorchangeyourscreenunlock pattern. l PIN:Whenenabled,youenteranumericPIN(PersonalIdentificationNumber),whichyou create,tounlockthedevice. l Password:Whenenabled,youenteranalphanumericpassword,whichyoucreate,to unlockthedevice. l None:Disableallcustomscreenlocksettings,tousethedefaultswipeunlockscreen. Settings 104 Lock Screen Options Whenyouhaveascreenlockset,youcansetLockscreenoptions.Availableoptionsdependonthe typeofscreenlock. MultipleWidgets WhenMultiplewidgetsisenabled,morethanonewidgetcanbedisplayedonthelockscreen 1. Press 2. TapLock screen,andthentapMultiple widgetstoenableordisabletheoption.

>Settings>My device. andthentap LockScreenWidgets Youcanchoosewidgetstodisplayonthelockscreen,foreasyaccesstofeatures,evenwhenthe screenislocked. 1. Press 2. TapLock screen>Lock screen widgetstoconfiguretheseoptions:

>Settings>My device. andthentap l Favorite apps or Camera:Whenenabled,youcanswipethelockscreenfromrighttoleft tolauncheitherFavoriteappsorCamera.TaptheON/OFFswitchbesideFavorite apps or CameratoturntheoptionOnorOff.WhenyouturntheoptionOn,selectFavoriteappsor Camera,tomakethewidget(s)availablefromtheLockscreen. l TapClock or personal messagetochoosewhethertodisplayaClock,orapersonal message,ontheLockscreen.Dependingontheoptionyouchoose,youcanthen customize:

o Clock widget options:WhenClockisselected,tapDual clocktodisplayadualclock whenroaming,toshowthetimeinyourhomenetworkarea,andthecurrentlocation. Youcanalsosetthesizeoftheclock,andsetoptionsshowingthedateandOwner information. o Edit personal information:WhenPersonalmessageisselected,taptocreatea personalmessagetodisplayonthelockscreen. Shortcuts Youcanchoosetohaveappshortcutsdisplayonthelockscreen,andchoosetheappstodisplay. ThisoptionisavailablewhentheSwipescreenlockisset. 1. Press 2. TapLock screen>Shortcutstoconfigureoptions:

andthentap

>Settings>My device. l TaptheON/OFFswitchbesideShortcutstoturntheoptionOnorOff.Theoptionmustbeon toconfigureappstodisplay. l Tapdefaultshortcutstoreplacethemwithanewappshortcutyouchoose. Settings 105 MakePatternVisible WhenyouhaveaPatternscreenlockset,youcanchoosewhetherthepatternisvisiblebrieflyas youdrawitonthelockscreen.ThisoptionisavailablewhenthePatternscreenlockisset. 1. Press 2. TapLock screen,andthentapthecheckboxbesideMake pattern visibletoturntheoption

>Settings>My device. andthentap OnorOff. LockAutomatically Whenyouhaveascreenlockset,youcanchooseatimeperiodforautomaticallylockingthescreen afterthescreenturnsoff,orchoosetohavethescreenlockimmediatelywhenthescreenturnsoff. 1. Press 2. TapLock screen,andthentapLock automaticallytochooseatimelocksetting.

>Settings>My device. andthentap LockInstantlyWithPowerKey Whenenabled,pressingthePowerKeylocksthescreenimmediately. 1. Press 2. TapLock screen,andthentapthecheckboxbesideLock instantly with power keytoturn

>Settings>My device. andthentap theoptionOnorOff. UnlockEffect Whenenabled,swipingyourfingeracrossthelockscreendisplaysaneffect. 1. Press 2. TapLock screen,andthentapUnlock effecttochooseRippleeffect,Lighteffect,orNone.

>Settings>My device. andthentap HelpText Whenenabled,helpfultipsdisplayonthelockscreen. 1. Press 2. TapLock screen,andthentapHelp texttoturntheoptiononoroff.

>Settings>My device. andthentap WakeUpInLockScreen Whenenabled,youcanpressthe unlockthescreen.ThisoptionisavailablewhentheSwipescreenlockisset. Home Key,andthenspeakawake-upcommandto 1. Press 2. TapLock screen,andthenconfiguretheseoptions:

andthentap

>Settings>My device. Settings 106 l Wake up in lock screen:Taptoenableordisabletheoption. l Set wake-up command:WhenWakeupinlockscreenisenabled,setoptionsforwake-up commands. Display Settings Configuresettingsforyourphonesdisplay. Wallpaper CustomizethebackgroundoftheHomeandLockscreens.Choosefrompreloadedwallpapers.or selectaphotoyouhavedownloadedortakenwiththeCamera. 1. Press andthentap 2. TapDisplay>Wallpaper. 3. Tapascreentocustomize,fromHome screen,Lock screen,orHome and lock screens.

>Settings>My device. 4. Chooseasourceforwallpaper:

l Gallery:SelectapicturefromGallery.Followthepromptstocropthepictureandsaveitas wallpaper. l Live wallpapers:Selectamovingsceneforthebackground(Homescreenonly). l Wallpapers:ChooseanimagefromtheWallpapersgallery. Notification Panel ConfigureoptionsfortheNotificationpanel,availablewhenyouswipeyourfingerdownfromStatus baratthetopofthescreen. AtthetopoftheNotificationpanel,youcancontrolsettingswiththeQuicksettingbuttons.Choose quicksettingbuttonsinNotificationpanelsettings. 1. Press 2. TapDisplay>Notification panel. andthentap

>Settings>My device. 3. Configuresettings:

l Brightness adjustment:Tapthecheckboxtodisplayasliderforadjustingthescreen brightnessontheNotificationpanel. l Set the quick setting buttons:QuicksettingbuttonsdisplayatthetopoftheNotification panel,toallowyoutosetfavoriteoptionsquickly.Touchandholdabutton,thendragitintoa newpositioninthelist. Multi Window Multiwindowallowsyoutousetwoappsonthesamescreen,inseparate,resizablewindows. Settings 107 YoucanenableMultiwindowinSettings,andthencontrolwhetheritdisplaysonthescreenby touchingandholdingonthe Back Key. andthentap

>Settings>My device. 1. Press 2. TapDisplay,andthentapthecheckboxbesideMulti windowtoenableordisabletheoption. Page Buddy WhenPagebuddyisturnedOn,yourphonedisplayscontext-relatedpagesontheHomescreen, dependingondevicestatus. Forexample,ifyouplugoptionalearphonesintoyourphones3.5mmHeadsetJack,yourphonecan displayaspecialpagewithmusicplaybackcontrols. 1. Press andthentap 2. TapDisplay>Page buddy. 3. Configureoptions:

>Settings>My device. l TaptheON/OFFswitchtoturnPagebuddyOnorOff. l Tapfeaturestoconfigure:

o Earphones page:Whenenabled,aspecialpagedisplayswhenyouplugoptional earphones(notincluded)intothe3.5mmHeadsetJack. o Docking page:Whenenabled,aspecialpagedisplayswhenyouplacethephoneinto anoptionaldockaccessory(notincluded). o Roaming page:Whenenabled,aspecialpagedisplayswhenyouleavethenetwork coverageareaandenterroamingmode. Note: TapPage buddy helpformoreinformation. Brightness Adjustyourscreensbrightnesstosuityoursurroundings. 1. Press 2. TapDisplay>Brightnesstoconfigureoptions:

andthentap

>Settings>My device. l TapthecheckboxnexttoAutomatic brightnesstoallowthephonetoadjustbrightness automatically. l Tosetacustombrightnesslevel,cleartheAutomaticbrightnesscheckmarkandthentouch anddragtheBrightness level. 3. TapOKtosavethesettings. Settings 108 Auto Rotate Screen WhenAutorotatescreenisenabled,thescreenautomaticallyupdateswhenyourotatethephone. SeeRotateformoreinformation. 1. Press 2. TapDisplay,andthetapthecheckboxnexttoAuto rotate screentoturnthefeatureOnor

>Settings>My device. andthentap Off. Note: YoucanalsocontrolscreenrotationfromNotifications,withtheScreenrotationsetting. Screen Timeout Screentimeoutletsyouselecthowlongthedisplayscreenremainslitafteryoupressanykey. andthentap

>Settings>My device. 1. Press 2. TapDisplay,andthentapScreen timeouttochooseatimeperiod. Daydream TheDaydreamsettingcontrolswhatthescreendisplayswhenthephoneisdocked,orwhile charging.YoucanchoosetodisplayaColorsscreen,ordisplayphotosstoredonyourphone. 1. Press 2. TapDisplay,andthentaptheON/OFFswitchnexttoDaydreamtoturntheoptionOnorOff.

>Settings>My device. andthentap WhenOn,youcanconfiguretheseoptions:

l Colors:Taptheselectortoenableordisabledisplayofacolorfulscreen. l Flipboard:DisplaypicturesfromFlipboard.Afterenablingtheoption,tap picturestodisplay. tochoose l Photo Frame:Displaypicturesinaphotoframe.Afterenablingtheoption,tap choosepicturestodisplay. l Photo Table:Displayofpicturesinaphototable.Afterenablingtheoption,tap choosepicturestodisplay. to to l TapStart nowtoswitchtodaydream. l TapSelect dream timetochoosewhendaydreamdisplays. Font Style Youcansetthefontforalltextthatdisplaysonthescreen. Settings 109 1. Press 2. TapDisplay,andthentapFont styletochooseafont.Followthepromptstosetitasthe

>Settings>My device. andthentap default. Tip: Tofindadditionalfontoptions,tapGet fontsonlinetoaccessnewfontsintheGooglePlay Storeapp. Font Size Thisoptionallowsyoutoselectthesizeoffontsforyourphonesscreens.

>Settings>My device. andthentap 1. Press 2. TapDisplay,andthentapFont sizetoselectasize. Touch Key Light Duration Thisfeatureallowsyoutosetthelengthoftimethe ofyourphoneremainlitafteryoutapthem. Menuand Backtouchkeysonthefront andthentap

>Settings>My device. 1. Press 2. TapDisplay,andthentapTouch key light durationtochooseadurationperiod. Display Battery Percentage ThebatterychargeleveldisplaysasaniconintheNotificationpanelbydefault.Thisfeatureallows youtodisplaythebatteryiconplusthepercentageofremainingcharge. 1. Press 2. TapDisplay,andthentapthecheckboxbesideShow battery percentagetoenableor

>Settings>My device. andthentap disabletheoption. Auto Adjust Screen Tone WhenAutoadjustscreentoneisenabled,yourdeviceautomaticallyanalyzesthescreenandadjusts thebrightnesstoconservebatterypower. 1. Press 2. TapDisplay,andthentapthecheckboxbesideAuto adjust screen tonetoenableordisable

>Settings>My device. andthentap theoption. LED Indicator Settings TheLEDindicatoronthefrontofthedevicedisplayswhenthedeviceislocked,tonotifyyouofstatus changesandevents.UseLEDindicatorsettingstoconfigurehowtheLEDfunctions. 1. Press 2. TapLED indicator,andthentapthecheckboxbesideoptionstoenableordisabletheoption:

>Settings>My device. andthentap Settings 110 l Charging:Whenenabled,theLEDglowsredduringcharging,andgreenwhenthebattery isfullycharged. l Low battery:Whenenabled,theLEDblinksredtoindicatelowbatterycharge. l Notifications:Whenenabled,theLEDblinksbluetoshowthatyouhavemissedcalls,new messages,orapplicationevents. l Voice recording:Whenenabled,theLEDblinksbluewhenrecordingwiththescreen turnedoff. Sound Settings UseSoundsettingstocontrolyourphonesaudio,fromringtonesandalertstotouchtonesand notifications. Volume Youcanadjustthevolumesettingstosuityourneedsandyourenvironment. Note: Youcanquicklyadjusttheringervolumeortheearpiecevolumeduringacallbypressingthe VolumeKey. 1. Press 2. TapSound,andthentapVolumetosetvolumelevels.Dragthesliderstosetthedefault

>Settings>My device. andthentap volumefor:

l Music, video, games, and other media l Ringtone l Notifications l System 3. TapOKtoassignthevolumelevels. Vibration Intensity Setthelevelforvibrationtoaccompanyringtonesandnotifications. 1. Press 2. TapSound,andthentapVibration intensitytosetvibrations.Dragthesliderstosetthe

>Settings>My device. andthentap vibrationintensityfor:

l Incoming call l Notification l Haptic feedback 3. TapOKtosavethesettings. Settings 111 Ringtones Choosearingtoneforincomingcalls.

>Settings>My device. 1. Press 2. TapSound,andthentapRingtonestochoosearingtone:

andthentap l Taparingtonetoselectit.Asyoutaparingtone,asampleplays. l TapAddtochooseamusictrackfromGoogleMusic,asoundfilefromDropbox,oruse SoundpickertochooseasongfromMusicplayer. 3. TapOKtosavethesetting. Vibrations Choosevibrationstoplayfornotifications,suchasforincomingcalls,newmessages,andevent reminders. 1. Press 2. TapSound,andthentapVibrationstochooseanotificationtone.

>Settings>My device. andthentap 3. Tapavibrationtoplayasampleandselectthesound. 4. TapOKtosavethesetting. Default Notification Sound Chooseasoundfornotifications,suchasfornewmessagesandeventreminders. 1. Press 2. TapSound,andthentapDefault notification soundtochooseanotificationtone.

>Settings>My device. andthentap 3. Tapasoundtoplayasampleandselectthesound. 4. TapOKtosavethesetting. Vibrate When Ringing WhenVibratewhenringingisenabled,avibrationplaysforcallsandnotifications,alongwiththe ringtoneorsound.YoucanusetheVibrationintensityandVibrationssettingstocustomizethe vibration. 1. Press 2. TapSound,andthentapthecheckboxnexttoVibrate when ringing toenableordisablethe

>Settings>My device. andthentap option. Dialing Keypad Tone WhenDialingkeypadtoneisenabled,tonesplaywhenyoutapkeysonthePhonekeypad. Settings 112 1. Press 2. TapSound,andthentapthecheckboxnexttoDialing keypad tonetoenableordisablethe

>Settings>My device. andthentap option. Touch Sounds WhenTouchsoundsisenabled,tonesplaywhenyoutaportouchthescreentomakeselections. andthentap

>Settings>My device. 1. Press 2. TapSound,andthentapthecheckboxnexttoTouch soundstoenableordisabletheoption. Screen Lock Sound WhenScreenlocksoundisenabled,tonesplaywhenyoutouchthescreentolockorunlockit. 1. Press 2. TapSound,andthentapthecheckboxnexttoScreen lock soundtoenableordisablethe

>Settings>My device. andthentap option. Haptic Feedback WhenHapticfeedbackisenabled,vibrationplayswhenyoutaptheMenuandBackkeys,andfor certainscreentouches. 1. Press 2. TapSound,andthentapthecheckboxnexttoHaptic feedbacktoenableordisablethe

>Settings>My device. andthentap option. Auto Haptic WhenAutohapticisturnedOn,thedevicevibratesautomaticallyinresponsetothesoundsofsome apps,suchasgames. andthentap

>Settings>My device. 1. Press 2. TapSound,andthentaptheON/OFFswitchnexttoAuto haptictoturnthefeatureOnorOff. Emergency Tone Youcanchoosetohaveatoneplay,orhaveyourphonevibrate,periodicallyduringanemergency call. 1. Press 2. TapSound,andthentapEmergency tonetoselectatone:

>Settings>My device. andthentap l Off:Notoneorvibrationplaysduringemergencycalls. l Alert:Atoneplaysduringemergencycalls. Settings 113 l Vibrate:Avibrationplaysduringemergencycalls. HDMI Audio Output ChoosethetypeofsoundoutputwhenyouattachyourphonetoanotherdeviceviaHDMIcable. 1. Press 2. TapSound,andthentapAudio outputtochoosewhethersoundisoutputasStereoor

>Settings>My device. andthentap Surround. Home Screen Mode Settings YourphoneofferstwoHomescreenmodes. n Standard modeprovidesaconventionallayoutforappsandwidgetsontheHomescreen. n Easy modeprovidesaneasierexperienceforthefirst-timesmartphoneuser. YoucanchoosetheHomescreenmodeatanytime. andthentap

>Settings>My device. 1. Press 2. TapHome screen mode,andthenchooseamode.TouchApplytosaveyourselection. Call Settings Configureoptionsforcallingwithyourphone. Call Rejection Createandmanagealistofphonenumbers,tohaveyourdeviceautomaticallyrejectcallsyou receivefromthosenumbers. 1. Press 2. TapCall,andthentapCall rejectiontoconfiguretheseoptions:

>Settings>My device. andthentap l Auto reject mode:Selectamodefrom:

o Off:Allcallsareallowed,nonearerejected. o All numbers:Callsfromallnumbersarerejected. o Auto reject numbers:CallsfromnumbersontheAutorejectlistarerejected. l Auto reject list:Entertelephonenumbers,torejectcallsfromthenumberswhenAuto rejectmodeisturnedOn. o Tap toenteratelephonenumber,orselectanumberfromacontact.TapMatch criteriatosetoptionsforusingtherejectnumberlist. Settings 114 o TapthecheckboxnexttoUnavailabletorejectcallswithnumbersthatdisplay UnavailableinCallerID. Set Up Call Rejection Messages Createandmanagetextmessagestosendtocallerswhenrejectingincomingcalls.Messagesyou createhereareavailablefromtheincomingcallscreenwhenyouusetheRejectwithmessage option. 1. Press 2. TapCall,andthentapSet up call rejection messagestomanagemessages:

>Settings>My device. andthentap l Tocreatenewmessages,tapCreate,thenfollowtheprompts. l Tomodifyanexistingmessage,tapthemessage,andtheneditthetext. Answering/Ending Calls Managesettingsforansweringandendingcalls. 1. Press 2. TapCall,andthentapAnswering/ending callstoconfiguretheseoptions:

>Settings>My device. andthentap l The home key answers calls:Whenenabled,youcananswerincomingcallsbypressing theHomekey. l Voice control:WhenturnedOn,youcananswercallsbyspeakingcommands.Tapthe ON/OFFswitchtoturnVoicecontrolOn,thentapVoice controltoconfiguretheIncoming callsoption.Whenenabled,youcananswerorrejectcallswiththevoicecommands AnswerandReject.Whenyouansweracallwithavoicecommand,theSpeakerwill automaticallyturnonforhands-freecalls. l The power key ends calls:Whenenabled,youcanendcallsbypressingthePowerkey.In thiscase,pressingthepowerkeyduringacallwillnotlockthescreen. Turn Off Screen During Calls Whenenabled,thescreenautomaticallyturnsoffduringphonecalls,andtheproximitysensoronthe frontofthedeviceisusedtoturnthescreenbackonwhenthedeviceismovedorbroughtcloseto anothersurface,suchaswhenyoumovethedevicetoyourear. andthentap

>Settings>My device. 1. Press 2. TapCall,andthentapTurn off screen during callstoenableordisablethesetting. Call Alerts Setoptionsforsoundsandvibrationstooccurduringcalls. 1. Press andthentap

>Settings>My device. Settings 115 2. TapCall,andthentapCall alertstoconfiguresettings:

l Vibrate on connection to network:Whenenabled,yourphonewillvibratewhenacall connectstothenetwork. l Call-end vibration:Whenenabled,thephonevibrateswhentheothercallerendsthecall. l Call connect tone:Whenenabled,thephoneplaysatonewhentheothercalleranswersa call. l Minute minder:Whenenabled,atoneplaysonceperminuteduringacall. l Call end tone:Whenenabled,thedeviceplaysatonewhentheothercallerendsthecall. l Alerts on call:Whenenabled,notificationsforalarmsandnewmessagesplayduringcalls. Whendisabled,thesenotificationswillbemutedduringacall. Call Accessories Configureoptionsforusingaheadsetforcalling. 1. Press 2. TapCall,andthentapCall accessoriestoconfiguresettings:

>Settings>My device. andthentap l Automatic answering:Whenenabled,andyouhaveaheadsetconnectedtotheHeadset Jack,incomingcallsareansweredautomaticallyafteradelay,whichyoucansetat Automaticansweringtimer.Taptoenableordisablethesetting. l Automatic answering timer:Chooseatimeperiodtodelaybeforeautomatically answeringanincomingcallwhenAutomaticansweringisenabledandaheadsetis connectedtothedevice.Taptochoose2 seconds,5 seconds,or10 seconds. l Outgoing call conditions:WhenthedeviceispairedwithaBluetoothheadset,youcan choosetomakecallsevenwhenthedeviceislocked.TaptochooseEven when device locked,orOnly when device unlocked. Ringtones and Keypad Tones Choosetonesandvibrationstoplayforincomingcallsandkeypadtaps. 1. Press 2. TapCall,andthentapRingtones and keypad tonestoconfiguresettings:

>Settings>My device. andthentap l TapRingtones,andthenselectaringtoneforincomingcalls.TapOKtosaveyour selection. l TapVibrations,andthenselectavibrationpatterntoplayforincomingcallswhenthe Vibratewhenringingoptionisenabled.YoucantapCreatetocreateacustompattern.Tap OKtosavethesettings. Settings 116 l TapVibrate when ringingtoplayavibrationforincomingcalls.Thevibrationpatternisset attheVibrationssetting. l TapthecheckboxnexttoDialing keypad tonetoenableordisabletonesforkeypadtaps. Personalize Call Sound Chooseoptionsforcallaudio,incaseswhereyoumightneedthesoundsofterormoreclear,or optimizedforyourrightorleftear. 1. Press 2. TapCall,andthentapPersonalize call sound. andthentap

>Settings>My device. 3. Tapasetting,andthenconfigureoptionsifavailable:

l In-call sound EQ:Chooseasettingforsoundsduringacall.Youcanchoosesoftorclear sound,oradaptsoundtoyourleftorrightear. l Adapt sound:TapStart,andthenfollowtheonscreenpromptstofindthebestsoundfor you. Noise Reduction Whenenabled,Noisereductionsuppressesbackgroundnoisefromyourenvironmentduringcalls. andthentap

>Settings>My device. 1. Press 2. TapCall,andthentapNoise reduction toenableordisablenoisereduction. Increase Volume In Pocket Whenenabled,thissettingusestheproximitysensortodetectwhenthedeviceisinapocketor otherclose-fittinglocationsuchasapurseorbag,andincreasesthevolumeforincomingcall ringtones. andthentap

>Settings>My device. 1. Press 2. TapCall,andthentapthecheckboxIncrease volume in pocket toenableorthesetting. US Dialing Whenenabled,theUSdialingoptionreplaces+withtheinternationalaccesscodeforyour location. andthentap

>Settings>My device. 1. Press 2. TapCall,andthentapthecheckboxnexttoUS dialingtoenableordisablethesetting. International Dialing WhenUSdialingisenabled,itusestheInternationaldialingcodetoreplace+.USdialingmustbe disabledtoaccesstheInternationaldialingcode. Settings 117 1. Press 2. TapCall,andthentapthecheckboxnexttoUS dialingtodisablethesetting.USdialingmust

>Settings>My device. andthentap bedisabledtoaccesstheInternationaldialingsetting. 3. TapInternational dialing,andthenusethekeypadtoentertheinternationaldialingcode. 4. TapOKtosavethecode. TTY Mode ATTY(teletypewriter,alsoknownasaTDDorTextTelephone)isatelecommunicationsphonethat allowspeoplewhoaredeaf,hardofhearing,orwhohavespeechorlanguagedisabilities,to communicatebytelephone. YourphoneiscompatiblewithselectTTYphones.PleasecheckwiththemanufacturerofyourTTY phonetoensurethatitsupportsdigitalwirelesstransmission.YourphoneandTTYphonewill connectusingaspecialcablethatplugsintoyourphonesheadsetjack.Ifthiscablewasnot providedwithyourTTYphone,contactyourTTYphonemanufacturertopurchasetheconnector cable. 1. Press 2. TapCall,andthentapTTY modetochooseamode,fromTTY Off,TTY Full,TTY HCO,or

>Settings>My device. andthentap TTY VCO. DTMF Tones SetthelengthofDual-toneMulti-frequency(DTMF)tones,whichplaywhenyouusethekeypad duringacall,suchaswhennavigatingmenus. andthentap

>Settings>My device. 1. Press 2. TapCall,andthentapDTMF tonestochooseatonelength,fromNormal,orLong. Voicemail Settings SetoptionsforVisualVoicemail. andthentap

>Settings>My device. 1. Press 2. TapCall,andthentapVoicemail settingstoconfigureoptionsforvoicemail. Voice Privacy Whenenabled,Voiceprivacyimprovesthesecurityofvoicecalls. 1. Press 2. TapCall,andthentapthecheckboxnexttoVoice privacytoenableordisableenhanced

>Settings>My device. andthentap privacymode. Settings 118 Blocking Mode Settings WhenBlockingmodeisenabled,notificationsforselectedfeaturesareblocked,andyouonly receivethenotificationsyouchoose.Youcanchoosetoblocknotificationsbyfeatureorcontact,and chooseblockingallthetime,orduringaspecifictimeperiod. 1. Press 2. TaptheON/OFFswitchnexttoBlocking modetoenableordisablethesetting.Blockingmode

>Settings>My device. andthentap mustbeenabledtoconfigureoptions. 3. WhenBlockingmodeisenabled,tapBlocking modetochooseoptions:

l Block incoming calls:Whenenabled,notificationsforincomingcallswillnotdisplay.Tap thecheckboxnexttotheoptiontoenableordisableit. l Turn off notifications:Whenenabled,notificationsfornewmessageswillnotdisplay.Tap thecheckboxnexttotheoptiontoenableordisableit. l Turn off alarm and timer:Whenenabled,notificationsforalarmsandtimerswillnot display.Tapthecheckboxnexttotheoptiontoenableordisableit. l Turn off LED indicator:Whenenabled,theLEDindicatorwillnotlightfornotifications, evenwhenthescreenisoff.Tapthecheckboxnexttotheoptiontoenableordisableit. 4. Setatimeperiodforblockingmode:

l TapthecheckboxnexttoAlways,toblocknotificationsatalltimes. l Tosetaspecifictimeperiodtoblocknotificationseachday,disabletheAlwaysoption,and thensetastarting(Fromfield)timeandendingtime(Tofield).Tapthetimefieldsandthen setthetime. 5. Chooseanoptionforblockingbycontact:

l TapAllowed contacts,andthenchooseanoption:

o None:Blockallnotifications,fromanycontact. o All contacts:Allownotificationsfromanycontact. o Favorites:Onlyallownotificationsfromcontactsmarkedasfavorites. o Custom:Allownotificationsfromcontactsyouspecify.Createalistofallowedcontacts bytappingAdd,andthenselectingcontactsfromContacts. l IfyouhavecreatedaCustomlistofallowedcontacts,youcantapAllowed contact listto modifythelistofallowedcontacts.ThisoptionisonlyavailablewhentheCustomlistis enabled. Settings 119 Hands-free Mode Settings Configuresettingsforusingyourphonewithouttouchingit,suchasannouncingincomingcallsand readingoutmessages. 1. Press 2. TapHands-free mode,andthentaptheON/OFFswitchbesideHands-free modetoturnthe

>Settings>My device. andthentap featureOnorOff. 3. AfteryouturnthefeatureOn,youcanconfigureoptions:

l Incoming call:Whenenabled,yourphonereadsoutthecallersinformationwhenyou receiveacall. l Message:Whenenabled,yourphonereadsoutthesendersinformationwhenyoureceive amessage. l Alarm:Whenenabled,yourphonereadsoutalarminformationwhenanalarmsounds. l Schedule:Whenenabled,yourphonereadsouteventinformationwhenareminder sounds. Power Saving Mode Settings ConfigurePowersavingmodesettingstoconservebatterypower. 1. Press 2. TapPower saving modetoconfigureoptions:

andthentap

>Settings>My device. l TaptheON/OFFswitchnexttoPower saving modetoturnthemodeOnorOff.Power savingmodemustbeturnedOntoconfiguresettings. l CPU power saving:Whenenabled,themaximumperformanceofthedevicesCPU

(CentralProcessingUnit)isdisabledtoconservebatterypower.Tapthecheckboxbeside theoptiontoewnableordisableit. l Screen power saving:Whenenabled,theframerefreshrateandbrightnesslevelare reducedtoconservepower.Tapthecheckboxbesidetheoptiontoenableordisableit. l Turn off haptic feedback:Whenenabled,Hapticfeedbackisdisabledtoconservebattery power.Tapthecheckboxbesidetheoptiontoenableordisableit. Note: TapLearn about Power saving modetoviewinformationaboutthesesettings. Accessory Settings Configureyourdevicesbehaviorwhenitisconnectedtoanoptionaldock(notincluded). 1. Press 2. TapAccessorytoconfiguresettings:

andthentap

>Settings>My device. Settings 120 l Dock sound:Whenenabled,asoundplayswhenyouinsertandremovethedevicefrom thedock. l Audio output mode:Whenenabled,audioplaysthroughthedockspeakerswhenthe deviceisdocked. l Desk home screen display:Whenenabled,displaysaspecialscreenwhenthedeviceis docked. l Audio output:Chooseadestinationforaudiooutputwhenyouconnecttodevicesvia HDMIcable. Accessibility Settings Yourdeviceoffersfeaturestomakeusingthedeviceeasierforthosewithcertainphysical disabilities.UseAccessibilitysettingstoconfigurethesefeatures. 1. Press 2. TapAccessibilitytoconfigureoptions:

andthentap

>Settings>My device. l TapAutorotate screentoenableordisableautomaticrotationofthescreenwhenyou rotatethephone. l TapScreen timeouttosetaperiodoftimeforthescreentoremainlit,afterwhichitwilldim andlock. l TapSpeak passwordstoallowthephonetoreadaloudpasswordinformation. l TapAnswering/ending callstoconfigurevariouswaystoanswerorendcalls. l TapShow shortcuttodisplayashortcuttoAccessibilitysettingsontheDeviceoptions menu.TheDeviceoptionsmenudisplayswhenyoupressandholdthePower/Lock Key. l Services:

o TapTalkBacktoactivatetheTalkBackfeatureandconfigureoptions. l Vision:

o TapFont sizetochangethesizeofthefontsusedonthescreen.ChooseTiny,Small, Normal,Large,orHuge. o TapMagnification gesturestocontrolwhetheryourphonerecognizesgesturesto pan,andzoominorout. o TapNegative colorstoreversethedisplayofonscreencolorsfromWhitetextona BlackbackgroundtoBlacktextonaWhitebackground. o TapAccessibility shortcuttocontrolwhetheryourdevicerecognizesagestureto quicklyenableaccessibilityfeatures.Tousethegesture,pressandholdthePower/Lock Keyuntilyouhearasoundorfeelavibration,thentouchandholdtwofingersonthe screenuntilyouhearanaudioconfirmation. Settings 121 o TapText-to-speech outputtoconfigureoptionsforconvertingtexttospeech.Formore information,seeText-to-SpeechOutput. l Hearing:

o TapSound Balancetocontrolthesignalsenttotheleftandrightwhenusing earphones. o TapthecheckboxnexttoMono audiotoenablestereoaudiotobecompressedintoa singlemonoaudiostreamforusewithasingleearphone. o TapthecheckboxnexttoTurn off all soundstomuteeverysoundmadebythephone. o TapthecheckboxnexttoFlash notificationtohaveyourphoneblinktheCameraflash fornotifications. l Mobility:

o TapthecheckboxnexttoPress and hold delaytochoosehowlongyourphonewaits whenyouholdyourfingeronthescreen,beforecontinuingwiththetapandholdaction. Language and Input Settings UseLanguageandinputsettingstochooseadefaultlanguageforyourphonesoperations,plus settingsfortextentryandotherinputs. Choose a Default Language Choosethelanguageforoperatingyourphone. andthentap

>Settings>My device. 1. Press 2. TapLanguage and input,andthentapLanguagetoselectalanguage. Set a Default Input Method Thefollowingprocedureallowsyoutoselectandsetthedefaultmethodyouwillusewhenaccessing thekeyboard. andthentap

>Settings>My device. 1. Press 2. TapLanguage and input,andthentapDefault toselectthedefaultinputmethod. Google Voice Typing Settings Googlevoicetypingallowsyoutospeakyourentries.WhenyouenableGooglevoicetyping,its availableforusewhenyoutouchafieldtoentertext. 1. Press 2. TapLanguage and input,andthentapthecheckboxnexttoGoogle voice typingtoenable

>Settings>My device. andthentap Settings 122 ordisablethefeature. 3. Tap besideGoogle voice typingtoconfigureoptions:

l Choose input languages:Selectlanguage(s)touseforvoiceinput,orchooseAutomatic toletGoogledecide. l Block offensive words:allowsyoutohiderecognizedoffensivewords. Samsung Keyboard TheSamsungKeyboardisanonscreenQWERTYkeyboard,soyoucanentertextbytypingon thekeyboard.Samsungkeyboardisenabledbydefault,andyoucanchooseoptionsforusingit. 1. Press andthentap

>Settings>My device. 2. TapLanguage and input,andthentap nexttoSamsung keyboardtoconfigurethese options:

l Select input languages:Chooselanguage(s)forusewithSamsungkeyboard.Whenyou havemorethanonelanguageenabled,youcanslideyourfingeronthespacebarwhile enteringtexttoswitchlanguages. l Predictive text:TaptheON/OFFswitchtoturnpredictivetextOnorOff.Predictivetext suggestswordsmatchingyourtextentries,andoptionally,completescommonwords automatically.TapPredictive texttoconfigureoptions:

o Personalized data:Whenenabled,predictivetextusespersonallanguagedatayou haveenteredtomakebetterpredictions.Samsungkeyboardcancollectallthetextyou enter,includingpersonaldataandcreditcardnumbers,inordertogivebetterprediction results. o Learn from Gmail:LogintoGmailtoallowyourdevicetolearnfromyourGmailemail. o Learn from Facebook:LogintoFacebooktoallowyourdevicetolearnfromyour Facebookpostings. o Learn from Twitter:LogintoTwittertoallowyourdevicetolearnfromyourTwitter postings. o Learn from Messages:Allowyourdevicetolearnfromyourtextandmultimedia messages. o Learn from Contacts:AllowyourdevicetolearnfromyourContactsentries. o Clear personal data:Removeallpersonalizeddatayouhaveentered. l Auto replacement:WhenturnedOn,predictivetextwillcompleteorreplacethewordyou aretypingwiththemostprobablewordwhenyoutaptheSpacebarorapunctuationmark. Settings 123 l Auto capitalization:Whenenabled,predictivetextautomaticallycapitalizeswordsinyour textbasedoncommonusage,suchasatthebeginningofsentences. l Auto spacing:Whenenabled,predictivetextautomaticallyinsertsspacesbetweenwords. l Autopunctuate:Whenenabled,aperiodandspaceareautomaticallyenteredtoenda sentence,whenyoutapthespacebartwice. l Keyboard swipe:Whenenabled,youcanentertextbyslidingyourfingeracrossthekeys onthekeyboard. o None:Whenenabled,SamsungKeyboardwillnotaccepttextentrybyswiping. o T9 Trace:Whenenabled,youcanentertextbyswipingyourfingeracrosslettersonthe keyboard. o Cursor control:Whenenabled,youcanslideyourfingeracrossthekeyboardtomove thecursortobeginenteringtext. l Key-tap feedback:Enableordisableoptionsforsoundorvibrationfeedbacktoyour onscreenkeyboardtouches. o Sound:Whenenabled,asoundplaysforyourkeytouches. o Vibration:Whenenabled,avibrationplaysforyourkeytouches. o Character preview:Whenenabled,thecharacterappearsinabubbleasyoutapkeys. o Tutorial:LearnaboutSamsungKeyboard. o Reset settings:Returnsettingstothedefaults. Swype Settings Swypeisanewwaytoentertextontouchscreens.Insteadoftouchingeachkeyindividually,use yourfingertotraceoverthelettersofaword.Foreachword,placeyourfingeronthefirstletterand glidetothesubsequentletters,liftingonthelastletter. 1. Press andthentap

>Settings>My device. 2. TapLanguage and input,andthentap nexttoSwypetoconfiguretheseoptions:

l Settings: SetSwypeoptions:

o Vibrate on keypress:Whenenabled,thedevicevibratesforyourSwypetouches. o Sound on keypress:Whenenabled,thedeviceplayssoundsforyourSwypetouches. o Pop-up on keypress:Whenenabled,thecharactersdisplaybrieflyasyoutapkeys. o Show complete trace:Whenenabled,Swypedisplaysthetraceofeachworduntilyou startthenextword. Settings 124 o Auto-capitalization:Whenenabled,Swypeautomaticallycapitalizesthefirstwordof sentences. o Auto-spacing:Whenenabled,Swypeautomaticallyinsertsspacesbetweenwordsas youcompletethem. o Next word prediction:Whenenabled,Swypepredictsthenextwordbasedonthe previousword. o Show Voice key:Whenenabled,aVoiceinputkeydisplaysontheSwypekeyboard. l My Words:ChooseoptionsforcustomizingSwypebasedonyourtextentries. o Backup & Sync:UseSwypeConnecttobackupyourwords. o Living Language:Whenenabled,Swypewillautomaticallyupdatewithpopularnew words. o Social integration:Logintoyourfavoritesocialnetworkingsitestouseyourentries theretoupdateSwype, o Edit my dictionary:ModifywordsaddedtoSwype. o Clear language data:DeleteallthewordsyouveaddedtotheSwypedictionary. o Contribute usage data:AllowNuancetocollectusagedatatoprovidebettertext prediction. o Cellular data:Whenenabled,Swypecanuseyourphonesconnectiontothewireless datanetworkforupdates,languagedownloads,andotherSwypeConnectfeatures. l Languages:ChoosethecurrentlanguageforSwype,anddownloadnewlanguagestouse withSwype. l Gestures:Learnaboutshortcutsyoucanuseonthekeyboardtoquicklyaccomplish commontasks. l Help:LearnaboutusingSwype. o How to Swype:LearnaboutusingSwype. o Show helpful tips:Whenenabled,tipsdisplayonthescreenasyouentertext. l Updates:CheckforupdatestoSwype,andinstallthemifdesired. Voice Search Settings TheVoiceSearchfeatureisavoice-activatedapplicationthatallowsyoutotellthephonewhatto searchforandthenthephoneactivatesaGooglesearchbasedonwhatyousaid. 1. Press 2. TapLanguage and input,andthentapVoice searchfortheseoptions:

>Settings>My device. andthentap l Language:Choosealanguageforvoicesearching. Settings 125 l Speech output:Chooseoptionsforspeechoutput. l Block offensive words:Whenenabled,wordsmanypeoplefindoffensivearenotshownin resultsofGooglevoicesearches.Offensivewordsarereplacedinresultswithaplaceholder

(####). l Hotword detection:Whenenabled,youcansayGoogletolaunchvoicesearch. l Personalized recognition:Whenenabled,Googleusesyourpersonalizedinformationto improvespeechrecognition. l Google Account dashboard:Manageyourcollecteddata. l Bluetooth headset:RecordsaudiothroughaBluetoothheadset,whenusinganoptional Bluetoothheadset(notincluded),pairedwithyourphone. Text-to-Speech Options Text-to-speech(TTS)providesaudiblereadoutoftext,forexample,thecontentsoftextmessages andtheCallerIDforincomingcalls. 1. Press 2. TapLanguage and input,andthentapText-to-speech optionstoconfigureoptions:

>Settings>My device. andthentap l Preferred TTS engine:SelectSamsungtext-to-speechengine,orGoogleText-to-speech Engine.Tap toconfigureoptions. l General:

o Speech rate:Choosearatefortextreadouts. o Listen to an example:Playanexampleofspeechusedforreadouts. Pointer Speed Adjustthespeedofthepointer,whenyouuseyourfingertoentertext. andthentap

>Settings>My device. 1. Press 2. TapLanguage and input,andthentapPointer speed. 3. Dragtheslidertosetthepointerspeed,andthentapOKtosaveyourselection. Motion Settings ConfigureMotionsettingstocontrolyourdevicebymovingit,orbyhandgestures. 1. Press 2. TapMotions toconfigurefeatures:

andthentap

>Settings>My device. Settings 126 l TaptheON/OFFswitchbesideMotionstoturnthefeatureOnorOff.WhenMotionsis turnedOn,youcanenableordisableindividualmotions:

l Motion:

o Direct call:Whenenabled,youcanliftthedevicetoyourearwhileviewingacontactto callthecontact. o Smart alert:Whenenabled,youcanliftthephonetoreceivenotificationsofmissedcalls andnotificationsthatoccurredwhilethedevicewasstationary. o Double tap to top:Whenenabled,youcantapthetopofthephonetwicetomoveto thetopofalist. o Tilt to zoom:Whenenabled,youcantiltthephonetozoominoroutwhenviewing picturesinGalleryorviewingawebpage. o Pan to move icon:Whenenabled,youcantouchandholdaniconontheHome screen,andthenmovethephoneinaside-to-sidetomovetheicontoanewpage. o Pan to browse images:Whenenabled,youcanmovethephoneinaside-to-side motionwhileviewinganimagetomovearoundtheimage. o Shake to update:Whenenabled,youcanshakethephonetoscanfornewdevices, suchasforaBluetoothscan. o Turn over to mute/pause:Whenenabled,youcanmuteincomingcallsandpause playbackbyturningthephonescreen-sidedown. l Sensitivity settings and tutorial:

o Sensitivity settings:Configuresettings,suchascalibratingthedevicesgyroscope, usedtodetectmotion,andothermotionoptions(whentheoptionsareenabled). o Learn about motions:Taptoviewdemonstrationsofeachmotion. l Hand motions:

o Palm swipe to capture:Whenenabled,youcansaveacopyofthecurrentscreenby swipingthesideofyourhandacrossthescreen. o Palm touch to mute/pause:Whenenabled,youcanmuteincomingcallsandpause playbackbycoveringthescreenwithyourhand. l Hand motion tutorial:

o Learn about hand motions:Taptoseedemonstrationsofhandmotions. Smart Screen Settings UseSmartscreenoptionstohaveyourphoneautomaticallyadjustscreentimeout,rotationwhenit detectsyouarelookingatthescreen,andcontrolscrollingandplaybackbasedwhetheryouare facingthescreen. Settings 127 Smartscreenoptionsusethefrontcameratodetectwhenyouarefacingthescreen.Somefactors thatmayaffecttheabilityofthefrontcameratodetectyourfaceare:

n Whenthephoneisnotdockedorheldupright,forexamplewhenplacedonatable. n Whenthefrontcameracannotdetectyourfaceandeyes. n Whenthefrontcameraisbeingusedforthecurrentapplication. n Whenthesourceoflightisbehindyou,orwhenusingthephoneinthedark. Smart Stay WhenSmartstayisenabled,thescreenwillnottimeoutaslongasyouarelookingatit. Whenenabled,theSmartstayicon displaysintheStatusbar. 1. Press 2. TapSmart screen,andthentapthecheckboxbesideSmart staytoenableordisablethe

>Settings>My device. andthentap option. Smart Rotation WhenSmartrotationisenabled,thescreenautomaticallyupdatestomatchtheangleatwhichyou areviewing. 1. Press 2. TapSmart screen,andthentapthecheckboxbesideSmart rotationtoenableordisablethe

>Settings>My device. andthentap option. Voice Control Settings WhenVoicecontrolisturnedOn,youcanusevoicecommandstocontrolyourphone. Note: Ifyousetthealerttypeforcallsornotificationstovibrate,voicecommandisnotavailable. 1. Press 2. TapVoice control,andthentaptheON/OFFswitchbesideVoice controltoturnthefeature

>Settings>My device. andthentap OnorOff. 3. AfteryouturnthefeatureOn,tapVoice controltosetoptions:

l Incoming calls:Whenenabled,youcananswerorrejectcallswiththevoicecommands AnswerandReject.Whenyouansweracallwiththevoicecommand,theSpeakerwill automaticallybeturnedonforhands-freetalking. l Alarm:Whenenabled,youcanstoporsnoozealarmswiththevoicecommandsStopand Snooze. Settings 128 l Camera:Whenenabled,youcantakepictureswiththevoicecommandsSmile,Cheese, CaptureandShoot. l Music:Whenenabled,youcancontrolthemusicplayerwiththevoicecommandsNext, Previous,Pause,Play,VolumeUp,andVolumeDown. Accounts Settings Whenyousetupaccountsonyourphone,suchasyourGoogleorSamsungaccounts,andyour emailorsocialnetworkingaccounts,youcansynchronizeaccountinformationbetweenyourphone andtheaccount.Typesofinformationyoucansynchronizeincludecontacts,pictures,videos,and othertypesoffiles. Youcanalsosetupoptionsforbackingupinformationfromyourphonetothecloud,andbackupor resetyourdevice. Add an Account Addanaccounttoyourphonetoshareinformationbetweenyourphoneandtheaccount. 1. Press 2. Chooseatypeofaccount,andthenfollowthepromptstoenteryouraccountcredentialsand

>Settings>Accounts. andthentap completetheaccountsetup. Backup Options Setupabackupaccountonyourphonetosaveinformationfromyourphonetotheaccount. 1. Press 2. Tapanoptiontoconfigurebackupfeatures:

andthentap

>Settings>Accounts. l Cloud:Configureoptionsforsynchronizingandbackingupinformation. o Add account:SignintoyourSamsungaccount,orcreateanewSamsungaccount. Youcansynccontacts,calendarevents,memos,andInternetshortcuts.Youcanback upLogs,SMSandMMSmessages,andcurrentwallpapersettings. o Link Dropbox account:SignintoyourDropboxaccount,orsetupanewaccount,to syncpictures,videosanddocuments. l Backup and reset:ConfigureoptionsforbackingupdatafromyourphonetoaGoogle account. o Back up my data:TapthecheckboxtoturnOnautomaticbackuptoaGoogleaccount, andthensetupanaccountforthebackups. o Backup account:WhenBackupmydataisturnedOn,setupaGoogleaccountfor backups.YoucansetupanewGoogleaccount,orsignintoanexistingaccount. Settings 129 o Automatic restore:WhenBackupmydataisturnedOn,youcanalsoturnon Automaticrestoretoautomaticallyrestoresettingsandotherinformationfromthe backupwhenyoureinstallanapp. o Factory data reset:Eraseallyourinformationfromthephone,andreturnthesettings tothefactorydefaults.Alldatawillbeerased,andcannotberecovered.Afactorydata resetalsoerasesthekeyfordecryptingfilesstoredonanoptionalinstalledmemorycard, sofilesonthecardcannotbeusedafterthereset. Location Services Settings Controlappsaccesstoyourlocation,andconfigurelocationsources. SomeappsmayrequireoneormorelocationservicesbeturnedOnforfullappfunctionality. GPSsignalsmaybeaffectedbyyoursurroundings,including:

n Buildings n Tunnelsorundergroundstructures n Weatherconditions n High-voltageorelectromagneticfields n Tintedwindows Note: E911locationserviceisstandardonallmobilephones,toallowsharingofGPSinformation withemergencypersonnelwhenyoumakeacalltoemergencyservices,suchas911. 1. Press 2. TapLocation servicestoconfigureoptions:

andthentap

>Settings>More. l Access to my location:TaptoturnlocationservicesOnorOff.WhenOn,youareallowing Googleslocationservicetocollectanonymouslocationdata.Somedatamaybestoredon yourdevice,andcollectionmayoccurevenwhennoappsarerunning. l Location sources:WhenAccesstomylocationisturnedOn,selectsourcesforlocation information. o Use GPS satellites:Whenenabled,yourphoneobtainslocationinformationfromGPS satellites. o Use wireless networks:Whenenabled,yourphoneobtainslocationinformationfrom Wi-Fiand/orwirelessnetworks. Security Settings Youcanencryptaccounts,settings,downloadedappsandtheirdata,media,andotherfiles.After encryption,youmustenterthePINorpasswordyouseteachtimeyouturnonyourphone.Youcan alsoencryptinformationstoredonanoptionalinstalledmemorycard(notincluded). Settings 130 Encryptionmaytakeanhourormoretocomplete.Startwithachargedbattery,andkeepthedevice onthechargeruntilencryptioniscomplete.Interruptingtheencryptionprocessmayresultintheloss ofsomeoralldata. 1. Press 2. TapSecurity,andthentapanoption:

andthentap

>Settings>More. l Encrypt device:TapSet screen lock typetostart,andthenfollowthepromptstoencrypt information. l Encrypt external SD card:TapSet screen lock typetostart,andthenfollowthe promptstoencryptinformation. Passwords UsetheMakepasswordsvisiblesettingtobrieflydisplaypasswordcharactersasyouenterthem intopasswordfields. 1. Press 2. TapSecurity,andthentapthecheckboxbesideMake passwords visibletoenableordisable

>Settings>More. andthentap thesetting. Device Administration Someapplications,suchasCorporateemail,mayrequireyouallowaccesstoyourdevicebydevice administratorsincertaincircumstances,suchasifyourdeviceislostorstolen. Somefeaturesadeviceadministratormightcontrolinclude:

n Settingthenumberoffailedpasswordattemptsbeforethedeviceisrestoredtofactorysettings. n Automaticallylockingthedevice. n Restoringfactorysettingsonthedevice. 1. Press 2. TapSecurity,andthentapanoption:

andthentap

>Settings>More. l Device administrators:Taptoview,add,orremovedeviceadministrators. l Unknown sources:Tapthecheckboxtoenableordisableyourphonesabilitytoinstall appsfromsourcesotherthanGooglePlayStore. l Verify apps:Tapthecheckboxtoenableordisableawarningbeforeinstallingappsthat maycauseharm. l Change security level:Chooseasecuritylevelfordeviceadministration. Security Update Service Chooseoptionsforupdatingyourphonessecuritypolicy. Settings 131 1. Press 2. TapSecurity,andthentapanoption:

andthentap

>Settings>More. l Security policy updates:Whenenabled,yourphonewillautomaticallycheckforchanges tothesecuritypolicyanddownloadanyupdates,toimprovesecurityandservice. l Via Wi-Fi only:Whenenabled,yourphonewillonlyupdatethesecuritypolicyautomatically whenitisconnectedtoaWi-Finetwork. Credential Storage Youcaninstallcredentialsfromanoptionalinstalledmemorycard(notincluded),andusethe Credentialstoragesettingstoallowapplicationstoaccessthesecuritycertificatesandother credentials. 1. Press 2. TapSecurity,andthentapanoption:

andthentap

>Settings>More. l Storage type:Displaysthetypeofcredentialsstored(notconfigurable). l Trusted credentials:Taptoviewcredentialsyouveinstalled. l Install from device storage:Taptoinstallencryptedcertificatesfromanoptionalinstalled memorycard(notincluded). l Clear credentials:Taptoclearstoredcredentialsandresetthepassword(onlyavailable whencredentialsareinstalled). Application Manager Settings YoucandownloadandinstallapplicationsfromtheGooglePlayStoreorSamsungApps,orcreate applicationsusingtheAndroidSDKandinstallthemonyourdevice.UseApplicationmanagerto manageapplicationsonyourdevice. Warning: Becausethisdevicecanbeconfiguredwithsystemsoftwarenotprovidedbyor supportedbyGoogleoranyothercompany,end-usersoperatethesedevicesattheirownrisk. 1. Press 2. TapApplication manager,andthentapDOWNLOADED,SD CARD,RUNNING,orALLto

>Settings>More. andthentap viewthestatusofappsandservices.Tapanapporserviceformoreinformation,andforapp options,suchasstoppinganduninstalling. Battery Settings Seewhatsusingbatterypower. 1. Press andthentap

>Settings>More. Settings 132 2. TapBatterytoviewbatteryusageforappsandservices.Tapanitemformoreinformation,orto configureoptionsformanagingpoweruse. Storage Settings ManagetheuseofmemoryresourcesinyourphonesDevicememory,andonanoptionalinstalled memorycard(notincluded). 1. Press 2. TapStoragetoviewinformationaboutmemoryusage,andforotheroptions:

>Settings>More. andthentap l Device memory:Viewmemoryusageforthedifferenttypesofinformationstoredonyour phonesmemory.Tapanitemformoreinformation. l SD card:Viewmemoryusageforthedifferenttypesofinformationstoredonanoptional installedmemorycard(notincluded). o Mount SD card:Prepareanoptionalinstalledmemorycardforuseasstorageinthe phone.Thisoptionisonlyavailableifanoptionalmemorycardisinstalled,andisnot alreadymounted.Usually,yourphonemountsamemorycardassoonasyouinstallit. o Unmount SD card:Prepareanoptionalinstalledmemorycardforsaferemovalor formatting. o Format SD card:Permanentlyremoveallcontentfromanoptionalinstalledmemory card.Afterformatting,thecontentcannotberetrieved. Date and Time Settings Yourphoneobtainsitstimeanddateinformationbyusingthenetwork-provideddate,time,andtime zone.Thesevaluescanbemanuallyaltered. 1. Press 2. TapDate and timetoconfiguresettings:

andthentap

>Settings>More. l Automatic date and time:Whenenabled,thedevicetakesdateandtimeupdatesfromthe wirelessnetwork. l Set date:Enterthecurrentdate(onlyavailablewhenAutomaticdateandtimeisdisabled). l Set time:Enterthecurrenttime(onlyavailablewhentheAutomaticsettingisdisabled). l Automatic time zone:Whenenabled,thedevicetakesthetimezonefromthewireless network. l Select time zone:Chooseyourlocaltimezone(onlyavailablewhentheAutomaticsetting isdisabled). l Use 24-hour format:Settheformatfortimedisplays. l Select date format:Settheformatfordatedisplays. Settings 133 Activate This Device Connecttothenetworkandactivateyourdevice.Ifyourdeviceisalreadyactivated,usethisoption toviewinformationaboutyourplanandusage. andthentap

>Settings>More. 1. Press 2. TapActivate this device,andthenfollowthepromptstoactivateyourdeviceonthenetwork. System Update Settings UseSystemupdateoptionstoupdateyourphonesinternalsoftware. 1. Press 2. TapSystem Updatetousetheseoptions:

andthentap

>Settings>More. l Update PRL:DownloadandthelatestPreferredRoamingList(PRL),usedbyyourphone toaccessthenetwork. l Update Profile:Updatetheuserprofilerelatedtoyourwirelessserviceaccount.Ifyou choosetochangeyourusernameonline,usethisoptiontoupdatetheusernameonyour phone. l Update Samsung Software:Upgradetothelatestsoftwareavailableforyourdevice. l Update Firmware:Updateyourphonesfirmware.Followthepromptstodownloadand installtheupdate. About Device Settings TheAboutDevicemenuletsyouaccessimportantphoneinformationaboutyourphone. 1. Press 2. TapAbout device,andthentapitemsformoredetails:

>Settings>More. andthentap l Status:Viewinformationaboutyourdevicescurrentstatus. l Legal information:DisplayOpensourcelicenses,configureLicensesettings(including yourDivXVODregistration),andviewGooglelegalinformationandaPrivacyAlert.. l Device name:Viewyourdevicesname,andenteranewnameifdesired. l Model number:Viewyourdevicesmodelnumber. l Android version:Viewthefirmwareversionofyourdevice. l Baseband version:Viewthebasebandversionofyourdevice. l Kernel version:Viewthekernelversionofyourdevice. l Build number:Viewthebuildnumberofyourdevice. Settings 134 l SE for Android status:ViewinformationaboutyourphonesAndroidstatus. l Hardware version:Viewthehardwareversionofyourdevice. Settings 135 Copyright Information 2013Sprint.SprintandthelogoaretrademarksofSprint.Othermarksaretrademarksoftheir respectiveowners. 2013Samsung.Samsung,GalaxyS,andSBeamaretrademarksofSamsungElectronicsCo., Ltd. 2013Google.Gmail,Hangouts,GoogleMaps,YouTube,Android,Google,Picasa,GoogleBooks, GoogleMobileServices,andGooglePlayaretrademarksofGoogle,Inc. Othermarksarepropertyoftheirrespectiveowners. Screenimagessimulated. Appearanceofdevicemayvary. Theactualavailablecapacityoftheinternalmemoryislessthanthespecifiedcapacitybecausethe operatingsystemanddefaultapplicationsoccupypartofthememory.Theavailablecapacitymay changewhenyouupgradethedevice. Copyright Information 136 4GServices67 4 A AboutDevice134 Accessibility122 Settings122 AccessibilitySettings121 AccessorySettings120 Accounts38 Email40 Gmail38 Google38 SocialNetwork50 AccountsandSync129 Activation3,134 AddanAccount129 AirplaneMode100 AlarmandTimer86 AnsweraCall26 AnsweringCalls115 ApplicationManager132 Apps53 AutoHaptic113 B BackKey8 BackupOptions129 Battery Install1 BatterySettings132 BlockingModeSettings119 Bluetooth69,82 ConfigureBluetoothSettings99 ConnecttoaCarKit69 ReceiveInformation72 ReconnectHeadsetorCarKit70 SendInformation71 TurnOnandOff98 TurnOnorOff69 Unpair70 BluetoothSettings98 Browser66 Index C Calculator87 Calendar86 AddEvent86 EraseEvents87 ViewEvents87 CallAccessories116 CallAlerts115 CallEmergencyNumbers25 CallRejection114 CallRejectionMessages115 CallSettings114 Camera8,74 ChatON50 ChooseDefaultLanguage122 Clock86 Contacts32 AccessingContacts32 Add32 AddingEntriestoYourFavorites35 ContactPicture34 ContactRingtone34 DeleteContact35 Edit33 GetStarted32 Link35 SaveaNumber33 Share36 ContactsGroups35 AddingContacts36 CreatingaNewGroup35 SendingaMessagetoaGroup36 CorporateEmail Creation40 CreateGoogleAccount38 CredentialStorage132 D Data66 DataServices66 Password5 YourUserName66 DataUsage99 DateandTime133 Index 137 DefaultNotificationSound112 DeviceAdministration131 DialingKeypadTone112 DisplaySettings107 AutoAdjustScreenTone110 AutoRotateScreen109 BatteryLevel110 Brightness108 Daydream109 FontSize110 FontStyle109 MultiWindow107 NotificationPanel107 PageBuddy108 ScreenTimeout109 TouchKeyLight110 Wallpaper107 LocateVODRegistrationNumber55 RegisterYourDivXDevice55 DivX54 Downloads88 Drag11 Dropbox88 AccessonYourPhone88 DownloadDesktopApplication88 UplaodPicture88 DTMFTones118 E Earpiece7 EditContact33 EditEmailSettings43 EditingText21 Email40 AddAccount40 Compose41 CorporateAccounts40 DeleteAccount45 ManageInbox42 ViewandReplytoEmail41 EmailMessage Makecallfrom25 EmergencyTone113 EndingCalls115 Enhanced911(E911)25 EnterText19 ExtendedHomeScreen17 Flash8 Flick11 Flipboard51 Frontcamera7 F G ReadandReplytoGmailMessages39 WorkingwithPhotos81 ZoomInorOut81 G+Photos83 Gallery79 GameHub56 Gestures9 GetStarted1 Gmail Google Google+52 Maps63 PlayBooks56 PlayMagazines56 PlayMovies&TV58 PlayMusic60 Search89 VoiceTyping19 Wallet94 GooglePlayStore56 CheckoutAccount57 InstallanApp56 GoogleSearch58 GoogleVoiceTyping19,122 Configuring20 Using19 Google+52,83 GroupPlay84 H Hands-freeModeSettings120 Hangouts52 HapticFeedback113 HDMIAudioOutput114 HeadsetJack8 Help89 HomeKey8 HomeScreen15 Extended17 Shortcuts15 Widgets16 Index 138 HomeScreenModeSettings114 N I In-callOptions29 IncomingCall Answer26 Reject26 IncreaseVolumeinPocket117 InternationalDialing117 K KeyFunctions7 Keyboard123-124 Samsung123-124 Touchscreen19 KeypadTones116 L LanguageandInput122 LaunchWebConnection66 LEDIndicator110 LocationServices130 LockScreenOptions105 M ManagingMessageConversation46 Maps63 MediaHub58 MenuKey8 Messaging38,46 Options48 Microphones8 microSDCard89 MobileNetworks100 MoreNetworkSettings100 MoreServices90 MotionSettings126 MultiWindow14 Music GooglePlayMusic60 MusicHub61 MusicPlayer61 MusicHub61 MusicPlayer61 MyFiles90 Navigation Maps63 Scout62 NearbyDevices103 NetworkSettings Roaming102 Tethering101 NewMessagesNotification46 NFC102 AndroidBeam102 TurnOnorOff102 NoiseReduction117 NotificationIcons18 O OpenanInstalledApp57 P PaperArtist83 Passwords131 PersonalizeCallSounds117 Phone23 Externalfeaturesandbuttons1 Layout7 Navigation9 PhoneBasics7 PhoneCallOptions27 PhoneCalls 3-wayCalling28 AnsweranIncomingCall26 CallaNumberinaTextMessage24 CallForwarding28 CallfromContacts24 CallfromLogs23 CallWaiting28 CallerID27 DialingOptions27 Fromemailmessages25 Fromtextmessages25 Makecalls23 MutetheRingingSound26 Receive25 RejectaCallwithaTextMessage26 RejectanIncomingCall26 SpeedDialing30 Usingphonedialpad23 Usingrecentcalls23 Index 139 Picasa83 PictureOptions74 Pinch13 PlayBooks56 PlayMagazines56 PlayMovies&TV58 PlayMusic60 PointerSpeed126 PowerKey7 PowerSavingModeSettings120 Proximitysensor7 R RecentCalls31 Clear31 Makecallfrom23 Options31 View31 ViewLogs31 RecentlyUsedApps17 RejectIncomingCall26 Ringtones112,116 Rotate12 S SBeam103 SMemo91 CreateNewSMemo92 SSuggest93 SVoice93 SamsungHub58 Samsungkeyboard19 SamsungKeyboard20,123-124 SamsungLink53 ConfigureSettings53 ShareMedia54 Scout62 ScreenLock104 ScreenLockSound113 ScreenMirroringSettings104 SDCard89 Format90 Insert89 Remove89 Unmount90 ViewMemory90 Search(Google)89 Security ScreenLock104 SecuritySettings130 SecurityUpdateService131 SendGmailMessage39 SendMessage46 SetDefaultInputMethod122 SetUpScreenLock73 Settings95 Accessibility122 AccountsandSync129 DataUsage99 DateandTime133 Display107 LanguageandInput122 LEDIndicator110 Sound111 Storage133 Wi-Fi95 SetupApplication3 SharePictureswithShareShot76 Shortcuts16 Slide10 SmartRotation128 SmartScreenSettings127 SmartStay128 SocialNetworkAccounts50 Sound Settings111 Speaker8 Spread13 Sprint4116 SprintAccount Information5 Manage5 Passwords5 Services6 SprintHotspot68 Connection69 Settings69 SprintHotspotSettings97 AllowedDevices98 SprintMusicPlus61 SprintOperatorServices6 SprintTV&Movies60 SprintZone63 StatusBar18 StatusIcons18 Index 140 Storage Settings133 Swipe10 Swype19-20 SystemUpdateSettings134 T TakePictures74 Text-to-Speech126 TextEditing21 TextEntry19 TextInput Methods19 TextMessaging Makecallfrom25 Tools86 Touch9 TouchandHold9 TouchSounds113 Touchscreen Keyboard19 Turnoff8 Turnon9 TTYMode118 TurnOffScreenDuringCalls115 TurnPhoneOff8 TurnPhoneOn8 TurnSBeamOnorOff103 TurnScreenOff8 TurnScreenOn8 Typing19 U UninstallanApp57 USDialing117 USBCharger/Accessoryport8 V VibrateWhenRinging112 VibrationIntensity111 Vibrations112 Video74 VideoOptions78 VideoPlayer63 Videos Record77 Sharing82 ViewPhotosandVideos80 VisualVoicemail27 VoiceControlSettings128 VoicePrivacy118 VoiceRecorder93 VoiceSearch93 VoiceSearchSettings125 VoiceTyping19 Configuring20 Using19 Voicemail26 Notification26 Password5 RetrieveYourVoicemailMessages26 Setup4 Visual27 VoicemailSettings118 Volume111 VPN72,101 AddVPNConnection73 ConnecttoVPN73 PreparePhoneforVPN72 VPNClient94 W Wallet94 Wallpaper Web66 Wi-Fi67 Settings107 ConnecttoWi-Fi67 Settings95 Wi-FiSettings Configure95 OtherSettings96 TurnWi-FiOnorOff95 Wi-FiDirect97 Y Z YouTube52,83 Zoom13 Index 141